F481406
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 801 | 316 | 1602 | 44 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100170450|Ga0070671_1001704503 |
| Length | 45 |
| Sequence | VLEVGEKAPLDAVVWTTPRETASIGDLLHDRPVLLLFYLFDWSTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 67 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 104 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 171 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 194 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 203 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 207 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 257 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 13.36 |
| Rhizosphere | 85.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 29.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070671_100170450 | 3300005355 | Unclassified | 1841 |
| 2 | JGI25407J50210_10014397 | 3300003373 | Unclassified | 2038 |
| 3 | Ga0070658_10060393 | 3300005327 | Bacteria | 3087 |
| 4 | Ga0070658_10234554 | 3300005327 | Bacteria | 1554 |
| 5 | Ga0070658_10407886 | 3300005327 | Bacteria | 1168 |
| 6 | Ga0070676_11105505 | 3300005328 | Bacteria | 599 |
| 7 | Ga0070683_100001965 | 3300005329 | Bacteria | 16104 |
| 8 | Ga0070683_100085673 | 3300005329 | Bacteria | 2954 |
| 9 | Ga0070683_100100210 | 3300005329 | Unclassified | 2727 |
| 10 | Ga0070683_100160682 | 3300005329 | Archaea | 2132 |
| 11 | Ga0070683_100283906 | 3300005329 | Bacteria | 1575 |
| 12 | Ga0070683_100442113 | 3300005329 | Bacteria | 1241 |
| 13 | Ga0068869_100657955 | 3300005334 | Unclassified | 890 |
| 14 | Ga0068869_101032634 | 3300005334 | Bacteria | 717 |
| 15 | Ga0070680_100054604 | 3300005336 | Bacteria | 3262 |
| 16 | Ga0070680_100057858 | 3300005336 | Bacteria | 3170 |
| 17 | Ga0070680_100167387 | 3300005336 | Bacteria | 1849 |
| 18 | Ga0070680_100199537 | 3300005336 | Unclassified | 1687 |
| 19 | Ga0070680_100297696 | 3300005336 | Bacteria | 1368 |
| 20 | Ga0070680_100673508 | 3300005336 | Unclassified | 890 |
| 21 | Ga0070680_100948087 | 3300005336 | Bacteria | 743 |
| 22 | Ga0070680_101015013 | 3300005336 | Bacteria | 717 |
| 23 | Ga0070682_100049950 | 3300005337 | Bacteria | 2609 |
| 24 | Ga0070682_100250017 | 3300005337 | Bacteria | 1278 |
| 25 | Ga0070682_100260954 | 3300005337 | Unclassified | 1254 |
| 26 | Ga0070682_100763989 | 3300005337 | Bacteria | 782 |
| 27 | Ga0070660_100006774 | 3300005339 | Bacteria | 7953 |
| 28 | Ga0070660_100042046 | 3300005339 | Bacteria | 3487 |
| 29 | Ga0070660_100131069 | 3300005339 | Bacteria | 2006 |
| 30 | Ga0070660_100248633 | 3300005339 | Unclassified | 1450 |
| 31 | Ga0070660_101024979 | 3300005339 | Unclassified | 698 |
| 32 | Ga0070660_101493189 | 3300005339 | Unclassified | 575 |
| 33 | Ga0070691_10031215 | 3300005341 | Bacteria | 2498 |
| 34 | Ga0070687_100167628 | 3300005343 | Bacteria | 1304 |
| 35 | Ga0070661_100016325 | 3300005344 | Bacteria | 5249 |
| 36 | Ga0070661_100290265 | 3300005344 | Bacteria | 1271 |
| 37 | Ga0070692_11079836 | 3300005345 | Unclassified | 566 |
| 38 | Ga0070668_100306629 | 3300005347 | Unclassified | 1333 |
| 39 | Ga0070674_100076353 | 3300005356 | Bacteria | 2382 |
| 40 | Ga0070659_100172007 | 3300005366 | Bacteria | 1775 |
| 41 | Ga0070659_100213722 | 3300005366 | Bacteria | 1590 |
| 42 | Ga0070659_100230143 | 3300005366 | Bacteria | 1532 |
| 43 | Ga0070709_10057126 | 3300005434 | Bacteria | 2471 |
| 44 | Ga0070709_10331003 | 3300005434 | Bacteria | 1120 |
| 45 | Ga0070709_10835854 | 3300005434 | Bacteria | 725 |
| 46 | Ga0070709_11520769 | 3300005434 | Bacteria | 544 |
| 47 | Ga0070714_100022366 | 3300005435 | Bacteria | 5184 |
| 48 | Ga0070714_100024073 | 3300005435 | Bacteria | 5010 |
| 49 | Ga0070714_100100588 | 3300005435 | Bacteria | 2546 |
| 50 | Ga0070714_100120764 | 3300005435 | Bacteria | 2331 |
| 51 | Ga0070714_100353378 | 3300005435 | Unclassified | 1381 |
| 52 | Ga0070714_100412946 | 3300005435 | Bacteria | 1278 |
| 53 | Ga0070714_100473636 | 3300005435 | Bacteria | 1192 |
| 54 | Ga0070714_101757267 | 3300005435 | Bacteria | 606 |
| 55 | Ga0070713_100309764 | 3300005436 | Unclassified | 1456 |
| 56 | Ga0070713_101676305 | 3300005436 | Bacteria | 617 |
| 57 | Ga0070713_102251532 | 3300005436 | Unclassified | 528 |
| 58 | Ga0070710_10915991 | 3300005437 | Unclassified | 634 |
| 59 | Ga0070711_100979823 | 3300005439 | Unclassified | 725 |
| 60 | Ga0070711_101375974 | 3300005439 | Bacteria | 614 |
| 61 | Ga0070711_101481455 | 3300005439 | Unclassified | 592 |
| 62 | Ga0070705_101889443 | 3300005440 | Unclassified | 508 |
| 63 | Ga0070694_101293927 | 3300005444 | Unclassified | 613 |
| 64 | Ga0070708_100874745 | 3300005445 | Unclassified | 844 |
| 65 | Ga0070663_101067542 | 3300005455 | Bacteria | 705 |
| 66 | Ga0070678_100060414 | 3300005456 | Bacteria | 2790 |
| 67 | Ga0070678_101693960 | 3300005456 | Bacteria | 595 |
| 68 | Ga0070662_101719090 | 3300005457 | Unclassified | 542 |
| 69 | Ga0070681_10010582 | 3300005458 | Bacteria | 9113 |
| 70 | Ga0070681_10051502 | 3300005458 | Bacteria | 4107 |
| 71 | Ga0070681_10052212 | 3300005458 | Bacteria | 4077 |
| 72 | Ga0070681_10065501 | 3300005458 | Bacteria | 3602 |
| 73 | Ga0070681_10739791 | 3300005458 | Bacteria | 900 |
| 74 | Ga0070685_11001008 | 3300005466 | Bacteria | 627 |
| 75 | Ga0070706_100445552 | 3300005467 | Unclassified | 1205 |
| 76 | Ga0070706_100546191 | 3300005467 | Bacteria | 1078 |
| 77 | Ga0070706_100760288 | 3300005467 | Bacteria | 898 |
| 78 | Ga0070706_100944349 | 3300005467 | Unclassified | 796 |
| 79 | Ga0070698_100050508 | 3300005471 | Bacteria | 4239 |
| 80 | Ga0070698_100283258 | 3300005471 | Bacteria | 1589 |
| 81 | Ga0070698_100639497 | 3300005471 | Bacteria | 1005 |
| 82 | Ga0070698_101598910 | 3300005471 | Bacteria | 604 |
| 83 | Ga0070679_100094296 | 3300005530 | Bacteria | 2980 |
| 84 | Ga0070679_100148752 | 3300005530 | Bacteria | 2319 |
| 85 | Ga0070679_100173337 | 3300005530 | Bacteria | 2130 |
| 86 | Ga0070679_100509105 | 3300005530 | Unclassified | 1148 |
| 87 | Ga0070684_100035813 | 3300005535 | Bacteria | 4250 |
| 88 | Ga0070684_100088781 | 3300005535 | Archaea | 2747 |
| 89 | Ga0070684_100660067 | 3300005535 | Bacteria | 974 |
| 90 | Ga0070684_100782456 | 3300005535 | Unclassified | 891 |
| 91 | Ga0070684_101263765 | 3300005535 | Unclassified | 695 |
| 92 | Ga0070684_101726081 | 3300005535 | Bacteria | 591 |
| 93 | Ga0070684_101893916 | 3300005535 | Bacteria | 563 |
| 94 | Ga0070697_101627173 | 3300005536 | Bacteria | 577 |
| 95 | Ga0068853_100193755 | 3300005539 | Bacteria | 1847 |
| 96 | Ga0068853_100241166 | 3300005539 | Unclassified | 1657 |
| 97 | Ga0068853_101074290 | 3300005539 | Bacteria | 776 |
| 98 | Ga0070686_100213117 | 3300005544 | Bacteria | 1392 |
| 99 | Ga0070695_100492968 | 3300005545 | Unclassified | 946 |
| 100 | Ga0070696_100188254 | 3300005546 | Unclassified | 1535 |
| 101 | Ga0070696_100751915 | 3300005546 | Unclassified | 799 |
| 102 | Ga0070693_100019770 | 3300005547 | Bacteria | 3539 |
| 103 | Ga0070693_101066373 | 3300005547 | Bacteria | 614 |
| 104 | Ga0070693_101194243 | 3300005547 | Bacteria | 584 |
| 105 | Ga0070665_101378818 | 3300005548 | Bacteria | 714 |
| 106 | Ga0070665_101639639 | 3300005548 | Unclassified | 651 |
| 107 | Ga0070665_101645139 | 3300005548 | Bacteria | 650 |
| 108 | Ga0070704_102306903 | 3300005549 | Unclassified | 501 |
| 109 | Ga0068855_100012292 | 3300005563 | Bacteria | 10344 |
| 110 | Ga0068855_100108170 | 3300005563 | Bacteria | 3194 |
| 111 | Ga0068855_102517638 | 3300005563 | Bacteria | 512 |
| 112 | Ga0070664_101008072 | 3300005564 | Unclassified | 783 |
| 113 | Ga0068857_101206576 | 3300005577 | Bacteria | 733 |
| 114 | Ga0068857_102083425 | 3300005577 | Unclassified | 557 |
| 115 | Ga0068857_102401975 | 3300005577 | Bacteria | 518 |
| 116 | Ga0068854_100315037 | 3300005578 | Unclassified | 1270 |
| 117 | Ga0068854_100481605 | 3300005578 | Bacteria | 1042 |
| 118 | Ga0068856_100031190 | 3300005614 | Bacteria | 5214 |
| 119 | Ga0068856_100076587 | 3300005614 | Bacteria | 3314 |
| 120 | Ga0068856_100234236 | 3300005614 | Unclassified | 1851 |
| 121 | Ga0068856_101395520 | 3300005614 | Bacteria | 715 |
| 122 | Ga0068856_102190179 | 3300005614 | Bacteria | 562 |
| 123 | Ga0070702_100678482 | 3300005615 | Bacteria | 783 |
| 124 | Ga0068852_100379284 | 3300005616 | Bacteria | 1387 |
| 125 | Ga0068852_100385339 | 3300005616 | Bacteria | 1376 |
| 126 | Ga0068852_101314657 | 3300005616 | Archaea | 745 |
| 127 | Ga0068864_102286806 | 3300005618 | Unclassified | 547 |
| 128 | Ga0068866_11012075 | 3300005718 | Bacteria | 591 |
| 129 | Ga0068861_100311793 | 3300005719 | Bacteria | 1367 |
| 130 | Ga0068870_10548219 | 3300005840 | Unclassified | 778 |
| 131 | Ga0068860_101321683 | 3300005843 | Unclassified | 742 |
| 132 | Ga0068860_102347656 | 3300005843 | Bacteria | 554 |
| 133 | Ga0081455_10017287 | 3300005937 | Bacteria | 6922 |
| 134 | Ga0081455_10280047 | 3300005937 | Bacteria | 1205 |
| 135 | Ga0081455_11057422 | 3300005937 | Unclassified | 502 |
| 136 | Ga0081538_10006374 | 3300005981 | Bacteria | 10408 |
| 137 | Ga0070717_10834039 | 3300006028 | Bacteria | 839 |
| 138 | Ga0075365_10212880 | 3300006038 | Bacteria | 1355 |
| 139 | Ga0070715_10236354 | 3300006163 | Unclassified | 948 |
| 140 | Ga0070716_100334727 | 3300006173 | Bacteria | 1066 |
| 141 | Ga0070716_100362484 | 3300006173 | Bacteria | 1030 |
| 142 | Ga0070716_100688363 | 3300006173 | Unclassified | 780 |
| 143 | Ga0070712_100200862 | 3300006175 | Bacteria | 1566 |
| 144 | Ga0070712_100594465 | 3300006175 | Bacteria | 936 |
| 145 | Ga0097621_100215376 | 3300006237 | Bacteria | 1672 |
| 146 | Ga0097621_100681590 | 3300006237 | Bacteria | 945 |
| 147 | Ga0097621_101735476 | 3300006237 | Bacteria | 595 |
| 148 | Ga0075433_10211416 | 3300006852 | Bacteria | 1724 |
| 149 | Ga0075433_11364096 | 3300006852 | Unclassified | 614 |
| 150 | Ga0075434_100064979 | 3300006871 | Bacteria | 3634 |
| 151 | Ga0075434_100248084 | 3300006871 | Bacteria | 1800 |
| 152 | Ga0075434_100610295 | 3300006871 | Unclassified | 1110 |
| 153 | Ga0075434_100644638 | 3300006871 | Bacteria | 1078 |
| 154 | Ga0075434_100849180 | 3300006871 | Bacteria | 928 |
| 155 | Ga0075434_102589722 | 3300006871 | Bacteria | 508 |
| 156 | Ga0068865_100430610 | 3300006881 | Bacteria | 1087 |
| 157 | Ga0075435_100019033 | 3300007076 | Bacteria | 5233 |
| 158 | Ga0075435_100165300 | 3300007076 | Bacteria | 1866 |
| 159 | Ga0075435_101461908 | 3300007076 | Unclassified | 599 |
| 160 | Ga0099795_10246046 | 3300007788 | Bacteria | 770 |
| 161 | Ga0105244_10566319 | 3300009036 | Bacteria | 522 |
| 162 | Ga0105240_10013640 | 3300009093 | Bacteria | 11145 |
| 163 | Ga0105240_10315472 | 3300009093 | Bacteria | 1784 |
| 164 | Ga0105240_11167687 | 3300009093 | Unclassified | 816 |
| 165 | Ga0105240_11815049 | 3300009093 | Unclassified | 635 |
| 166 | Ga0105240_12088996 | 3300009093 | Bacteria | 588 |
| 167 | Ga0111539_10284658 | 3300009094 | Unclassified | 1924 |
| 168 | Ga0111539_10353408 | 3300009094 | Bacteria | 1710 |
| 169 | Ga0111539_10732012 | 3300009094 | Bacteria | 1151 |
| 170 | Ga0105245_10015168 | 3300009098 | Bacteria | 6712 |
| 171 | Ga0105245_10336206 | 3300009098 | Unclassified | 1492 |
| 172 | Ga0105245_10429925 | 3300009098 | Unclassified | 1325 |
| 173 | Ga0105245_10903371 | 3300009098 | Bacteria | 925 |
| 174 | Ga0105245_11309007 | 3300009098 | Bacteria | 774 |
| 175 | Ga0105247_10694314 | 3300009101 | Bacteria | 765 |
| 176 | Ga0114129_11126585 | 3300009147 | Unclassified | 981 |
| 177 | Ga0114129_11625052 | 3300009147 | Unclassified | 790 |
| 178 | Ga0114129_11947055 | 3300009147 | Unclassified | 712 |
| 179 | Ga0105243_10286420 | 3300009148 | Unclassified | 1486 |
| 180 | Ga0105243_10787744 | 3300009148 | Bacteria | 936 |
| 181 | Ga0105243_12050348 | 3300009148 | Bacteria | 607 |
| 182 | Ga0105243_12127763 | 3300009148 | Bacteria | 597 |
| 183 | Ga0105241_10140239 | 3300009174 | Bacteria | 1967 |
| 184 | Ga0105241_10277073 | 3300009174 | Bacteria | 1431 |
| 185 | Ga0105242_10547271 | 3300009176 | Bacteria | 1109 |
| 186 | Ga0105242_10762275 | 3300009176 | Unclassified | 954 |
| 187 | Ga0105242_11033481 | 3300009176 | Unclassified | 831 |
| 188 | Ga0105242_11138607 | 3300009176 | Unclassified | 796 |
| 189 | Ga0105242_12514321 | 3300009176 | Bacteria | 563 |
| 190 | Ga0105242_12521562 | 3300009176 | Bacteria | 563 |
| 191 | Ga0105248_10816384 | 3300009177 | Bacteria | 1052 |
| 192 | Ga0105248_11176540 | 3300009177 | Bacteria | 867 |
| 193 | Ga0105248_11180525 | 3300009177 | Bacteria | 865 |
| 194 | Ga0105237_12178760 | 3300009545 | Unclassified | 564 |
| 195 | Ga0105238_10221114 | 3300009551 | Bacteria | 1870 |
| 196 | Ga0105238_10530180 | 3300009551 | Unclassified | 1181 |
| 197 | Ga0105238_10987606 | 3300009551 | Unclassified | 862 |
| 198 | Ga0105249_10535200 | 3300009553 | Bacteria | 1220 |
| 199 | Ga0105249_11373645 | 3300009553 | Bacteria | 778 |
| 200 | Ga0105249_12905224 | 3300009553 | Unclassified | 550 |
| 201 | Ga0105249_13463290 | 3300009553 | Bacteria | 508 |
| 202 | Ga0105239_10144569 | 3300010375 | Bacteria | 2652 |
| 203 | Ga0105239_10506833 | 3300010375 | Bacteria | 1372 |
| 204 | Ga0105239_10882100 | 3300010375 | Bacteria | 1026 |
| 205 | Ga0105246_10032008 | 3300011119 | Bacteria | 3484 |
| 206 | Ga0105246_10324704 | 3300011119 | Bacteria | 1252 |
| 207 | Ga0105246_10519247 | 3300011119 | Bacteria | 1015 |
| 208 | Ga0157342_1053178 | 3300012507 | Bacteria | 575 |
| 209 | Ga0157373_10114639 | 3300013100 | Unclassified | 1895 |
| 210 | Ga0157373_10140151 | 3300013100 | Bacteria | 1700 |
| 211 | Ga0157373_10143477 | 3300013100 | Bacteria | 1679 |
| 212 | Ga0157373_11023082 | 3300013100 | Bacteria | 617 |
| 213 | Ga0157371_10637146 | 3300013102 | Bacteria | 795 |
| 214 | Ga0157371_11126406 | 3300013102 | Bacteria | 602 |
| 215 | Ga0157371_11539663 | 3300013102 | Bacteria | 519 |
| 216 | Ga0157370_10008554 | 3300013104 | Bacteria | 11030 |
| 217 | Ga0157370_10011551 | 3300013104 | Bacteria | 9220 |
| 218 | Ga0157370_10179733 | 3300013104 | Bacteria | 1966 |
| 219 | Ga0157370_10598101 | 3300013104 | Bacteria | 1010 |
| 220 | Ga0157370_11685759 | 3300013104 | Bacteria | 569 |
| 221 | Ga0157369_10003021 | 3300013105 | Bacteria | 20101 |
| 222 | Ga0157369_10003191 | 3300013105 | Bacteria | 19559 |
| 223 | Ga0157369_10093669 | 3300013105 | Bacteria | 3206 |
| 224 | Ga0157369_11020865 | 3300013105 | Bacteria | 846 |
| 225 | Ga0157369_11231920 | 3300013105 | Unclassified | 763 |
| 226 | Ga0157374_10065974 | 3300013296 | Bacteria | 3401 |
| 227 | Ga0157378_13090503 | 3300013297 | Bacteria | 517 |
| 228 | Ga0163162_10350021 | 3300013306 | Bacteria | 1610 |
| 229 | Ga0163162_11321867 | 3300013306 | Bacteria | 819 |
| 230 | Ga0157372_10538351 | 3300013307 | Bacteria | 1361 |
| 231 | Ga0157372_11105384 | 3300013307 | Bacteria | 917 |
| 232 | Ga0157372_11776492 | 3300013307 | Unclassified | 709 |
| 233 | Ga0157372_11814872 | 3300013307 | Unclassified | 701 |
| 234 | Ga0157372_13397695 | 3300013307 | Unclassified | 506 |
| 235 | Ga0157375_10412513 | 3300013308 | Bacteria | 1517 |
| 236 | Ga0157375_11015111 | 3300013308 | Bacteria | 969 |
| 237 | Ga0157375_12687673 | 3300013308 | Bacteria | 595 |
| 238 | Ga0163163_10114925 | 3300014325 | Bacteria | 2723 |
| 239 | Ga0163163_11827790 | 3300014325 | Unclassified | 668 |
| 240 | Ga0182008_10121763 | 3300014497 | Bacteria | 1297 |
| 241 | Ga0157377_10475764 | 3300014745 | Bacteria | 868 |
| 242 | Ga0157379_11948522 | 3300014968 | Bacteria | 580 |
| 243 | Ga0157376_10367854 | 3300014969 | Bacteria | 1381 |
| 244 | Ga0157376_10900831 | 3300014969 | Bacteria | 903 |
| 245 | Ga0182006_1307657 | 3300015261 | Bacteria | 520 |
| 246 | Ga0197907_11123783 | 3300020069 | Unclassified | 502 |
| 247 | Ga0206356_10146978 | 3300020070 | Unclassified | 1081 |
| 248 | Ga0206356_11031196 | 3300020070 | Bacteria | 1406 |
| 249 | Ga0206356_11759030 | 3300020070 | Bacteria | 3770 |
| 250 | Ga0206352_10752928 | 3300020078 | Bacteria | 526 |
| 251 | Ga0206354_10745355 | 3300020081 | Bacteria | 956 |
| 252 | Ga0206353_10831774 | 3300020082 | Bacteria | 9453 |
| 253 | Ga0206353_11836039 | 3300020082 | Bacteria | 1350 |
| 254 | Ga0213874_10407939 | 3300021377 | Unclassified | 530 |
| 255 | Ga0213871_10051870 | 3300021441 | Bacteria | 1126 |
| 256 | Ga0207692_10236162 | 3300025898 | Bacteria | 1090 |
| 257 | Ga0207642_10695251 | 3300025899 | Bacteria | 640 |
| 258 | Ga0207688_10178838 | 3300025901 | Bacteria | 1264 |
| 259 | Ga0207680_11069233 | 3300025903 | Bacteria | 577 |
| 260 | Ga0207699_10944057 | 3300025906 | Bacteria | 637 |
| 261 | Ga0207699_11053879 | 3300025906 | Unclassified | 602 |
| 262 | Ga0207705_10029496 | 3300025909 | Bacteria | 3910 |
| 263 | Ga0207705_10659748 | 3300025909 | Bacteria | 813 |
| 264 | Ga0207705_11011619 | 3300025909 | Unclassified | 642 |
| 265 | Ga0207684_10520291 | 3300025910 | Bacteria | 1019 |
| 266 | Ga0207684_10555893 | 3300025910 | Unclassified | 982 |
| 267 | Ga0207684_10913941 | 3300025910 | Bacteria | 737 |
| 268 | Ga0207684_11091899 | 3300025910 | Unclassified | 664 |
| 269 | Ga0207654_10174542 | 3300025911 | Unclassified | 1398 |
| 270 | Ga0207707_10007964 | 3300025912 | Bacteria | 9209 |
| 271 | Ga0207707_10022793 | 3300025912 | Bacteria | 5475 |
| 272 | Ga0207707_10050559 | 3300025912 | Bacteria | 3620 |
| 273 | Ga0207707_10125932 | 3300025912 | Bacteria | 2240 |
| 274 | Ga0207707_10279846 | 3300025912 | Bacteria | 1445 |
| 275 | Ga0207707_11090718 | 3300025912 | Unclassified | 651 |
| 276 | Ga0207695_10076261 | 3300025913 | Bacteria | 3409 |
| 277 | Ga0207695_10304465 | 3300025913 | Bacteria | 1485 |
| 278 | Ga0207693_10859102 | 3300025915 | Unclassified | 697 |
| 279 | Ga0207693_11408592 | 3300025915 | Bacteria | 517 |
| 280 | Ga0207663_10760339 | 3300025916 | Unclassified | 770 |
| 281 | Ga0207663_11317400 | 3300025916 | Bacteria | 582 |
| 282 | Ga0207663_11327615 | 3300025916 | Bacteria | 579 |
| 283 | Ga0207660_10010651 | 3300025917 | Bacteria | 5976 |
| 284 | Ga0207660_10037530 | 3300025917 | Bacteria | 3377 |
| 285 | Ga0207660_10054397 | 3300025917 | Bacteria | 2857 |
| 286 | Ga0207660_10379668 | 3300025917 | Unclassified | 1136 |
| 287 | Ga0207660_10727503 | 3300025917 | Bacteria | 810 |
| 288 | Ga0207660_10802883 | 3300025917 | Bacteria | 768 |
| 289 | Ga0207662_10614301 | 3300025918 | Bacteria | 757 |
| 290 | Ga0207657_10001226 | 3300025919 | Bacteria | 27377 |
| 291 | Ga0207657_10007076 | 3300025919 | Bacteria | 11526 |
| 292 | Ga0207657_10411169 | 3300025919 | Bacteria | 1064 |
| 293 | Ga0207657_11023219 | 3300025919 | Unclassified | 633 |
| 294 | Ga0207649_10149383 | 3300025920 | Bacteria | 1607 |
| 295 | Ga0207649_10152813 | 3300025920 | Bacteria | 1592 |
| 296 | Ga0207652_10008436 | 3300025921 | Bacteria | 8292 |
| 297 | Ga0207652_10101952 | 3300025921 | Bacteria | 2536 |
| 298 | Ga0207652_10120519 | 3300025921 | Bacteria | 2334 |
| 299 | Ga0207652_10130486 | 3300025921 | Bacteria | 2241 |
| 300 | Ga0207652_11290518 | 3300025921 | Bacteria | 633 |
| 301 | Ga0207646_10070951 | 3300025922 | Bacteria | 3111 |
| 302 | Ga0207681_11210108 | 3300025923 | Archaea | 635 |
| 303 | Ga0207694_11031304 | 3300025924 | Unclassified | 696 |
| 304 | Ga0207694_11152256 | 3300025924 | Unclassified | 656 |
| 305 | Ga0207659_10179314 | 3300025926 | Bacteria | 1677 |
| 306 | Ga0207687_10162045 | 3300025927 | Unclassified | 1717 |
| 307 | Ga0207687_10216030 | 3300025927 | Unclassified | 1507 |
| 308 | Ga0207687_10317614 | 3300025927 | Unclassified | 1260 |
| 309 | Ga0207687_11185832 | 3300025927 | Bacteria | 656 |
| 310 | Ga0207664_10057211 | 3300025929 | Bacteria | 3099 |
| 311 | Ga0207664_10126538 | 3300025929 | Archaea | 2146 |
| 312 | Ga0207664_10139850 | 3300025929 | Bacteria | 2047 |
| 313 | Ga0207664_10140172 | 3300025929 | Unclassified | 2044 |
| 314 | Ga0207664_10195009 | 3300025929 | Unclassified | 1745 |
| 315 | Ga0207664_10198324 | 3300025929 | Unclassified | 1731 |
| 316 | Ga0207664_10445238 | 3300025929 | Unclassified | 1156 |
| 317 | Ga0207664_10491677 | 3300025929 | Bacteria | 1098 |
| 318 | Ga0207664_10827895 | 3300025929 | Bacteria | 832 |
| 319 | Ga0207664_11734137 | 3300025929 | Bacteria | 547 |
| 320 | Ga0207664_11822657 | 3300025929 | Unclassified | 531 |
| 321 | Ga0207644_10537413 | 3300025931 | Bacteria | 967 |
| 322 | Ga0207690_10112275 | 3300025932 | Bacteria | 1965 |
| 323 | Ga0207690_10326360 | 3300025932 | Unclassified | 1208 |
| 324 | Ga0207706_10535630 | 3300025933 | Unclassified | 1009 |
| 325 | Ga0207706_11648118 | 3300025933 | Bacteria | 518 |
| 326 | Ga0207686_10626740 | 3300025934 | Bacteria | 849 |
| 327 | Ga0207686_10730712 | 3300025934 | Unclassified | 789 |
| 328 | Ga0207686_11133110 | 3300025934 | Unclassified | 639 |
| 329 | Ga0207669_11887550 | 3300025937 | Bacteria | 510 |
| 330 | Ga0207704_11794493 | 3300025938 | Bacteria | 527 |
| 331 | Ga0207704_11859702 | 3300025938 | Bacteria | 518 |
| 332 | Ga0207665_10073490 | 3300025939 | Unclassified | 2338 |
| 333 | Ga0207665_10626469 | 3300025939 | Bacteria | 842 |
| 334 | Ga0207691_10876090 | 3300025940 | Bacteria | 752 |
| 335 | Ga0207711_10837023 | 3300025941 | Bacteria | 856 |
| 336 | Ga0207661_10000419 | 3300025944 | Bacteria | 27497 |
| 337 | Ga0207661_10044100 | 3300025944 | Bacteria | 3523 |
| 338 | Ga0207661_10046546 | 3300025944 | Bacteria | 3440 |
| 339 | Ga0207661_10210686 | 3300025944 | Bacteria | 1713 |
| 340 | Ga0207661_10232906 | 3300025944 | Bacteria | 1632 |
| 341 | Ga0207661_10705676 | 3300025944 | Bacteria | 928 |
| 342 | Ga0207661_11923911 | 3300025944 | Unclassified | 537 |
| 343 | Ga0207661_12050040 | 3300025944 | Bacteria | 518 |
| 344 | Ga0207679_10130139 | 3300025945 | Bacteria | 2018 |
| 345 | Ga0207667_10973997 | 3300025949 | Unclassified | 837 |
| 346 | Ga0207667_11765973 | 3300025949 | Bacteria | 583 |
| 347 | Ga0207667_12131340 | 3300025949 | Unclassified | 519 |
| 348 | Ga0207712_10717900 | 3300025961 | Unclassified | 873 |
| 349 | Ga0207668_10993458 | 3300025972 | Unclassified | 750 |
| 350 | Ga0207668_11095780 | 3300025972 | Bacteria | 714 |
| 351 | Ga0207640_10143789 | 3300025981 | Bacteria | 1742 |
| 352 | Ga0207640_11014505 | 3300025981 | Bacteria | 731 |
| 353 | Ga0207677_10401543 | 3300026023 | Bacteria | 1162 |
| 354 | Ga0207677_11805569 | 3300026023 | Bacteria | 568 |
| 355 | Ga0207703_10909446 | 3300026035 | Bacteria | 843 |
| 356 | Ga0207639_10125680 | 3300026041 | Bacteria | 2115 |
| 357 | Ga0207639_11011502 | 3300026041 | Bacteria | 779 |
| 358 | Ga0207639_12181894 | 3300026041 | Bacteria | 515 |
| 359 | Ga0207678_10211784 | 3300026067 | Bacteria | 1658 |
| 360 | Ga0207708_10290441 | 3300026075 | Bacteria | 1327 |
| 361 | Ga0207708_11470680 | 3300026075 | Bacteria | 598 |
| 362 | Ga0207702_10031083 | 3300026078 | Bacteria | 4451 |
| 363 | Ga0207702_10192159 | 3300026078 | Unclassified | 1887 |
| 364 | Ga0207702_11096255 | 3300026078 | Bacteria | 790 |
| 365 | Ga0207702_11546803 | 3300026078 | Bacteria | 657 |
| 366 | Ga0207702_12018932 | 3300026078 | Bacteria | 567 |
| 367 | Ga0207648_10779523 | 3300026089 | Unclassified | 889 |
| 368 | Ga0207674_11131829 | 3300026116 | Unclassified | 752 |
| 369 | Ga0207674_11187735 | 3300026116 | Bacteria | 732 |
| 370 | Ga0207675_102355562 | 3300026118 | Bacteria | 545 |
| 371 | Ga0207683_10194136 | 3300026121 | Bacteria | 1844 |
| 372 | Ga0207683_11086064 | 3300026121 | Bacteria | 742 |
| 373 | Ga0207698_10095595 | 3300026142 | Bacteria | 2446 |
| 374 | Ga0207698_10486990 | 3300026142 | Bacteria | 1197 |
| 375 | Ga0207698_10740913 | 3300026142 | Unclassified | 981 |
| 376 | Ga0207698_11954890 | 3300026142 | Unclassified | 601 |
| 377 | Ga0209179_1134938 | 3300027512 | Bacteria | 551 |
| 378 | Ga0268265_11909092 | 3300028380 | Bacteria | 601 |
| 379 | Ga0268264_11628043 | 3300028381 | Bacteria | 656 |
| 380 | Ga0265337_1031911 | 3300028556 | Bacteria | 1561 |
| 381 | Ga0265319_1000686 | 3300028563 | Bacteria | 22046 |
| 382 | Ga0265319_1087389 | 3300028563 | Bacteria | 986 |
| 383 | Ga0265334_10153902 | 3300028573 | Bacteria | 810 |
| 384 | Ga0265334_10223853 | 3300028573 | Bacteria | 651 |
| 385 | Ga0265334_10242321 | 3300028573 | Unclassified | 621 |
| 386 | Ga0265318_10007208 | 3300028577 | Bacteria | 5049 |
| 387 | Ga0265318_10008090 | 3300028577 | Bacteria | 4703 |
| 388 | Ga0265318_10348056 | 3300028577 | Bacteria | 541 |
| 389 | Ga0265322_10014406 | 3300028654 | Bacteria | 2285 |
| 390 | Ga0265336_10000958 | 3300028666 | Bacteria | 14421 |
| 391 | Ga0265336_10062984 | 3300028666 | Bacteria | 1111 |
| 392 | Ga0265338_10001750 | 3300028800 | Bacteria | 34304 |
| 393 | Ga0265338_10013644 | 3300028800 | Bacteria | 9148 |
| 394 | Ga0265338_10027092 | 3300028800 | Bacteria | 5759 |
| 395 | Ga0265338_10027548 | 3300028800 | Bacteria | 5698 |
| 396 | Ga0265338_10040991 | 3300028800 | Bacteria | 4338 |
| 397 | Ga0265338_10052415 | 3300028800 | Bacteria | 3660 |
| 398 | Ga0265338_11065578 | 3300028800 | Unclassified | 545 |
| 399 | Ga0265338_11217008 | 3300028800 | Unclassified | 505 |
| 400 | Ga0265324_10033352 | 3300029957 | Unclassified | 1797 |
| 401 | Ga0265324_10126015 | 3300029957 | Unclassified | 869 |
| 402 | Ga0265324_10192953 | 3300029957 | Bacteria | 692 |
| 403 | Ga0265330_10053429 | 3300031235 | Bacteria | 1768 |
| 404 | Ga0265330_10121401 | 3300031235 | Bacteria | 1113 |
| 405 | Ga0265332_10031157 | 3300031238 | Bacteria | 2327 |
| 406 | Ga0265320_10182847 | 3300031240 | Bacteria | 939 |
| 407 | Ga0265320_10198647 | 3300031240 | Unclassified | 896 |
| 408 | Ga0265325_10053100 | 3300031241 | Bacteria | 2079 |
| 409 | Ga0265325_10219509 | 3300031241 | Unclassified | 870 |
| 410 | Ga0265325_10315781 | 3300031241 | Bacteria | 695 |
| 411 | Ga0265329_10026696 | 3300031242 | Bacteria | 1901 |
| 412 | Ga0265340_10275150 | 3300031247 | Unclassified | 748 |
| 413 | Ga0265339_10001458 | 3300031249 | Bacteria | 17517 |
| 414 | Ga0265339_10262445 | 3300031249 | Unclassified | 833 |
| 415 | Ga0265331_10127516 | 3300031250 | Bacteria | 1162 |
| 416 | Ga0265331_10554362 | 3300031250 | Bacteria | 518 |
| 417 | Ga0265327_10053757 | 3300031251 | Bacteria | 2088 |
| 418 | Ga0265327_10123137 | 3300031251 | Bacteria | 1226 |
| 419 | Ga0265327_10142464 | 3300031251 | Bacteria | 1119 |
| 420 | Ga0265316_10031545 | 3300031344 | Bacteria | 4331 |
| 421 | Ga0265316_10033839 | 3300031344 | Bacteria | 4157 |
| 422 | Ga0265313_10025147 | 3300031595 | Bacteria | 3163 |
| 423 | Ga0265313_10108460 | 3300031595 | Bacteria | 1223 |
| 424 | Ga0265313_10236642 | 3300031595 | Bacteria | 748 |
| 425 | Ga0265314_10018137 | 3300031711 | Bacteria | 5497 |
| 426 | Ga0265314_10047154 | 3300031711 | Bacteria | 3035 |
| 427 | Ga0265342_10105274 | 3300031712 | Bacteria | 1602 |
| 428 | Ga0265342_10532916 | 3300031712 | Bacteria | 597 |
| 429 | Ga0307416_100529061 | 3300032002 | Bacteria | 1249 |
| 430 | Ga0307415_100369060 | 3300032126 | Bacteria | 1215 |
| 431 | Ga0373949_0199970 | 3300035090 | Unclassified | 600 |
| 432 | Ga0373932_0118135 | 3300035112 | Bacteria | 882 |
| 433 | Ga0373939_0192325 | 3300035114 | Unclassified | 767 |
| 434 | Ga0373953_0567402 | 3300035117 | Bacteria | 505 |
| 435 | Ga0373943_0250126 | 3300035170 | Bacteria | 995 |
| 436 | Ga0373931_0095091 | 3300035691 | Bacteria | 1667 |
| 437 | Ga0373947_0023365 | 3300035725 | Bacteria | 3595 |
| 438 | Ga0373925_1469145 | 3300037068 | Bacteria | 558 |
| 439 | Ga0373925_1743929 | 3300037068 | Unclassified | 508 |
| 440 | Ga0395899_0009149 | 3300037312 | Bacteria | 7612 |
| 441 | Ga0395899_0026374 | 3300037312 | Bacteria | 4385 |
| 442 | Ga0395899_0389295 | 3300037312 | Bacteria | 925 |
| 443 | Ga0395899_0571514 | 3300037312 | Unclassified | 724 |
| 444 | Ga0395899_0839476 | 3300037312 | Bacteria | 565 |
| 445 | Ga0395899_0855128 | 3300037312 | Bacteria | 558 |
| 446 | Ga0395900_0054702 | 3300037418 | Bacteria | 4109 |
| 447 | Ga0395900_0134196 | 3300037418 | Bacteria | 2536 |
| 448 | Ga0395900_0283227 | 3300037418 | Unclassified | 1649 |
| 449 | Ga0395900_0316310 | 3300037418 | Unclassified | 1543 |
| 450 | Ga0395900_0707538 | 3300037418 | Bacteria | 940 |
| 451 | Ga0395900_0885071 | 3300037418 | Unclassified | 817 |
| 452 | Ga0395900_1230087 | 3300037418 | Bacteria | 664 |
| 453 | Ga0395900_1680894 | 3300037418 | Bacteria | 546 |
| 454 | Ga0395898_0025042 | 3300037466 | Bacteria | 6016 |
| 455 | Ga0395898_0034580 | 3300037466 | Bacteria | 5034 |
| 456 | Ga0395898_0065394 | 3300037466 | Bacteria | 3525 |
| 457 | Ga0395898_0079817 | 3300037466 | Unclassified | 3156 |
| 458 | Ga0395898_0536622 | 3300037466 | Bacteria | 1112 |
| 459 | Ga0395898_0754350 | 3300037466 | Unclassified | 914 |
| 460 | Ga0395898_0934088 | 3300037466 | Bacteria | 805 |
| 461 | Ga0395898_1060194 | 3300037466 | Bacteria | 745 |
| 462 | Ga0395898_1114864 | 3300037466 | Bacteria | 722 |
| 463 | Ga0395898_1987844 | 3300037466 | Unclassified | 501 |
| 464 | Ga0395905_0025167 | 3300037471 | Bacteria | 5613 |
| 465 | Ga0395905_0043009 | 3300037471 | Bacteria | 4238 |
| 466 | Ga0395905_0045169 | 3300037471 | Bacteria | 4132 |
| 467 | Ga0395905_0128122 | 3300037471 | Unclassified | 2387 |
| 468 | Ga0395905_0446086 | 3300037471 | Bacteria | 1192 |
| 469 | Ga0395905_1130541 | 3300037471 | Unclassified | 687 |
| 470 | Ga0395905_1352309 | 3300037471 | Bacteria | 616 |
| 471 | Ga0395901_0014062 | 3300038443 | Bacteria | 8148 |
| 472 | Ga0395901_0061643 | 3300038443 | Bacteria | 3903 |
| 473 | Ga0395901_0100687 | 3300038443 | Bacteria | 3031 |
| 474 | Ga0395901_0119062 | 3300038443 | Bacteria | 2775 |
| 475 | Ga0395901_0153745 | 3300038443 | Unclassified | 2416 |
| 476 | Ga0395901_0294928 | 3300038443 | Bacteria | 1682 |
| 477 | Ga0395901_0386779 | 3300038443 | Bacteria | 1439 |
| 478 | Ga0395901_0770764 | 3300038443 | Bacteria | 953 |
| 479 | Ga0395901_0898162 | 3300038443 | Unclassified | 868 |
| 480 | Ga0395901_1140933 | 3300038443 | Unclassified | 748 |
| 481 | Ga0395901_1583827 | 3300038443 | Bacteria | 609 |
| 482 | Ga0395901_1720791 | 3300038443 | Unclassified | 578 |
| 483 | Ga0395901_1992796 | 3300038443 | Bacteria | 527 |
| 484 | Ga0242420_011944 | 3300038996 | Bacteria | 1465 |
| 485 | Ga0436360_0647028 | 3300039438 | Bacteria | 2398 |
| 486 | Ga0436363_0933607 | 3300039450 | Bacteria | 727 |
| 487 | Ga0436362_0712128 | 3300039453 | Bacteria | 1666 |
| 488 | Ga0451802_0226917 | 3300041460 | Bacteria | 581 |
| 489 | Ga0451845_0784403 | 3300041501 | Unclassified | 781 |
| 490 | Ga0439448_0065025 | 3300042005 | Unclassified | 1209 |
| 491 | Ga0451577_1182173 | 3300042876 | Unclassified | 683 |
| 492 | Ga0466969_0017481 | 3300044656 | Bacteria | 3743 |
| 493 | Ga0466966_0050309 | 3300044684 | Bacteria | 2651 |
| 494 | Ga0466966_0160101 | 3300044684 | Bacteria | 1371 |
| 495 | Ga0466961_0089191 | 3300044693 | Bacteria | 1947 |
| 496 | Ga0466961_0445081 | 3300044693 | Bacteria | 784 |
| 497 | Ga0466961_0823091 | 3300044693 | Bacteria | 554 |
| 498 | Ga0466963_0019397 | 3300044694 | Bacteria | 4264 |
| 499 | Ga0466963_0053658 | 3300044694 | Bacteria | 2677 |
| 500 | Ga0466963_0060635 | 3300044694 | Bacteria | 2527 |
| 501 | Ga0466963_0268646 | 3300044694 | Unclassified | 1198 |
| 502 | Ga0466963_0279527 | 3300044694 | Bacteria | 1173 |
| 503 | Ga0466963_0514375 | 3300044694 | Unclassified | 845 |
| 504 | Ga0466963_1202581 | 3300044694 | Bacteria | 532 |
| 505 | Ga0466964_0256755 | 3300044706 | Bacteria | 864 |
| 506 | Ga0466964_0600942 | 3300044706 | Unclassified | 603 |
| 507 | Ga0453684_1248597 | 3300044712 | Unclassified | 778 |
| 508 | Ga0466971_0016330 | 3300044719 | Bacteria | 3275 |
| 509 | Ga0466971_0017567 | 3300044719 | Bacteria | 3165 |
| 510 | Ga0466971_0276697 | 3300044719 | Unclassified | 803 |
| 511 | Ga0466971_0617135 | 3300044719 | Bacteria | 541 |
| 512 | Ga0466968_0399911 | 3300044735 | Unclassified | 673 |
| 513 | Ga0466968_0485378 | 3300044735 | Bacteria | 614 |
| 514 | Ga0466970_0791044 | 3300044765 | Unclassified | 555 |
| 515 | Ga0466957_0017973 | 3300044842 | Bacteria | 4147 |
| 516 | Ga0466957_0776900 | 3300044842 | Unclassified | 679 |
| 517 | Ga0466960_0726004 | 3300044901 | Bacteria | 597 |
| 518 | Ga0466959_0059027 | 3300045049 | Bacteria | 2794 |
| 519 | Ga0466959_0179274 | 3300045049 | Unclassified | 1482 |
| 520 | Ga0466959_1116333 | 3300045049 | Bacteria | 524 |
| 521 | Ga0466958_0156269 | 3300045836 | Bacteria | 1440 |
| 522 | Ga0466958_0169476 | 3300045836 | Unclassified | 1382 |
| 523 | Ga0466958_0214865 | 3300045836 | Unclassified | 1226 |
| 524 | Ga0466958_0539979 | 3300045836 | Bacteria | 757 |
| 525 | Ga0466958_0818813 | 3300045836 | Bacteria | 607 |
| 526 | Ga0466967_0000665 | 3300045976 | Bacteria | 17349 |
| 527 | Ga0466967_0012229 | 3300045976 | Bacteria | 6553 |
| 528 | Ga0466967_0016463 | 3300045976 | Bacteria | 5832 |
| 529 | Ga0466967_0123765 | 3300045976 | Bacteria | 2393 |
| 530 | Ga0466967_0152619 | 3300045976 | Bacteria | 2160 |
| 531 | Ga0466967_0248562 | 3300045976 | Bacteria | 1698 |
| 532 | Ga0466967_0330861 | 3300045976 | Bacteria | 1471 |
| 533 | Ga0466967_0343463 | 3300045976 | Bacteria | 1444 |
| 534 | Ga0466967_0448713 | 3300045976 | Bacteria | 1260 |
| 535 | Ga0466967_0778897 | 3300045976 | Unclassified | 949 |
| 536 | Ga0466967_1610025 | 3300045976 | Unclassified | 647 |
| 537 | Ga0466967_1780196 | 3300045976 | Unclassified | 613 |
| 538 | Ga0466967_2130470 | 3300045976 | Bacteria | 557 |
| 539 | Ga0495603_0043187 | 3300046455 | Bacteria | 2693 |
| 540 | Ga0495603_0127929 | 3300046455 | Bacteria | 1480 |
| 541 | Ga0495629_0126592 | 3300046459 | Unclassified | 1780 |
| 542 | Ga0495629_0220152 | 3300046459 | Bacteria | 1309 |
| 543 | Ga0495629_0852593 | 3300046459 | Bacteria | 599 |
| 544 | Ga0495641_0068551 | 3300046461 | Bacteria | 1595 |
| 545 | Ga0495641_0231703 | 3300046461 | Bacteria | 829 |
| 546 | Ga0495641_0271495 | 3300046461 | Unclassified | 763 |
| 547 | Ga0495653_0118145 | 3300046463 | Unclassified | 1894 |
| 548 | Ga0495582_0294951 | 3300046473 | Bacteria | 932 |
| 549 | Ga0495582_0529915 | 3300046473 | Bacteria | 681 |
| 550 | Ga0495639_0117159 | 3300046475 | Bacteria | 1268 |
| 551 | Ga0495584_0181791 | 3300046491 | Unclassified | 1069 |
| 552 | Ga0495594_0270912 | 3300046499 | Bacteria | 967 |
| 553 | Ga0495594_0675019 | 3300046499 | Unclassified | 585 |
| 554 | Ga0495596_0146545 | 3300046500 | Bacteria | 917 |
| 555 | Ga0495596_0344646 | 3300046500 | Unclassified | 580 |
| 556 | Ga0495608_0244988 | 3300046511 | Unclassified | 1119 |
| 557 | Ga0495608_0688522 | 3300046511 | Bacteria | 609 |
| 558 | Ga0495618_0079260 | 3300046514 | Bacteria | 2095 |
| 559 | Ga0495618_0585194 | 3300046514 | Unclassified | 665 |
| 560 | Ga0495628_0879210 | 3300046516 | Bacteria | 623 |
| 561 | Ga0495630_0233728 | 3300046517 | Unclassified | 1405 |
| 562 | Ga0495630_0603664 | 3300046517 | Bacteria | 841 |
| 563 | Ga0495630_1177842 | 3300046517 | Bacteria | 580 |
| 564 | Ga0495630_1352751 | 3300046517 | Unclassified | 536 |
| 565 | Ga0495631_0500587 | 3300046518 | Unclassified | 518 |
| 566 | Ga0495631_0508679 | 3300046518 | Unclassified | 513 |
| 567 | Ga0495644_0277032 | 3300046523 | Unclassified | 654 |
| 568 | Ga0495644_0374724 | 3300046523 | Unclassified | 562 |
| 569 | Ga0495663_0124039 | 3300046525 | Unclassified | 867 |
| 570 | Ga0495652_0014440 | 3300046529 | Bacteria | 7089 |
| 571 | Ga0495652_0515508 | 3300046529 | Bacteria | 827 |
| 572 | Ga0495652_0745034 | 3300046529 | Unclassified | 656 |
| 573 | Ga0495665_0669898 | 3300046531 | Bacteria | 516 |
| 574 | Ga0495586_0136639 | 3300046535 | Bacteria | 1374 |
| 575 | Ga0495598_0190692 | 3300046537 | Unclassified | 736 |
| 576 | Ga0495645_0918652 | 3300046543 | Unclassified | 519 |
| 577 | Ga0495633_0291349 | 3300046558 | Bacteria | 742 |
| 578 | Ga0495667_0188133 | 3300046559 | Bacteria | 1324 |
| 579 | Ga0495667_0880945 | 3300046559 | Unclassified | 549 |
| 580 | Ga0495656_0323896 | 3300046615 | Unclassified | 794 |
| 581 | Ga0495634_0047348 | 3300046642 | Unclassified | 2898 |
| 582 | Ga0495634_0084690 | 3300046642 | Unclassified | 2067 |
| 583 | Ga0495634_0415350 | 3300046642 | Bacteria | 797 |
| 584 | Ga0495634_0495861 | 3300046642 | Bacteria | 716 |
| 585 | Ga0495635_0038322 | 3300046663 | Bacteria | 3319 |
| 586 | Ga0495588_0344851 | 3300046674 | Bacteria | 783 |
| 587 | Ga0495657_0318700 | 3300046675 | Unclassified | 924 |
| 588 | Ga0495647_0253128 | 3300046681 | Bacteria | 784 |
| 589 | Ga0495658_0012444 | 3300046683 | Bacteria | 4309 |
| 590 | Ga0495658_0165806 | 3300046683 | Unclassified | 1365 |
| 591 | Ga0495658_0909999 | 3300046683 | Bacteria | 562 |
| 592 | Ga0495613_0070031 | 3300046689 | Bacteria | 2557 |
| 593 | Ga0495613_0345814 | 3300046689 | Unclassified | 1022 |
| 594 | Ga0495613_0770428 | 3300046689 | Unclassified | 629 |
| 595 | Ga0495670_0263649 | 3300046691 | Unclassified | 920 |
| 596 | Ga0495670_0579011 | 3300046691 | Unclassified | 611 |
| 597 | Ga0495600_0082691 | 3300046809 | Unclassified | 2095 |
| 598 | Ga0495600_0523051 | 3300046809 | Unclassified | 727 |
| 599 | Ga0495581_0275740 | 3300047315 | Bacteria | 983 |
| 600 | Ga0495674_0328860 | 3300047319 | Unclassified | 1244 |
| 601 | Ga0495674_1194786 | 3300047319 | Unclassified | 575 |
| 602 | Ga0495676_0184400 | 3300047321 | Bacteria | 1460 |
| 603 | Ga0495676_1069494 | 3300047321 | Bacteria | 513 |
| 604 | Ga0495680_0209786 | 3300047322 | Bacteria | 1395 |
| 605 | Ga0495680_0628623 | 3300047322 | Unclassified | 716 |
| 606 | Ga0495675_0757192 | 3300047444 | Unclassified | 540 |
| 607 | Ga0495675_0846110 | 3300047444 | Unclassified | 504 |
| 608 | Ga0495685_287189 | 3300047447 | Unclassified | 518 |
| 609 | Ga0496100_0008310 | 3300048903 | Bacteria | 5788 |
| 610 | Ga0496100_0177837 | 3300048903 | Unclassified | 1537 |
| 611 | Ga0496100_0406561 | 3300048903 | Bacteria | 1038 |
| 612 | Ga0496100_0555990 | 3300048903 | Unclassified | 888 |
| 613 | Ga0496100_1551442 | 3300048903 | Bacteria | 523 |
| 614 | Ga0496101_0008526 | 3300048904 | Bacteria | 6700 |
| 615 | Ga0496101_0021007 | 3300048904 | Bacteria | 4480 |
| 616 | Ga0496101_0405404 | 3300048904 | Bacteria | 1074 |
| 617 | Ga0496101_0753353 | 3300048904 | Unclassified | 768 |
| 618 | Ga0496101_0759359 | 3300048904 | Bacteria | 765 |
| 619 | Ga0496101_1307891 | 3300048904 | Bacteria | 567 |
| 620 | Ga0496101_1591522 | 3300048904 | Unclassified | 508 |
| 621 | Ga0496102_0028813 | 3300048905 | Bacteria | 4964 |
| 622 | Ga0496102_0047895 | 3300048905 | Bacteria | 3886 |
| 623 | Ga0496102_0160221 | 3300048905 | Bacteria | 2116 |
| 624 | Ga0496102_0459104 | 3300048905 | Unclassified | 1195 |
| 625 | Ga0496102_0663995 | 3300048905 | Bacteria | 965 |
| 626 | Ga0496102_0718626 | 3300048905 | Bacteria | 922 |
| 627 | Ga0496103_0032071 | 3300048906 | Bacteria | 3205 |
| 628 | Ga0496103_0086174 | 3300048906 | Bacteria | 1980 |
| 629 | Ga0496103_1065595 | 3300048906 | Bacteria | 501 |
| 630 | Ga0496104_0011259 | 3300048907 | Bacteria | 8006 |
| 631 | Ga0496104_0012515 | 3300048907 | Bacteria | 7630 |
| 632 | Ga0496104_0037274 | 3300048907 | Bacteria | 4548 |
| 633 | Ga0496104_0037541 | 3300048907 | Bacteria | 4531 |
| 634 | Ga0496104_0070949 | 3300048907 | Bacteria | 3312 |
| 635 | Ga0496104_0088505 | 3300048907 | Bacteria | 2958 |
| 636 | Ga0496104_0377495 | 3300048907 | Bacteria | 1330 |
| 637 | Ga0496105_0000738 | 3300048908 | Bacteria | 22174 |
| 638 | Ga0496105_0102216 | 3300048908 | Unclassified | 2367 |
| 639 | Ga0496105_0120817 | 3300048908 | Unclassified | 2160 |
| 640 | Ga0496105_0703671 | 3300048908 | Bacteria | 775 |
| 641 | Ga0496105_0752089 | 3300048908 | Unclassified | 744 |
| 642 | Ga0496105_1189500 | 3300048908 | Bacteria | 562 |
| 643 | Ga0496106_0025788 | 3300048909 | Bacteria | 4375 |
| 644 | Ga0496106_0040595 | 3300048909 | Bacteria | 3485 |
| 645 | Ga0496106_0146907 | 3300048909 | Bacteria | 1858 |
| 646 | Ga0496106_0318043 | 3300048909 | Bacteria | 1249 |
| 647 | Ga0496106_0936238 | 3300048909 | Unclassified | 683 |
| 648 | Ga0496107_0000717 | 3300048910 | Bacteria | 18921 |
| 649 | Ga0496107_0075160 | 3300048910 | Unclassified | 2459 |
| 650 | Ga0496107_0239804 | 3300048910 | Unclassified | 1349 |
| 651 | Ga0496107_0453157 | 3300048910 | Bacteria | 953 |
| 652 | Ga0496107_1291907 | 3300048910 | Unclassified | 522 |
| 653 | Ga0496108_0015271 | 3300048911 | Bacteria | 6267 |
| 654 | Ga0496108_0070996 | 3300048911 | Bacteria | 2938 |
| 655 | Ga0496108_0087222 | 3300048911 | Bacteria | 2650 |
| 656 | Ga0496108_0268159 | 3300048911 | Bacteria | 1486 |
| 657 | Ga0496108_0540419 | 3300048911 | Bacteria | 1017 |
| 658 | Ga0496108_0555285 | 3300048911 | Unclassified | 1002 |
| 659 | Ga0496108_0920706 | 3300048911 | Bacteria | 750 |
| 660 | Ga0496108_0924128 | 3300048911 | Bacteria | 748 |
| 661 | Ga0496109_0013710 | 3300048912 | Bacteria | 7041 |
| 662 | Ga0496109_0068948 | 3300048912 | Unclassified | 3242 |
| 663 | Ga0496109_0075705 | 3300048912 | Bacteria | 3094 |
| 664 | Ga0496109_0135240 | 3300048912 | Bacteria | 2303 |
| 665 | Ga0496109_0271501 | 3300048912 | Bacteria | 1598 |
| 666 | Ga0496109_0410758 | 3300048912 | Bacteria | 1279 |
| 667 | Ga0496109_1117290 | 3300048912 | Unclassified | 725 |
| 668 | Ga0496109_1559498 | 3300048912 | Unclassified | 595 |
| 669 | Ga0496110_0000219 | 3300048913 | Bacteria | 37065 |
| 670 | Ga0496110_0000677 | 3300048913 | Bacteria | 23384 |
| 671 | Ga0496110_0020333 | 3300048913 | Bacteria | 5605 |
| 672 | Ga0496110_0104779 | 3300048913 | Unclassified | 2537 |
| 673 | Ga0496110_0105600 | 3300048913 | Bacteria | 2527 |
| 674 | Ga0496110_0311522 | 3300048913 | Bacteria | 1434 |
| 675 | Ga0496110_0954325 | 3300048913 | Unclassified | 764 |
| 676 | Ga0496111_0000345 | 3300048914 | Bacteria | 22979 |
| 677 | Ga0496111_0000642 | 3300048914 | Bacteria | 18440 |
| 678 | Ga0496111_0034936 | 3300048914 | Bacteria | 3591 |
| 679 | Ga0496111_0035609 | 3300048914 | Bacteria | 3559 |
| 680 | Ga0496111_0119842 | 3300048914 | Unclassified | 1943 |
| 681 | Ga0496111_0158245 | 3300048914 | Unclassified | 1681 |
| 682 | Ga0496111_0353491 | 3300048914 | Unclassified | 1088 |
| 683 | Ga0496112_0036501 | 3300048915 | Bacteria | 4795 |
| 684 | Ga0496112_0062006 | 3300048915 | Bacteria | 3687 |
| 685 | Ga0496112_0075524 | 3300048915 | Bacteria | 3333 |
| 686 | Ga0496112_0148615 | 3300048915 | Bacteria | 2311 |
| 687 | Ga0496112_0185365 | 3300048915 | Bacteria | 2045 |
| 688 | Ga0496112_0229648 | 3300048915 | Unclassified | 1810 |
| 689 | Ga0496112_0448256 | 3300048915 | Bacteria | 1228 |
| 690 | Ga0496112_0470839 | 3300048915 | Bacteria | 1193 |
| 691 | Ga0496112_0563812 | 3300048915 | Unclassified | 1072 |
| 692 | Ga0496112_1167678 | 3300048915 | Bacteria | 687 |
| 693 | Ga0496112_1285320 | 3300048915 | Bacteria | 647 |
| 694 | Ga0496113_0180570 | 3300048916 | Unclassified | 1673 |
| 695 | Ga0496113_0226985 | 3300048916 | Bacteria | 1489 |
| 696 | Ga0496113_0241949 | 3300048916 | Bacteria | 1440 |
| 697 | Ga0496113_0267973 | 3300048916 | Bacteria | 1365 |
| 698 | Ga0496113_0439935 | 3300048916 | Bacteria | 1047 |
| 699 | Ga0496113_0543275 | 3300048916 | Bacteria | 932 |
| 700 | Ga0496113_0613932 | 3300048916 | Unclassified | 871 |
| 701 | Ga0496113_0927721 | 3300048916 | Bacteria | 688 |
| 702 | Ga0496113_1122498 | 3300048916 | Bacteria | 616 |
| 703 | Ga0496113_1395376 | 3300048916 | Unclassified | 543 |
| 704 | Ga0496114_0059483 | 3300048917 | Bacteria | 3192 |
| 705 | Ga0496114_0152595 | 3300048917 | Unclassified | 2004 |
| 706 | Ga0496114_0272063 | 3300048917 | Bacteria | 1493 |
| 707 | Ga0496114_0701312 | 3300048917 | Bacteria | 888 |
| 708 | Ga0496114_0878967 | 3300048917 | Bacteria | 777 |
| 709 | Ga0496114_1011704 | 3300048917 | Bacteria | 714 |
| 710 | Ga0496114_1281373 | 3300048917 | Unclassified | 620 |
| 711 | Ga0496114_1519597 | 3300048917 | Unclassified | 557 |
| 712 | Ga0496115_0152882 | 3300048918 | Bacteria | 1906 |
| 713 | Ga0496115_0982050 | 3300048918 | Bacteria | 646 |
| 714 | Ga0496115_1462254 | 3300048918 | Bacteria | 502 |
| 715 | Ga0501031_0430005 | 3300049568 | Bacteria | 853 |
| 716 | Ga0501032_0685315 | 3300049569 | Bacteria | 650 |
| 717 | Ga0501032_1037008 | 3300049569 | Bacteria | 515 |
| 718 | Ga0501034_0046629 | 3300049571 | Bacteria | 4379 |
| 719 | Ga0501036_0334866 | 3300049572 | Bacteria | 1264 |
| 720 | Ga0501038_0647408 | 3300049574 | Unclassified | 796 |
| 721 | Ga0501039_0243786 | 3300049575 | Bacteria | 1413 |
| 722 | Ga0501039_0533679 | 3300049575 | Unclassified | 921 |
| 723 | Ga0501040_0117324 | 3300049576 | Bacteria | 1865 |
| 724 | Ga0501040_0377534 | 3300049576 | Bacteria | 1017 |
| 725 | Ga0501041_0035238 | 3300049577 | Bacteria | 3032 |
| 726 | Ga0501042_0106975 | 3300049578 | Bacteria | 2014 |
| 727 | Ga0501042_0239752 | 3300049578 | Bacteria | 1308 |
| 728 | Ga0501043_0154179 | 3300049579 | Bacteria | 1797 |
| 729 | Ga0501046_0201620 | 3300049580 | Bacteria | 1480 |
| 730 | Ga0501046_0479591 | 3300049580 | Unclassified | 892 |
| 731 | Ga0501047_0840964 | 3300049581 | Bacteria | 732 |
| 732 | Ga0501047_0910691 | 3300049581 | Bacteria | 693 |
| 733 | Ga0501048_0392661 | 3300049582 | Bacteria | 991 |
| 734 | Ga0501048_1243193 | 3300049582 | Bacteria | 535 |
| 735 | Ga0501067_0282348 | 3300049583 | Bacteria | 924 |
| 736 | Ga0501067_0607338 | 3300049583 | Bacteria | 613 |
| 737 | Ga0501068_0068508 | 3300049584 | Bacteria | 2163 |
| 738 | Ga0501068_0333928 | 3300049584 | Bacteria | 973 |
| 739 | Ga0501068_0412201 | 3300049584 | Bacteria | 872 |
| 740 | Ga0501068_1182848 | 3300049584 | Unclassified | 506 |
| 741 | Ga0501069_0398546 | 3300049585 | Unclassified | 814 |
| 742 | Ga0501070_0009306 | 3300049586 | Bacteria | 8310 |
| 743 | Ga0501070_0130429 | 3300049586 | Bacteria | 2077 |
| 744 | Ga0501071_0070086 | 3300049587 | Unclassified | 2554 |
| 745 | Ga0501072_0367352 | 3300049588 | Bacteria | 1142 |
| 746 | Ga0501073_0013829 | 3300049589 | Bacteria | 5870 |
| 747 | Ga0501073_0143834 | 3300049589 | Bacteria | 1653 |
| 748 | Ga0501074_0013425 | 3300049590 | Bacteria | 5955 |
| 749 | Ga0501074_0418286 | 3300049590 | Bacteria | 951 |
| 750 | Ga0501076_0348798 | 3300049592 | Bacteria | 1215 |
| 751 | Ga0501076_0459708 | 3300049592 | Bacteria | 1048 |
| 752 | Ga0501077_0247616 | 3300049593 | Bacteria | 1133 |
| 753 | Ga0501079_0260629 | 3300049741 | Bacteria | 1355 |
| 754 | Ga0501079_0284378 | 3300049741 | Bacteria | 1293 |
| 755 | Ga0501079_0340318 | 3300049741 | Unclassified | 1175 |
| 756 | Ga0501079_0821971 | 3300049741 | Bacteria | 732 |
| 757 | Ga0501080_0003676 | 3300049742 | Bacteria | 13526 |
| 758 | Ga0501080_0082979 | 3300049742 | Bacteria | 2977 |
| 759 | Ga0501080_0406589 | 3300049742 | Bacteria | 1224 |
| 760 | Ga0501080_1346200 | 3300049742 | Unclassified | 610 |
| 761 | Ga0501081_0042520 | 3300049743 | Bacteria | 3114 |
| 762 | Ga0501081_0318015 | 3300049743 | Bacteria | 1144 |
| 763 | Ga0501081_1012561 | 3300049743 | Unclassified | 628 |
| 764 | Ga0501083_0369328 | 3300049744 | Bacteria | 933 |
| 765 | Ga0501035_0556511 | 3300049822 | Bacteria | 939 |
| 766 | Ga0501044_0404197 | 3300049823 | Unclassified | 1278 |
| 767 | Ga0501045_0531969 | 3300049824 | Bacteria | 872 |
| 768 | nmdc:mga0yw44_194240_c1 | 3300050492 | Bacteria | 1339 |
| 769 | nmdc:mga07m45_683768_c1 | 3300050496 | Bacteria | 590 |
| 770 | nmdc:mga05p37_1537599_c1 | 3300050507 | Unclassified | 660 |
| 771 | nmdc:mga05p37_2198689_c1 | 3300050507 | Unclassified | 512 |
| 772 | nmdc:mga09592_1161937_c1 | 3300050508 | Unclassified | 639 |
| 773 | nmdc:mga08y16_1137002_c1 | 3300050511 | Unclassified | 754 |
| 774 | nmdc:mga08y16_243332_c1 | 3300050511 | Unclassified | 1859 |
| 775 | nmdc:mga0n895_1580763_c1 | 3300050512 | Bacteria | 620 |
| 776 | nmdc:mga0n895_1799776_c1 | 3300050512 | Bacteria | 573 |
| 777 | nmdc:mga0n895_1889863_c1 | 3300050512 | Unclassified | 556 |
| 778 | nmdc:mga0n895_784284_c1 | 3300050512 | Unclassified | 944 |
| 779 | nmdc:mga0n895_86715_c1 | 3300050512 | Bacteria | 3127 |
| 780 | nmdc:mga0rr50_266484_c1 | 3300050513 | Bacteria | 1426 |
| 781 | nmdc:mga0rr50_787117_c1 | 3300050513 | Unclassified | 812 |
| 782 | nmdc:mga08x19_426251_c1 | 3300050514 | Bacteria | 932 |
| 783 | nmdc:mga0a205_332001_c1 | 3300050515 | Bacteria | 1390 |
| 784 | nmdc:mga0a205_615960_c1 | 3300050515 | Bacteria | 938 |
| 785 | Ga0495601_0047609 | 3300053077 | Bacteria | 2700 |
| 786 | Ga0495612_0381815 | 3300053078 | Unclassified | 639 |
| 787 | Ga0495595_0691937 | 3300053084 | Bacteria | 522 |
| 788 | Ga0495619_0022008 | 3300053085 | Bacteria | 4075 |
| 789 | Ga0495619_0114435 | 3300053085 | Bacteria | 1846 |
| 790 | Ga0495619_0699730 | 3300053085 | Bacteria | 689 |
| 791 | Ga0501084_0010477 | 3300054114 | Bacteria | 7662 |
| 792 | Ga0501084_0331647 | 3300054114 | Bacteria | 1285 |
| 793 | Ga0501084_0393017 | 3300054114 | Unclassified | 1172 |
| 794 | Ga0501082_0437494 | 3300060353 | Bacteria | 1142 |
| 795 | Ga0501082_1070418 | 3300060353 | Unclassified | 705 |
| 796 | Ga0501082_1657561 | 3300060353 | Bacteria | 558 |
| 797 | Ga0466962_0056241 | 3300061719 | Bacteria | 1879 |
| 798 | Ga0466962_0138937 | 3300061719 | Unclassified | 1176 |
| 799 | Ga0466962_0240340 | 3300061719 | Unclassified | 889 |
| 800 | Ga0466962_0252270 | 3300061719 | Bacteria | 867 |
| 801 | Ga0530510_1078785 | 3300061734 | Unclassified | 615 |
| 802 | Ga0070671_100170450 | |||
| 803 | JGI25407J50210_10014397 | |||
| 804 | Ga0070658_10060393 | |||
| 805 | Ga0070658_10234554 | |||
| 806 | Ga0070658_10407886 | |||
| 807 | Ga0070676_11105505 | |||
| 808 | Ga0070683_100001965 | |||
| 809 | Ga0070683_100085673 | |||
| 810 | Ga0070683_100100210 | |||
| 811 | Ga0070683_100160682 | |||
| 812 | Ga0070683_100283906 | |||
| 813 | Ga0070683_100442113 | |||
| 814 | Ga0068869_100657955 | |||
| 815 | Ga0068869_101032634 | |||
| 816 | Ga0070680_100054604 | |||
| 817 | Ga0070680_100057858 | |||
| 818 | Ga0070680_100167387 | |||
| 819 | Ga0070680_100199537 | |||
| 820 | Ga0070680_100297696 | |||
| 821 | Ga0070680_100673508 | |||
| 822 | Ga0070680_100948087 | |||
| 823 | Ga0070680_101015013 | |||
| 824 | Ga0070682_100049950 | |||
| 825 | Ga0070682_100250017 | |||
| 826 | Ga0070682_100260954 | |||
| 827 | Ga0070682_100763989 | |||
| 828 | Ga0070660_100006774 | |||
| 829 | Ga0070660_100042046 | |||
| 830 | Ga0070660_100131069 | |||
| 831 | Ga0070660_100248633 | |||
| 832 | Ga0070660_101024979 | |||
| 833 | Ga0070660_101493189 | |||
| 834 | Ga0070691_10031215 | |||
| 835 | Ga0070687_100167628 | |||
| 836 | Ga0070661_100016325 | |||
| 837 | Ga0070661_100290265 | |||
| 838 | Ga0070692_11079836 | |||
| 839 | Ga0070668_100306629 | |||
| 840 | Ga0070674_100076353 | |||
| 841 | Ga0070659_100172007 | |||
| 842 | Ga0070659_100213722 | |||
| 843 | Ga0070659_100230143 | |||
| 844 | Ga0070709_10057126 | |||
| 845 | Ga0070709_10331003 | |||
| 846 | Ga0070709_10835854 | |||
| 847 | Ga0070709_11520769 | |||
| 848 | Ga0070714_100022366 | |||
| 849 | Ga0070714_100024073 | |||
| 850 | Ga0070714_100100588 | |||
| 851 | Ga0070714_100120764 | |||
| 852 | Ga0070714_100353378 | |||
| 853 | Ga0070714_100412946 | |||
| 854 | Ga0070714_100473636 | |||
| 855 | Ga0070714_101757267 | |||
| 856 | Ga0070713_100309764 | |||
| 857 | Ga0070713_101676305 | |||
| 858 | Ga0070713_102251532 | |||
| 859 | Ga0070710_10915991 | |||
| 860 | Ga0070711_100979823 | |||
| 861 | Ga0070711_101375974 | |||
| 862 | Ga0070711_101481455 | |||
| 863 | Ga0070705_101889443 | |||
| 864 | Ga0070694_101293927 | |||
| 865 | Ga0070708_100874745 | |||
| 866 | Ga0070663_101067542 | |||
| 867 | Ga0070678_100060414 | |||
| 868 | Ga0070678_101693960 | |||
| 869 | Ga0070662_101719090 | |||
| 870 | Ga0070681_10010582 | |||
| 871 | Ga0070681_10051502 | |||
| 872 | Ga0070681_10052212 | |||
| 873 | Ga0070681_10065501 | |||
| 874 | Ga0070681_10739791 | |||
| 875 | Ga0070685_11001008 | |||
| 876 | Ga0070706_100445552 | |||
| 877 | Ga0070706_100546191 | |||
| 878 | Ga0070706_100760288 | |||
| 879 | Ga0070706_100944349 | |||
| 880 | Ga0070698_100050508 | |||
| 881 | Ga0070698_100283258 | |||
| 882 | Ga0070698_100639497 | |||
| 883 | Ga0070698_101598910 | |||
| 884 | Ga0070679_100094296 | |||
| 885 | Ga0070679_100148752 | |||
| 886 | Ga0070679_100173337 | |||
| 887 | Ga0070679_100509105 | |||
| 888 | Ga0070684_100035813 | |||
| 889 | Ga0070684_100088781 | |||
| 890 | Ga0070684_100660067 | |||
| 891 | Ga0070684_100782456 | |||
| 892 | Ga0070684_101263765 | |||
| 893 | Ga0070684_101726081 | |||
| 894 | Ga0070684_101893916 | |||
| 895 | Ga0070697_101627173 | |||
| 896 | Ga0068853_100193755 | |||
| 897 | Ga0068853_100241166 | |||
| 898 | Ga0068853_101074290 | |||
| 899 | Ga0070686_100213117 | |||
| 900 | Ga0070695_100492968 | |||
| 901 | Ga0070696_100188254 | |||
| 902 | Ga0070696_100751915 | |||
| 903 | Ga0070693_100019770 | |||
| 904 | Ga0070693_101066373 | |||
| 905 | Ga0070693_101194243 | |||
| 906 | Ga0070665_101378818 | |||
| 907 | Ga0070665_101639639 | |||
| 908 | Ga0070665_101645139 | |||
| 909 | Ga0070704_102306903 | |||
| 910 | Ga0068855_100012292 | |||
| 911 | Ga0068855_100108170 | |||
| 912 | Ga0068855_102517638 | |||
| 913 | Ga0070664_101008072 | |||
| 914 | Ga0068857_101206576 | |||
| 915 | Ga0068857_102083425 | |||
| 916 | Ga0068857_102401975 | |||
| 917 | Ga0068854_100315037 | |||
| 918 | Ga0068854_100481605 | |||
| 919 | Ga0068856_100031190 | |||
| 920 | Ga0068856_100076587 | |||
| 921 | Ga0068856_100234236 | |||
| 922 | Ga0068856_101395520 | |||
| 923 | Ga0068856_102190179 | |||
| 924 | Ga0070702_100678482 | |||
| 925 | Ga0068852_100379284 | |||
| 926 | Ga0068852_100385339 | |||
| 927 | Ga0068852_101314657 | |||
| 928 | Ga0068864_102286806 | |||
| 929 | Ga0068866_11012075 | |||
| 930 | Ga0068861_100311793 | |||
| 931 | Ga0068870_10548219 | |||
| 932 | Ga0068860_101321683 | |||
| 933 | Ga0068860_102347656 | |||
| 934 | Ga0081455_10017287 | |||
| 935 | Ga0081455_10280047 | |||
| 936 | Ga0081455_11057422 | |||
| 937 | Ga0081538_10006374 | |||
| 938 | Ga0070717_10834039 | |||
| 939 | Ga0075365_10212880 | |||
| 940 | Ga0070715_10236354 | |||
| 941 | Ga0070716_100334727 | |||
| 942 | Ga0070716_100362484 | |||
| 943 | Ga0070716_100688363 | |||
| 944 | Ga0070712_100200862 | |||
| 945 | Ga0070712_100594465 | |||
| 946 | Ga0097621_100215376 | |||
| 947 | Ga0097621_100681590 | |||
| 948 | Ga0097621_101735476 | |||
| 949 | Ga0075433_10211416 | |||
| 950 | Ga0075433_11364096 | |||
| 951 | Ga0075434_100064979 | |||
| 952 | Ga0075434_100248084 | |||
| 953 | Ga0075434_100610295 | |||
| 954 | Ga0075434_100644638 | |||
| 955 | Ga0075434_100849180 | |||
| 956 | Ga0075434_102589722 | |||
| 957 | Ga0068865_100430610 | |||
| 958 | Ga0075435_100019033 | |||
| 959 | Ga0075435_100165300 | |||
| 960 | Ga0075435_101461908 | |||
| 961 | Ga0099795_10246046 | |||
| 962 | Ga0105244_10566319 | |||
| 963 | Ga0105240_10013640 | |||
| 964 | Ga0105240_10315472 | |||
| 965 | Ga0105240_11167687 | |||
| 966 | Ga0105240_11815049 | |||
| 967 | Ga0105240_12088996 | |||
| 968 | Ga0111539_10284658 | |||
| 969 | Ga0111539_10353408 | |||
| 970 | Ga0111539_10732012 | |||
| 971 | Ga0105245_10015168 | |||
| 972 | Ga0105245_10336206 | |||
| 973 | Ga0105245_10429925 | |||
| 974 | Ga0105245_10903371 | |||
| 975 | Ga0105245_11309007 | |||
| 976 | Ga0105247_10694314 | |||
| 977 | Ga0114129_11126585 | |||
| 978 | Ga0114129_11625052 | |||
| 979 | Ga0114129_11947055 | |||
| 980 | Ga0105243_10286420 | |||
| 981 | Ga0105243_10787744 | |||
| 982 | Ga0105243_12050348 | |||
| 983 | Ga0105243_12127763 | |||
| 984 | Ga0105241_10140239 | |||
| 985 | Ga0105241_10277073 | |||
| 986 | Ga0105242_10547271 | |||
| 987 | Ga0105242_10762275 | |||
| 988 | Ga0105242_11033481 | |||
| 989 | Ga0105242_11138607 | |||
| 990 | Ga0105242_12514321 | |||
| 991 | Ga0105242_12521562 | |||
| 992 | Ga0105248_10816384 | |||
| 993 | Ga0105248_11176540 | |||
| 994 | Ga0105248_11180525 | |||
| 995 | Ga0105237_12178760 | |||
| 996 | Ga0105238_10221114 | |||
| 997 | Ga0105238_10530180 | |||
| 998 | Ga0105238_10987606 | |||
| 999 | Ga0105249_10535200 | |||
| 1000 | Ga0105249_11373645 | |||
| 1001 | Ga0105249_12905224 | |||
| 1002 | Ga0105249_13463290 | |||
| 1003 | Ga0105239_10144569 | |||
| 1004 | Ga0105239_10506833 | |||
| 1005 | Ga0105239_10882100 | |||
| 1006 | Ga0105246_10032008 | |||
| 1007 | Ga0105246_10324704 | |||
| 1008 | Ga0105246_10519247 | |||
| 1009 | Ga0157342_1053178 | |||
| 1010 | Ga0157373_10114639 | |||
| 1011 | Ga0157373_10140151 | |||
| 1012 | Ga0157373_10143477 | |||
| 1013 | Ga0157373_11023082 | |||
| 1014 | Ga0157371_10637146 | |||
| 1015 | Ga0157371_11126406 | |||
| 1016 | Ga0157371_11539663 | |||
| 1017 | Ga0157370_10008554 | |||
| 1018 | Ga0157370_10011551 | |||
| 1019 | Ga0157370_10179733 | |||
| 1020 | Ga0157370_10598101 | |||
| 1021 | Ga0157370_11685759 | |||
| 1022 | Ga0157369_10003021 | |||
| 1023 | Ga0157369_10003191 | |||
| 1024 | Ga0157369_10093669 | |||
| 1025 | Ga0157369_11020865 | |||
| 1026 | Ga0157369_11231920 | |||
| 1027 | Ga0157374_10065974 | |||
| 1028 | Ga0157378_13090503 | |||
| 1029 | Ga0163162_10350021 | |||
| 1030 | Ga0163162_11321867 | |||
| 1031 | Ga0157372_10538351 | |||
| 1032 | Ga0157372_11105384 | |||
| 1033 | Ga0157372_11776492 | |||
| 1034 | Ga0157372_11814872 | |||
| 1035 | Ga0157372_13397695 | |||
| 1036 | Ga0157375_10412513 | |||
| 1037 | Ga0157375_11015111 | |||
| 1038 | Ga0157375_12687673 | |||
| 1039 | Ga0163163_10114925 | |||
| 1040 | Ga0163163_11827790 | |||
| 1041 | Ga0182008_10121763 | |||
| 1042 | Ga0157377_10475764 | |||
| 1043 | Ga0157379_11948522 | |||
| 1044 | Ga0157376_10367854 | |||
| 1045 | Ga0157376_10900831 | |||
| 1046 | Ga0182006_1307657 | |||
| 1047 | Ga0197907_11123783 | |||
| 1048 | Ga0206356_10146978 | |||
| 1049 | Ga0206356_11031196 | |||
| 1050 | Ga0206356_11759030 | |||
| 1051 | Ga0206352_10752928 | |||
| 1052 | Ga0206354_10745355 | |||
| 1053 | Ga0206353_10831774 | |||
| 1054 | Ga0206353_11836039 | |||
| 1055 | Ga0213874_10407939 | |||
| 1056 | Ga0213871_10051870 | |||
| 1057 | Ga0207692_10236162 | |||
| 1058 | Ga0207642_10695251 | |||
| 1059 | Ga0207688_10178838 | |||
| 1060 | Ga0207680_11069233 | |||
| 1061 | Ga0207699_10944057 | |||
| 1062 | Ga0207699_11053879 | |||
| 1063 | Ga0207705_10029496 | |||
| 1064 | Ga0207705_10659748 | |||
| 1065 | Ga0207705_11011619 | |||
| 1066 | Ga0207684_10520291 | |||
| 1067 | Ga0207684_10555893 | |||
| 1068 | Ga0207684_10913941 | |||
| 1069 | Ga0207684_11091899 | |||
| 1070 | Ga0207654_10174542 | |||
| 1071 | Ga0207707_10007964 | |||
| 1072 | Ga0207707_10022793 | |||
| 1073 | Ga0207707_10050559 | |||
| 1074 | Ga0207707_10125932 | |||
| 1075 | Ga0207707_10279846 | |||
| 1076 | Ga0207707_11090718 | |||
| 1077 | Ga0207695_10076261 | |||
| 1078 | Ga0207695_10304465 | |||
| 1079 | Ga0207693_10859102 | |||
| 1080 | Ga0207693_11408592 | |||
| 1081 | Ga0207663_10760339 | |||
| 1082 | Ga0207663_11317400 | |||
| 1083 | Ga0207663_11327615 | |||
| 1084 | Ga0207660_10010651 | |||
| 1085 | Ga0207660_10037530 | |||
| 1086 | Ga0207660_10054397 | |||
| 1087 | Ga0207660_10379668 | |||
| 1088 | Ga0207660_10727503 | |||
| 1089 | Ga0207660_10802883 | |||
| 1090 | Ga0207662_10614301 | |||
| 1091 | Ga0207657_10001226 | |||
| 1092 | Ga0207657_10007076 | |||
| 1093 | Ga0207657_10411169 | |||
| 1094 | Ga0207657_11023219 | |||
| 1095 | Ga0207649_10149383 | |||
| 1096 | Ga0207649_10152813 | |||
| 1097 | Ga0207652_10008436 | |||
| 1098 | Ga0207652_10101952 | |||
| 1099 | Ga0207652_10120519 | |||
| 1100 | Ga0207652_10130486 | |||
| 1101 | Ga0207652_11290518 | |||
| 1102 | Ga0207646_10070951 | |||
| 1103 | Ga0207681_11210108 | |||
| 1104 | Ga0207694_11031304 | |||
| 1105 | Ga0207694_11152256 | |||
| 1106 | Ga0207659_10179314 | |||
| 1107 | Ga0207687_10162045 | |||
| 1108 | Ga0207687_10216030 | |||
| 1109 | Ga0207687_10317614 | |||
| 1110 | Ga0207687_11185832 | |||
| 1111 | Ga0207664_10057211 | |||
| 1112 | Ga0207664_10126538 | |||
| 1113 | Ga0207664_10139850 | |||
| 1114 | Ga0207664_10140172 | |||
| 1115 | Ga0207664_10195009 | |||
| 1116 | Ga0207664_10198324 | |||
| 1117 | Ga0207664_10445238 | |||
| 1118 | Ga0207664_10491677 | |||
| 1119 | Ga0207664_10827895 | |||
| 1120 | Ga0207664_11734137 | |||
| 1121 | Ga0207664_11822657 | |||
| 1122 | Ga0207644_10537413 | |||
| 1123 | Ga0207690_10112275 | |||
| 1124 | Ga0207690_10326360 | |||
| 1125 | Ga0207706_10535630 | |||
| 1126 | Ga0207706_11648118 | |||
| 1127 | Ga0207686_10626740 | |||
| 1128 | Ga0207686_10730712 | |||
| 1129 | Ga0207686_11133110 | |||
| 1130 | Ga0207669_11887550 | |||
| 1131 | Ga0207704_11794493 | |||
| 1132 | Ga0207704_11859702 | |||
| 1133 | Ga0207665_10073490 | |||
| 1134 | Ga0207665_10626469 | |||
| 1135 | Ga0207691_10876090 | |||
| 1136 | Ga0207711_10837023 | |||
| 1137 | Ga0207661_10000419 | |||
| 1138 | Ga0207661_10044100 | |||
| 1139 | Ga0207661_10046546 | |||
| 1140 | Ga0207661_10210686 | |||
| 1141 | Ga0207661_10232906 | |||
| 1142 | Ga0207661_10705676 | |||
| 1143 | Ga0207661_11923911 | |||
| 1144 | Ga0207661_12050040 | |||
| 1145 | Ga0207679_10130139 | |||
| 1146 | Ga0207667_10973997 | |||
| 1147 | Ga0207667_11765973 | |||
| 1148 | Ga0207667_12131340 | |||
| 1149 | Ga0207712_10717900 | |||
| 1150 | Ga0207668_10993458 | |||
| 1151 | Ga0207668_11095780 | |||
| 1152 | Ga0207640_10143789 | |||
| 1153 | Ga0207640_11014505 | |||
| 1154 | Ga0207677_10401543 | |||
| 1155 | Ga0207677_11805569 | |||
| 1156 | Ga0207703_10909446 | |||
| 1157 | Ga0207639_10125680 | |||
| 1158 | Ga0207639_11011502 | |||
| 1159 | Ga0207639_12181894 | |||
| 1160 | Ga0207678_10211784 | |||
| 1161 | Ga0207708_10290441 | |||
| 1162 | Ga0207708_11470680 | |||
| 1163 | Ga0207702_10031083 | |||
| 1164 | Ga0207702_10192159 | |||
| 1165 | Ga0207702_11096255 | |||
| 1166 | Ga0207702_11546803 | |||
| 1167 | Ga0207702_12018932 | |||
| 1168 | Ga0207648_10779523 | |||
| 1169 | Ga0207674_11131829 | |||
| 1170 | Ga0207674_11187735 | |||
| 1171 | Ga0207675_102355562 | |||
| 1172 | Ga0207683_10194136 | |||
| 1173 | Ga0207683_11086064 | |||
| 1174 | Ga0207698_10095595 | |||
| 1175 | Ga0207698_10486990 | |||
| 1176 | Ga0207698_10740913 | |||
| 1177 | Ga0207698_11954890 | |||
| 1178 | Ga0209179_1134938 | |||
| 1179 | Ga0268265_11909092 | |||
| 1180 | Ga0268264_11628043 | |||
| 1181 | Ga0265337_1031911 | |||
| 1182 | Ga0265319_1000686 | |||
| 1183 | Ga0265319_1087389 | |||
| 1184 | Ga0265334_10153902 | |||
| 1185 | Ga0265334_10223853 | |||
| 1186 | Ga0265334_10242321 | |||
| 1187 | Ga0265318_10007208 | |||
| 1188 | Ga0265318_10008090 | |||
| 1189 | Ga0265318_10348056 | |||
| 1190 | Ga0265322_10014406 | |||
| 1191 | Ga0265336_10000958 | |||
| 1192 | Ga0265336_10062984 | |||
| 1193 | Ga0265338_10001750 | |||
| 1194 | Ga0265338_10013644 | |||
| 1195 | Ga0265338_10027092 | |||
| 1196 | Ga0265338_10027548 | |||
| 1197 | Ga0265338_10040991 | |||
| 1198 | Ga0265338_10052415 | |||
| 1199 | Ga0265338_11065578 | |||
| 1200 | Ga0265338_11217008 | |||
| 1201 | Ga0265324_10033352 | |||
| 1202 | Ga0265324_10126015 | |||
| 1203 | Ga0265324_10192953 | |||
| 1204 | Ga0265330_10053429 | |||
| 1205 | Ga0265330_10121401 | |||
| 1206 | Ga0265332_10031157 | |||
| 1207 | Ga0265320_10182847 | |||
| 1208 | Ga0265320_10198647 | |||
| 1209 | Ga0265325_10053100 | |||
| 1210 | Ga0265325_10219509 | |||
| 1211 | Ga0265325_10315781 | |||
| 1212 | Ga0265329_10026696 | |||
| 1213 | Ga0265340_10275150 | |||
| 1214 | Ga0265339_10001458 | |||
| 1215 | Ga0265339_10262445 | |||
| 1216 | Ga0265331_10127516 | |||
| 1217 | Ga0265331_10554362 | |||
| 1218 | Ga0265327_10053757 | |||
| 1219 | Ga0265327_10123137 | |||
| 1220 | Ga0265327_10142464 | |||
| 1221 | Ga0265316_10031545 | |||
| 1222 | Ga0265316_10033839 | |||
| 1223 | Ga0265313_10025147 | |||
| 1224 | Ga0265313_10108460 | |||
| 1225 | Ga0265313_10236642 | |||
| 1226 | Ga0265314_10018137 | |||
| 1227 | Ga0265314_10047154 | |||
| 1228 | Ga0265342_10105274 | |||
| 1229 | Ga0265342_10532916 | |||
| 1230 | Ga0307416_100529061 | |||
| 1231 | Ga0307415_100369060 | |||
| 1232 | Ga0373949_0199970 | |||
| 1233 | Ga0373932_0118135 | |||
| 1234 | Ga0373939_0192325 | |||
| 1235 | Ga0373953_0567402 | |||
| 1236 | Ga0373943_0250126 | |||
| 1237 | Ga0373931_0095091 | |||
| 1238 | Ga0373947_0023365 | |||
| 1239 | Ga0373925_1469145 | |||
| 1240 | Ga0373925_1743929 | |||
| 1241 | Ga0395899_0009149 | |||
| 1242 | Ga0395899_0026374 | |||
| 1243 | Ga0395899_0389295 | |||
| 1244 | Ga0395899_0571514 | |||
| 1245 | Ga0395899_0839476 | |||
| 1246 | Ga0395899_0855128 | |||
| 1247 | Ga0395900_0054702 | |||
| 1248 | Ga0395900_0134196 | |||
| 1249 | Ga0395900_0283227 | |||
| 1250 | Ga0395900_0316310 | |||
| 1251 | Ga0395900_0707538 | |||
| 1252 | Ga0395900_0885071 | |||
| 1253 | Ga0395900_1230087 | |||
| 1254 | Ga0395900_1680894 | |||
| 1255 | Ga0395898_0025042 | |||
| 1256 | Ga0395898_0034580 | |||
| 1257 | Ga0395898_0065394 | |||
| 1258 | Ga0395898_0079817 | |||
| 1259 | Ga0395898_0536622 | |||
| 1260 | Ga0395898_0754350 | |||
| 1261 | Ga0395898_0934088 | |||
| 1262 | Ga0395898_1060194 | |||
| 1263 | Ga0395898_1114864 | |||
| 1264 | Ga0395898_1987844 | |||
| 1265 | Ga0395905_0025167 | |||
| 1266 | Ga0395905_0043009 | |||
| 1267 | Ga0395905_0045169 | |||
| 1268 | Ga0395905_0128122 | |||
| 1269 | Ga0395905_0446086 | |||
| 1270 | Ga0395905_1130541 | |||
| 1271 | Ga0395905_1352309 | |||
| 1272 | Ga0395901_0014062 | |||
| 1273 | Ga0395901_0061643 | |||
| 1274 | Ga0395901_0100687 | |||
| 1275 | Ga0395901_0119062 | |||
| 1276 | Ga0395901_0153745 | |||
| 1277 | Ga0395901_0294928 | |||
| 1278 | Ga0395901_0386779 | |||
| 1279 | Ga0395901_0770764 | |||
| 1280 | Ga0395901_0898162 | |||
| 1281 | Ga0395901_1140933 | |||
| 1282 | Ga0395901_1583827 | |||
| 1283 | Ga0395901_1720791 | |||
| 1284 | Ga0395901_1992796 | |||
| 1285 | Ga0242420_011944 | |||
| 1286 | Ga0436360_0647028 | |||
| 1287 | Ga0436363_0933607 | |||
| 1288 | Ga0436362_0712128 | |||
| 1289 | Ga0451802_0226917 | |||
| 1290 | Ga0451845_0784403 | |||
| 1291 | Ga0439448_0065025 | |||
| 1292 | Ga0451577_1182173 | |||
| 1293 | Ga0466969_0017481 | |||
| 1294 | Ga0466966_0050309 | |||
| 1295 | Ga0466966_0160101 | |||
| 1296 | Ga0466961_0089191 | |||
| 1297 | Ga0466961_0445081 | |||
| 1298 | Ga0466961_0823091 | |||
| 1299 | Ga0466963_0019397 | |||
| 1300 | Ga0466963_0053658 | |||
| 1301 | Ga0466963_0060635 | |||
| 1302 | Ga0466963_0268646 | |||
| 1303 | Ga0466963_0279527 | |||
| 1304 | Ga0466963_0514375 | |||
| 1305 | Ga0466963_1202581 | |||
| 1306 | Ga0466964_0256755 | |||
| 1307 | Ga0466964_0600942 | |||
| 1308 | Ga0453684_1248597 | |||
| 1309 | Ga0466971_0016330 | |||
| 1310 | Ga0466971_0017567 | |||
| 1311 | Ga0466971_0276697 | |||
| 1312 | Ga0466971_0617135 | |||
| 1313 | Ga0466968_0399911 | |||
| 1314 | Ga0466968_0485378 | |||
| 1315 | Ga0466970_0791044 | |||
| 1316 | Ga0466957_0017973 | |||
| 1317 | Ga0466957_0776900 | |||
| 1318 | Ga0466960_0726004 | |||
| 1319 | Ga0466959_0059027 | |||
| 1320 | Ga0466959_0179274 | |||
| 1321 | Ga0466959_1116333 | |||
| 1322 | Ga0466958_0156269 | |||
| 1323 | Ga0466958_0169476 | |||
| 1324 | Ga0466958_0214865 | |||
| 1325 | Ga0466958_0539979 | |||
| 1326 | Ga0466958_0818813 | |||
| 1327 | Ga0466967_0000665 | |||
| 1328 | Ga0466967_0012229 | |||
| 1329 | Ga0466967_0016463 | |||
| 1330 | Ga0466967_0123765 | |||
| 1331 | Ga0466967_0152619 | |||
| 1332 | Ga0466967_0248562 | |||
| 1333 | Ga0466967_0330861 | |||
| 1334 | Ga0466967_0343463 | |||
| 1335 | Ga0466967_0448713 | |||
| 1336 | Ga0466967_0778897 | |||
| 1337 | Ga0466967_1610025 | |||
| 1338 | Ga0466967_1780196 | |||
| 1339 | Ga0466967_2130470 | |||
| 1340 | Ga0495603_0043187 | |||
| 1341 | Ga0495603_0127929 | |||
| 1342 | Ga0495629_0126592 | |||
| 1343 | Ga0495629_0220152 | |||
| 1344 | Ga0495629_0852593 | |||
| 1345 | Ga0495641_0068551 | |||
| 1346 | Ga0495641_0231703 | |||
| 1347 | Ga0495641_0271495 | |||
| 1348 | Ga0495653_0118145 | |||
| 1349 | Ga0495582_0294951 | |||
| 1350 | Ga0495582_0529915 | |||
| 1351 | Ga0495639_0117159 | |||
| 1352 | Ga0495584_0181791 | |||
| 1353 | Ga0495594_0270912 | |||
| 1354 | Ga0495594_0675019 | |||
| 1355 | Ga0495596_0146545 | |||
| 1356 | Ga0495596_0344646 | |||
| 1357 | Ga0495608_0244988 | |||
| 1358 | Ga0495608_0688522 | |||
| 1359 | Ga0495618_0079260 | |||
| 1360 | Ga0495618_0585194 | |||
| 1361 | Ga0495628_0879210 | |||
| 1362 | Ga0495630_0233728 | |||
| 1363 | Ga0495630_0603664 | |||
| 1364 | Ga0495630_1177842 | |||
| 1365 | Ga0495630_1352751 | |||
| 1366 | Ga0495631_0500587 | |||
| 1367 | Ga0495631_0508679 | |||
| 1368 | Ga0495644_0277032 | |||
| 1369 | Ga0495644_0374724 | |||
| 1370 | Ga0495663_0124039 | |||
| 1371 | Ga0495652_0014440 | |||
| 1372 | Ga0495652_0515508 | |||
| 1373 | Ga0495652_0745034 | |||
| 1374 | Ga0495665_0669898 | |||
| 1375 | Ga0495586_0136639 | |||
| 1376 | Ga0495598_0190692 | |||
| 1377 | Ga0495645_0918652 | |||
| 1378 | Ga0495633_0291349 | |||
| 1379 | Ga0495667_0188133 | |||
| 1380 | Ga0495667_0880945 | |||
| 1381 | Ga0495656_0323896 | |||
| 1382 | Ga0495634_0047348 | |||
| 1383 | Ga0495634_0084690 | |||
| 1384 | Ga0495634_0415350 | |||
| 1385 | Ga0495634_0495861 | |||
| 1386 | Ga0495635_0038322 | |||
| 1387 | Ga0495588_0344851 | |||
| 1388 | Ga0495657_0318700 | |||
| 1389 | Ga0495647_0253128 | |||
| 1390 | Ga0495658_0012444 | |||
| 1391 | Ga0495658_0165806 | |||
| 1392 | Ga0495658_0909999 | |||
| 1393 | Ga0495613_0070031 | |||
| 1394 | Ga0495613_0345814 | |||
| 1395 | Ga0495613_0770428 | |||
| 1396 | Ga0495670_0263649 | |||
| 1397 | Ga0495670_0579011 | |||
| 1398 | Ga0495600_0082691 | |||
| 1399 | Ga0495600_0523051 | |||
| 1400 | Ga0495581_0275740 | |||
| 1401 | Ga0495674_0328860 | |||
| 1402 | Ga0495674_1194786 | |||
| 1403 | Ga0495676_0184400 | |||
| 1404 | Ga0495676_1069494 | |||
| 1405 | Ga0495680_0209786 | |||
| 1406 | Ga0495680_0628623 | |||
| 1407 | Ga0495675_0757192 | |||
| 1408 | Ga0495675_0846110 | |||
| 1409 | Ga0495685_287189 | |||
| 1410 | Ga0496100_0008310 | |||
| 1411 | Ga0496100_0177837 | |||
| 1412 | Ga0496100_0406561 | |||
| 1413 | Ga0496100_0555990 | |||
| 1414 | Ga0496100_1551442 | |||
| 1415 | Ga0496101_0008526 | |||
| 1416 | Ga0496101_0021007 | |||
| 1417 | Ga0496101_0405404 | |||
| 1418 | Ga0496101_0753353 | |||
| 1419 | Ga0496101_0759359 | |||
| 1420 | Ga0496101_1307891 | |||
| 1421 | Ga0496101_1591522 | |||
| 1422 | Ga0496102_0028813 | |||
| 1423 | Ga0496102_0047895 | |||
| 1424 | Ga0496102_0160221 | |||
| 1425 | Ga0496102_0459104 | |||
| 1426 | Ga0496102_0663995 | |||
| 1427 | Ga0496102_0718626 | |||
| 1428 | Ga0496103_0032071 | |||
| 1429 | Ga0496103_0086174 | |||
| 1430 | Ga0496103_1065595 | |||
| 1431 | Ga0496104_0011259 | |||
| 1432 | Ga0496104_0012515 | |||
| 1433 | Ga0496104_0037274 | |||
| 1434 | Ga0496104_0037541 | |||
| 1435 | Ga0496104_0070949 | |||
| 1436 | Ga0496104_0088505 | |||
| 1437 | Ga0496104_0377495 | |||
| 1438 | Ga0496105_0000738 | |||
| 1439 | Ga0496105_0102216 | |||
| 1440 | Ga0496105_0120817 | |||
| 1441 | Ga0496105_0703671 | |||
| 1442 | Ga0496105_0752089 | |||
| 1443 | Ga0496105_1189500 | |||
| 1444 | Ga0496106_0025788 | |||
| 1445 | Ga0496106_0040595 | |||
| 1446 | Ga0496106_0146907 | |||
| 1447 | Ga0496106_0318043 | |||
| 1448 | Ga0496106_0936238 | |||
| 1449 | Ga0496107_0000717 | |||
| 1450 | Ga0496107_0075160 | |||
| 1451 | Ga0496107_0239804 | |||
| 1452 | Ga0496107_0453157 | |||
| 1453 | Ga0496107_1291907 | |||
| 1454 | Ga0496108_0015271 | |||
| 1455 | Ga0496108_0070996 | |||
| 1456 | Ga0496108_0087222 | |||
| 1457 | Ga0496108_0268159 | |||
| 1458 | Ga0496108_0540419 | |||
| 1459 | Ga0496108_0555285 | |||
| 1460 | Ga0496108_0920706 | |||
| 1461 | Ga0496108_0924128 | |||
| 1462 | Ga0496109_0013710 | |||
| 1463 | Ga0496109_0068948 | |||
| 1464 | Ga0496109_0075705 | |||
| 1465 | Ga0496109_0135240 | |||
| 1466 | Ga0496109_0271501 | |||
| 1467 | Ga0496109_0410758 | |||
| 1468 | Ga0496109_1117290 | |||
| 1469 | Ga0496109_1559498 | |||
| 1470 | Ga0496110_0000219 | |||
| 1471 | Ga0496110_0000677 | |||
| 1472 | Ga0496110_0020333 | |||
| 1473 | Ga0496110_0104779 | |||
| 1474 | Ga0496110_0105600 | |||
| 1475 | Ga0496110_0311522 | |||
| 1476 | Ga0496110_0954325 | |||
| 1477 | Ga0496111_0000345 | |||
| 1478 | Ga0496111_0000642 | |||
| 1479 | Ga0496111_0034936 | |||
| 1480 | Ga0496111_0035609 | |||
| 1481 | Ga0496111_0119842 | |||
| 1482 | Ga0496111_0158245 | |||
| 1483 | Ga0496111_0353491 | |||
| 1484 | Ga0496112_0036501 | |||
| 1485 | Ga0496112_0062006 | |||
| 1486 | Ga0496112_0075524 | |||
| 1487 | Ga0496112_0148615 | |||
| 1488 | Ga0496112_0185365 | |||
| 1489 | Ga0496112_0229648 | |||
| 1490 | Ga0496112_0448256 | |||
| 1491 | Ga0496112_0470839 | |||
| 1492 | Ga0496112_0563812 | |||
| 1493 | Ga0496112_1167678 | |||
| 1494 | Ga0496112_1285320 | |||
| 1495 | Ga0496113_0180570 | |||
| 1496 | Ga0496113_0226985 | |||
| 1497 | Ga0496113_0241949 | |||
| 1498 | Ga0496113_0267973 | |||
| 1499 | Ga0496113_0439935 | |||
| 1500 | Ga0496113_0543275 | |||
| 1501 | Ga0496113_0613932 | |||
| 1502 | Ga0496113_0927721 | |||
| 1503 | Ga0496113_1122498 | |||
| 1504 | Ga0496113_1395376 | |||
| 1505 | Ga0496114_0059483 | |||
| 1506 | Ga0496114_0152595 | |||
| 1507 | Ga0496114_0272063 | |||
| 1508 | Ga0496114_0701312 | |||
| 1509 | Ga0496114_0878967 | |||
| 1510 | Ga0496114_1011704 | |||
| 1511 | Ga0496114_1281373 | |||
| 1512 | Ga0496114_1519597 | |||
| 1513 | Ga0496115_0152882 | |||
| 1514 | Ga0496115_0982050 | |||
| 1515 | Ga0496115_1462254 | |||
| 1516 | Ga0501031_0430005 | |||
| 1517 | Ga0501032_0685315 | |||
| 1518 | Ga0501032_1037008 | |||
| 1519 | Ga0501034_0046629 | |||
| 1520 | Ga0501036_0334866 | |||
| 1521 | Ga0501038_0647408 | |||
| 1522 | Ga0501039_0243786 | |||
| 1523 | Ga0501039_0533679 | |||
| 1524 | Ga0501040_0117324 | |||
| 1525 | Ga0501040_0377534 | |||
| 1526 | Ga0501041_0035238 | |||
| 1527 | Ga0501042_0106975 | |||
| 1528 | Ga0501042_0239752 | |||
| 1529 | Ga0501043_0154179 | |||
| 1530 | Ga0501046_0201620 | |||
| 1531 | Ga0501046_0479591 | |||
| 1532 | Ga0501047_0840964 | |||
| 1533 | Ga0501047_0910691 | |||
| 1534 | Ga0501048_0392661 | |||
| 1535 | Ga0501048_1243193 | |||
| 1536 | Ga0501067_0282348 | |||
| 1537 | Ga0501067_0607338 | |||
| 1538 | Ga0501068_0068508 | |||
| 1539 | Ga0501068_0333928 | |||
| 1540 | Ga0501068_0412201 | |||
| 1541 | Ga0501068_1182848 | |||
| 1542 | Ga0501069_0398546 | |||
| 1543 | Ga0501070_0009306 | |||
| 1544 | Ga0501070_0130429 | |||
| 1545 | Ga0501071_0070086 | |||
| 1546 | Ga0501072_0367352 | |||
| 1547 | Ga0501073_0013829 | |||
| 1548 | Ga0501073_0143834 | |||
| 1549 | Ga0501074_0013425 | |||
| 1550 | Ga0501074_0418286 | |||
| 1551 | Ga0501076_0348798 | |||
| 1552 | Ga0501076_0459708 | |||
| 1553 | Ga0501077_0247616 | |||
| 1554 | Ga0501079_0260629 | |||
| 1555 | Ga0501079_0284378 | |||
| 1556 | Ga0501079_0340318 | |||
| 1557 | Ga0501079_0821971 | |||
| 1558 | Ga0501080_0003676 | |||
| 1559 | Ga0501080_0082979 | |||
| 1560 | Ga0501080_0406589 | |||
| 1561 | Ga0501080_1346200 | |||
| 1562 | Ga0501081_0042520 | |||
| 1563 | Ga0501081_0318015 | |||
| 1564 | Ga0501081_1012561 | |||
| 1565 | Ga0501083_0369328 | |||
| 1566 | Ga0501035_0556511 | |||
| 1567 | Ga0501044_0404197 | |||
| 1568 | Ga0501045_0531969 | |||
| 1569 | nmdc:mga0yw44_194240_c1 | |||
| 1570 | nmdc:mga07m45_683768_c1 | |||
| 1571 | nmdc:mga05p37_1537599_c1 | |||
| 1572 | nmdc:mga05p37_2198689_c1 | |||
| 1573 | nmdc:mga09592_1161937_c1 | |||
| 1574 | nmdc:mga08y16_1137002_c1 | |||
| 1575 | nmdc:mga08y16_243332_c1 | |||
| 1576 | nmdc:mga0n895_1580763_c1 | |||
| 1577 | nmdc:mga0n895_1799776_c1 | |||
| 1578 | nmdc:mga0n895_1889863_c1 | |||
| 1579 | nmdc:mga0n895_784284_c1 | |||
| 1580 | nmdc:mga0n895_86715_c1 | |||
| 1581 | nmdc:mga0rr50_266484_c1 | |||
| 1582 | nmdc:mga0rr50_787117_c1 | |||
| 1583 | nmdc:mga08x19_426251_c1 | |||
| 1584 | nmdc:mga0a205_332001_c1 | |||
| 1585 | nmdc:mga0a205_615960_c1 | |||
| 1586 | Ga0495601_0047609 | |||
| 1587 | Ga0495612_0381815 | |||
| 1588 | Ga0495595_0691937 | |||
| 1589 | Ga0495619_0022008 | |||
| 1590 | Ga0495619_0114435 | |||
| 1591 | Ga0495619_0699730 | |||
| 1592 | Ga0501084_0010477 | |||
| 1593 | Ga0501084_0331647 | |||
| 1594 | Ga0501084_0393017 | |||
| 1595 | Ga0501082_0437494 | |||
| 1596 | Ga0501082_1070418 | |||
| 1597 | Ga0501082_1657561 | |||
| 1598 | Ga0466962_0056241 | |||
| 1599 | Ga0466962_0138937 | |||
| 1600 | Ga0466962_0240340 | |||
| 1601 | Ga0466962_0252270 | |||
| 1602 | Ga0530510_1078785 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oqt-assembly1.cif.gz_A | crystal structure of a bacterial cationic amino acid transporter (cat) homologue | 0.5256 | 8 | 22 |
| 1i97-assembly1.cif.gz_H | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline | 0.3453 | 12 | 30 |
| 5oqt-assembly1.cif.gz_A | crystal structure of a bacterial cationic amino acid transporter (cat) homologue | 0.2733 | 8 | 22 |
| 1i97-assembly1.cif.gz_H | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline | 0.2633 | 12 | 30 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5niiA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.5554 | 9 | 30 | 3.50.50.60 |
| 3fmwC03 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin; | 0.4633 | 10 | 29 | 3.40.30.120 |
| 3fmwC03 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin; | 0.3603 | 10 | 29 | 3.40.30.120 |
| 5niiA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.3464 | 9 | 30 | 3.50.50.60 |
| af_Q10LF0_1_138_1.25.40.20 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain | 0.3273 | 3 | 42 | 1.25.40.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523DGH4-F1-model_v4 | Redoxin domain-containing protein | 0.7579 | 5 | 40 |
|
| AF-A0A7Y5BMY5-F1-model_v4 | Redoxin domain-containing protein | 0.7535 | 1 | 39 |
|
| AF-A0A2E7AI19-F1-model_v4 | Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein | 0.7351 | 1 | 40 |
|
| AF-A0A7M3YJM6-F1-model_v4 | Uncharacterized protein | 0.7305 | 8 | 42 |
|
| AF-A0A350T049-F1-model_v4 | Redoxin domain-containing protein | 0.7293 | 5 | 41 |
|