F481405

General Info

Members Datasets Scaffolds Average Seq Length
801 357 1602 178

Family's Representative Sequence

Representative Sequence 3300005354|Ga0070675_100177360|Ga0070675_1001773602
Length 207
Sequence MKREPRVYGLLAEFPQPENLLAAATAARAAGYRRMDAYTPFPVHGLSEAIGFHTTRLPAIVLVGGIVGACLGFGLQYWYETQHYMMNVGGRPHNSWPSFVVITFETTILCAAISAVLGMLALNGLPQPYHPLFNVPSFELASRSHFFLCIEARDPKFDLDATRDFLEDLGPISIAVVPTGRVKPVRAGQGARAYPAAQPMAMAVDTP

Samples

Sample ID Description Type Environment
1 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
203 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
246 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
247 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
248 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
259 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
269 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
339 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
342 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
343 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
344 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
353 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
357 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.63
Metatranscriptomes 0.25
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0.12
Rhizoplane 2.87
Rhizosphere 93.76
Stem 0
Stem Tuber 0
Unclassified 12.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070675_100177360 3300005354 Bacteria 1841
2 JGI25165J46597_1018651 3300003214 Bacteria 918
3 rootH2_10035698 3300003320 Bacteria 1956
4 rootH2_10083533 3300003320 Bacteria 2230
5 rootL2_10141580 3300003322 Bacteria 2037
6 rootH1_10151438 3300003323 Bacteria 1162
7 Ga0065712_10102327 3300005290 Bacteria 2012
8 Ga0065715_10492090 3300005293 Unclassified 787
9 Ga0070658_10711045 3300005327 Bacteria 872
10 Ga0070676_10188013 3300005328 Bacteria 1346
11 Ga0070690_100494987 3300005330 Bacteria 914
12 Ga0068869_100065280 3300005334 Bacteria 2679
13 Ga0068869_100122722 3300005334 Bacteria 1989
14 Ga0070680_100054088 3300005336 Bacteria 3277
15 Ga0070680_100086467 3300005336 Bacteria 2592
16 Ga0070682_100121874 3300005337 Bacteria 1752
17 Ga0068868_100258221 3300005338 Bacteria 1468
18 Ga0070660_100756065 3300005339 Bacteria 816
19 Ga0070689_100028698 3300005340 Bacteria 4208
20 Ga0070689_100098189 3300005340 Bacteria 2316
21 Ga0070689_100247514 3300005340 Bacteria 1470
22 Ga0070689_100310444 3300005340 Unclassified 1315
23 Ga0070689_100411475 3300005340 Bacteria 1145
24 Ga0070689_101211979 3300005340 Bacteria 678
25 Ga0070689_101324156 3300005340 Unclassified 649
26 Ga0070687_100002848 3300005343 Bacteria 6610
27 Ga0070687_100102823 3300005343 Bacteria 1603
28 Ga0070661_100035788 3300005344 Bacteria 3608
29 Ga0070692_10014354 3300005345 Bacteria 3719
30 Ga0070692_10106336 3300005345 Bacteria 1546
31 Ga0070692_10189571 3300005345 Bacteria 1197
32 Ga0070668_100139938 3300005347 Bacteria 1949
33 Ga0070668_100331963 3300005347 Bacteria 1283
34 Ga0070669_100005918 3300005353 Bacteria 8825
35 Ga0070669_100052456 3300005353 Bacteria 2984
36 Ga0070669_100062077 3300005353 Bacteria 2747
37 Ga0070669_100984427 3300005353 Unclassified 723
38 Ga0070675_100018637 3300005354 Bacteria 5525
39 Ga0070671_100123562 3300005355 Bacteria 2179
40 Ga0070671_100472548 3300005355 Bacteria 1077
41 Ga0070671_101219441 3300005355 Unclassified 662
42 Ga0070674_100031475 3300005356 Bacteria 3516
43 Ga0070674_100062837 3300005356 Bacteria 2596
44 Ga0070673_100105727 3300005364 Bacteria 2326
45 Ga0070673_100203567 3300005364 Bacteria 1706
46 Ga0070688_101083381 3300005365 Bacteria 640
47 Ga0070659_100839695 3300005366 Bacteria 800
48 Ga0070667_100978557 3300005367 Unclassified 789
49 Ga0070709_10727361 3300005434 Bacteria 774
50 Ga0070713_100026778 3300005436 Bacteria 4533
51 Ga0070713_100225882 3300005436 Bacteria 1700
52 Ga0070713_100273412 3300005436 Unclassified 1548
53 Ga0070713_101317428 3300005436 Unclassified 700
54 Ga0070701_10091831 3300005438 Bacteria 1665
55 Ga0070705_100000590 3300005440 Bacteria 21129
56 Ga0070705_100998485 3300005440 Bacteria 679
57 Ga0070694_100062749 3300005444 Bacteria 2539
58 Ga0070708_100068778 3300005445 Bacteria 3183
59 Ga0070708_100176329 3300005445 Bacteria 1997
60 Ga0070708_100619722 3300005445 Bacteria 1020
61 Ga0070663_100641806 3300005455 Bacteria 897
62 Ga0070678_100019827 3300005456 Bacteria 4396
63 Ga0070678_100214489 3300005456 Bacteria 1597
64 Ga0070678_100966101 3300005456 Bacteria 782
65 Ga0070678_101056167 3300005456 Bacteria 748
66 Ga0070662_100210454 3300005457 Bacteria 1547
67 Ga0070662_100802672 3300005457 Unclassified 800
68 Ga0070681_10000234 3300005458 Bacteria 43792
69 Ga0070681_10007335 3300005458 Bacteria 10772
70 Ga0068867_100011643 3300005459 Bacteria 6209
71 Ga0068867_100142107 3300005459 Bacteria 1877
72 Ga0068867_100397836 3300005459 Bacteria 1161
73 Ga0068867_100639611 3300005459 Bacteria 932
74 Ga0068867_100677063 3300005459 Bacteria 908
75 Ga0070685_10005996 3300005466 Bacteria 6191
76 Ga0070685_10290502 3300005466 Bacteria 1098
77 Ga0070706_100057339 3300005467 Bacteria 3594
78 Ga0070706_100092325 3300005467 Bacteria 2808
79 Ga0070707_100052632 3300005468 Bacteria 3903
80 Ga0070698_100110887 3300005471 Bacteria 2708
81 Ga0070698_100206106 3300005471 Bacteria 1901
82 Ga0070698_100281455 3300005471 Bacteria 1595
83 Ga0070698_100689694 3300005471 Unclassified 963
84 Ga0070698_100999187 3300005471 Bacteria 784
85 Ga0070699_100000090 3300005518 Bacteria 87042
86 Ga0070699_100260195 3300005518 Bacteria 1552
87 Ga0070679_100003892 3300005530 Bacteria 13727
88 Ga0070679_100018627 3300005530 Bacteria 6740
89 Ga0070679_100270581 3300005530 Bacteria 1653
90 Ga0070679_100664968 3300005530 Bacteria 984
91 Ga0070697_100026869 3300005536 Bacteria 4602
92 Ga0070697_100112055 3300005536 Bacteria 2275
93 Ga0068853_100077331 3300005539 Bacteria 2907
94 Ga0070672_100000377 3300005543 Bacteria 25848
95 Ga0070672_100284698 3300005543 Bacteria 1398
96 Ga0070672_100594393 3300005543 Bacteria 963
97 Ga0070672_100828627 3300005543 Bacteria 815
98 Ga0070686_100282532 3300005544 Bacteria 1225
99 Ga0070686_100392254 3300005544 Unclassified 1054
100 Ga0070686_100959409 3300005544 Unclassified 699
101 Ga0070695_100016533 3300005545 Bacteria 4467
102 Ga0070695_100016629 3300005545 Bacteria 4456
103 Ga0070695_100112305 3300005545 Bacteria 1851
104 Ga0070695_100231682 3300005545 Bacteria 1335
105 Ga0070695_100244966 3300005545 Bacteria 1302
106 Ga0070695_100304315 3300005545 Bacteria 1179
107 Ga0070696_100000001 3300005546 Bacteria 174282
108 Ga0070696_100029173 3300005546 Bacteria 3768
109 Ga0070693_100000924 3300005547 Bacteria 13036
110 Ga0070665_100008057 3300005548 Bacteria 10668
111 Ga0070665_100430038 3300005548 Bacteria 1329
112 Ga0070665_101118879 3300005548 Bacteria 799
113 Ga0070704_100040822 3300005549 Bacteria 3198
114 Ga0070704_100040843 3300005549 Bacteria 3197
115 Ga0070704_100054137 3300005549 Bacteria 2839
116 Ga0070704_100056130 3300005549 Bacteria 2796
117 Ga0070704_100078195 3300005549 Bacteria 2426
118 Ga0070704_100150598 3300005549 Unclassified 1828
119 Ga0070704_100169012 3300005549 Bacteria 1737
120 Ga0070704_100341734 3300005549 Bacteria 1261
121 Ga0068855_100204804 3300005563 Bacteria 2220
122 Ga0068855_100249663 3300005563 Bacteria 1979
123 Ga0068857_100171571 3300005577 Bacteria 1972
124 Ga0068857_100185608 3300005577 Bacteria 1893
125 Ga0068857_100193022 3300005577 Bacteria 1855
126 Ga0068857_100525487 3300005577 Bacteria 1112
127 Ga0068854_100249861 3300005578 Bacteria 1416
128 Ga0068854_100357742 3300005578 Bacteria 1197
129 Ga0068856_100877449 3300005614 Unclassified 916
130 Ga0070702_100143049 3300005615 Bacteria 1526
131 Ga0070702_100691831 3300005615 Bacteria 776
132 Ga0070702_100938733 3300005615 Bacteria 680
133 Ga0068859_100013449 3300005617 Bacteria 8206
134 Ga0068859_100043319 3300005617 Bacteria 4523
135 Ga0068859_100124219 3300005617 Bacteria 2649
136 Ga0068864_100000103 3300005618 Bacteria 82304
137 Ga0068864_101146196 3300005618 Bacteria 775
138 Ga0068866_10056253 3300005718 Bacteria 2023
139 Ga0068861_100062134 3300005719 Bacteria 2868
140 Ga0068861_100170398 3300005719 Bacteria 1804
141 Ga0068861_100325367 3300005719 Bacteria 1340
142 Ga0068861_101345694 3300005719 Bacteria 696
143 Ga0068851_10086236 3300005834 Bacteria 1647
144 Ga0068870_10006617 3300005840 Bacteria 5117
145 Ga0068870_10075426 3300005840 Bacteria 1850
146 Ga0068863_100589186 3300005841 Bacteria 1100
147 Ga0068858_100036330 3300005842 Bacteria 4568
148 Ga0068858_100095035 3300005842 Bacteria 2777
149 Ga0068858_100511325 3300005842 Unclassified 1161
150 Ga0068858_100749311 3300005842 Bacteria 952
151 Ga0068860_100096604 3300005843 Bacteria 2816
152 Ga0068860_100387126 3300005843 Bacteria 1381
153 Ga0068860_100428067 3300005843 Bacteria 1313
154 Ga0068860_101612464 3300005843 Bacteria 671
155 Ga0068862_100051486 3300005844 Bacteria 3522
156 Ga0068862_100072619 3300005844 Bacteria 2973
157 Ga0068862_100243823 3300005844 Bacteria 1635
158 Ga0068862_100844130 3300005844 Bacteria 897
159 Ga0081455_10000777 3300005937 Bacteria 41065
160 Ga0081455_10145792 3300005937 Bacteria 1832
161 Ga0081538_10003485 3300005981 Bacteria 14849
162 Ga0081538_10006428 3300005981 Bacteria 10348
163 Ga0081538_10083312 3300005981 Bacteria 1691
164 Ga0081539_10011114 3300005985 Bacteria 7187
165 Ga0070717_10150090 3300006028 Bacteria 2016
166 Ga0070717_10264646 3300006028 Bacteria 1522
167 Ga0070717_11026584 3300006028 Unclassified 751
168 Ga0075363_100052165 3300006048 Unclassified 2183
169 Ga0075432_10051380 3300006058 Bacteria 1455
170 Ga0070716_100216370 3300006173 Bacteria 1284
171 Ga0075367_10001521 3300006178 Bacteria 10026
172 Ga0075366_10001960 3300006195 Bacteria 10415
173 Ga0097621_100646082 3300006237 Unclassified 970
174 Ga0075370_10104693 3300006353 Bacteria 1640
175 Ga0068871_100052140 3300006358 Bacteria 3312
176 Ga0075428_100030632 3300006844 Bacteria 5949
177 Ga0075428_100211193 3300006844 Bacteria 2097
178 Ga0075430_100060511 3300006846 Bacteria 3182
179 Ga0075430_100492033 3300006846 Bacteria 1012
180 Ga0075431_100023037 3300006847 Bacteria 6366
181 Ga0075431_100042178 3300006847 Bacteria 4705
182 Ga0075431_100046425 3300006847 Bacteria 4479
183 Ga0075431_100051884 3300006847 Bacteria 4229
184 Ga0075431_100109619 3300006847 Bacteria 2849
185 Ga0075431_100239903 3300006847 Bacteria 1844
186 Ga0075431_101025867 3300006847 Unclassified 791
187 Ga0075431_101139105 3300006847 Bacteria 744
188 Ga0075431_101209273 3300006847 Unclassified 718
189 Ga0075433_10007752 3300006852 Bacteria 8530
190 Ga0075433_10080389 3300006852 Bacteria 2873
191 Ga0075433_10166179 3300006852 Bacteria 1964
192 Ga0075433_10460663 3300006852 Bacteria 1120
193 Ga0075433_10521289 3300006852 Bacteria 1045
194 Ga0075433_10523123 3300006852 Bacteria 1043
195 Ga0075434_100008868 3300006871 Bacteria 9363
196 Ga0075434_100019059 3300006871 Bacteria 6631
197 Ga0075434_100142646 3300006871 Bacteria 2416
198 Ga0075434_100298111 3300006871 Unclassified 1632
199 Ga0075434_101372536 3300006871 Bacteria 717
200 Ga0075429_100036613 3300006880 Bacteria 4268
201 Ga0075429_100054197 3300006880 Bacteria 3489
202 Ga0075429_100092847 3300006880 Bacteria 2632
203 Ga0068865_100080478 3300006881 Bacteria 2336
204 Ga0075436_100000744 3300006914 Bacteria 21597
205 Ga0075436_100045243 3300006914 Bacteria 3035
206 Ga0075436_100259155 3300006914 Bacteria 1240
207 Ga0075436_100312925 3300006914 Bacteria 1127
208 Ga0097620_100013449 3300006931 Bacteria 8206
209 Ga0097620_100043320 3300006931 Bacteria 4523
210 Ga0097620_100124223 3300006931 Bacteria 2649
211 Ga0075435_100000039 3300007076 Bacteria 67464
212 Ga0075435_100011142 3300007076 Bacteria 6595
213 Ga0075435_100049145 3300007076 Bacteria 3391
214 Ga0075435_100125194 3300007076 Bacteria 2147
215 Ga0105240_10772816 3300009093 Unclassified 1043
216 Ga0105240_11344960 3300009093 Bacteria 752
217 Ga0111539_10144660 3300009094 Bacteria 2783
218 Ga0111539_10482517 3300009094 Bacteria 1444
219 Ga0111539_11941803 3300009094 Archaea 682
220 Ga0111539_11958537 3300009094 Unclassified 679
221 Ga0105245_10009869 3300009098 Bacteria 8315
222 Ga0105245_10303010 3300009098 Bacteria 1568
223 Ga0105247_10576653 3300009101 Bacteria 831
224 Ga0114129_10009458 3300009147 Bacteria 13893
225 Ga0114129_10020084 3300009147 Bacteria 9508
226 Ga0114129_10082798 3300009147 Bacteria 4458
227 Ga0114129_10095664 3300009147 Bacteria 4113
228 Ga0114129_10111005 3300009147 Bacteria 3785
229 Ga0114129_10206798 3300009147 Unclassified 2655
230 Ga0114129_10231964 3300009147 Bacteria 2486
231 Ga0114129_10258637 3300009147 Bacteria 2335
232 Ga0114129_10331720 3300009147 Bacteria 2020
233 Ga0114129_10354968 3300009147 Bacteria 1941
234 Ga0114129_10361970 3300009147 Bacteria 1919
235 Ga0114129_10470446 3300009147 Bacteria 1646
236 Ga0114129_10521486 3300009147 Bacteria 1549
237 Ga0114129_10848780 3300009147 Bacteria 1161
238 Ga0114129_10881138 3300009147 Unclassified 1135
239 Ga0114129_12113717 3300009147 Unclassified 679
240 Ga0105243_10233139 3300009148 Bacteria 1634
241 Ga0105243_10961193 3300009148 Bacteria 854
242 Ga0105241_10265813 3300009174 Bacteria 1459
243 Ga0105241_10463123 3300009174 Bacteria 1123
244 Ga0105241_11006640 3300009174 Unclassified 780
245 Ga0105242_10014061 3300009176 Bacteria 6192
246 Ga0105242_10814038 3300009176 Bacteria 926
247 Ga0105242_12074803 3300009176 Bacteria 612
248 Ga0105248_10157609 3300009177 Bacteria 2561
249 Ga0105248_10276527 3300009177 Bacteria 1890
250 Ga0105248_10338952 3300009177 Bacteria 1693
251 Ga0105248_11024908 3300009177 Bacteria 932
252 Ga0105248_12020665 3300009177 Unclassified 655
253 Ga0105237_10013872 3300009545 Bacteria 8432
254 Ga0105237_10308479 3300009545 Bacteria 1585
255 Ga0105237_11294565 3300009545 Bacteria 735
256 Ga0105249_10057277 3300009553 Bacteria 3570
257 Ga0105249_10364331 3300009553 Bacteria 1468
258 Ga0105249_10372343 3300009553 Bacteria 1452
259 Ga0105249_10508413 3300009553 Bacteria 1251
260 Ga0105249_11433104 3300009553 Unclassified 763
261 Ga0105239_10049261 3300010375 Bacteria 4619
262 Ga0105239_10179263 3300010375 Bacteria 2370
263 Ga0105239_10253681 3300010375 Bacteria 1976
264 Ga0105239_11314564 3300010375 Unclassified 834
265 Ga0105246_10327693 3300011119 Bacteria 1247
266 Ga0157369_10919262 3300013105 Bacteria 897
267 Ga0157374_11862816 3300013296 Bacteria 627
268 Ga0157378_10014673 3300013297 Bacteria 6862
269 Ga0157378_10405060 3300013297 Bacteria 1345
270 Ga0157378_10638710 3300013297 Bacteria 1079
271 Ga0163162_10167540 3300013306 Bacteria 2321
272 Ga0163162_11496184 3300013306 Unclassified 769
273 Ga0157372_10140106 3300013307 Bacteria 2786
274 Ga0157372_11468260 3300013307 Bacteria 786
275 Ga0157375_10000175 3300013308 Bacteria 59637
276 Ga0157375_10368649 3300013308 Bacteria 1602
277 Ga0157375_11105341 3300013308 Bacteria 928
278 Ga0157375_12004913 3300013308 Unclassified 688
279 Ga0163163_10006535 3300014325 Bacteria 10208
280 Ga0163163_10100345 3300014325 Bacteria 2917
281 Ga0157380_10018599 3300014326 Bacteria 5160
282 Ga0157380_10204014 3300014326 Bacteria 1756
283 Ga0157380_10665915 3300014326 Unclassified 1041
284 Ga0157377_10270950 3300014745 Bacteria 1109
285 Ga0157379_10422140 3300014968 Bacteria 1228
286 Ga0157376_10876449 3300014969 Bacteria 914
287 Ga0163161_10198804 3300017792 Bacteria 1544
288 Ga0213876_10006420 3300021384 Bacteria 6411
289 Ga0209148_1024874 3300025254 Bacteria 942
290 Ga0209233_1001888 3300025261 Bacteria 8043
291 Ga0209455_1001960 3300025272 Bacteria 8475
292 Ga0209455_1003306 3300025272 Bacteria 5783
293 Ga0209758_1003267 3300025297 Bacteria 15032
294 Ga0207656_10200995 3300025321 Bacteria 962
295 Ga0207642_10058745 3300025899 Bacteria 1776
296 Ga0207645_10058452 3300025907 Bacteria 2462
297 Ga0207645_10190602 3300025907 Bacteria 1347
298 Ga0207645_10471467 3300025907 Bacteria 848
299 Ga0207643_10026989 3300025908 Bacteria 3183
300 Ga0207643_10072345 3300025908 Bacteria 1986
301 Ga0207705_10423129 3300025909 Bacteria 1031
302 Ga0207684_10166243 3300025910 Bacteria 1901
303 Ga0207684_10374487 3300025910 Bacteria 1225
304 Ga0207654_10611857 3300025911 Unclassified 778
305 Ga0207707_10000438 3300025912 Bacteria 43316
306 Ga0207707_10005914 3300025912 Bacteria 10702
307 Ga0207707_10059322 3300025912 Unclassified 3329
308 Ga0207707_10079773 3300025912 Bacteria 2858
309 Ga0207695_10540705 3300025913 Unclassified 1046
310 Ga0207671_10009243 3300025914 Bacteria 8259
311 Ga0207660_10164909 3300025917 Bacteria 1712
312 Ga0207662_10049169 3300025918 Bacteria 2501
313 Ga0207662_10075668 3300025918 Bacteria 2045
314 Ga0207662_10383709 3300025918 Bacteria 950
315 Ga0207657_10173603 3300025919 Bacteria 1745
316 Ga0207657_10260332 3300025919 Bacteria 1381
317 Ga0207649_10246927 3300025920 Bacteria 1284
318 Ga0207652_10009057 3300025921 Bacteria 8017
319 Ga0207652_10015253 3300025921 Bacteria 6236
320 Ga0207652_10154419 3300025921 Bacteria 2056
321 Ga0207646_10048608 3300025922 Bacteria 3802
322 Ga0207646_10867988 3300025922 Bacteria 801
323 Ga0207646_11495729 3300025922 Unclassified 585
324 Ga0207681_10011336 3300025923 Bacteria 5478
325 Ga0207681_10064171 3300025923 Bacteria 2535
326 Ga0207681_10279108 3300025923 Bacteria 1315
327 Ga0207681_10482768 3300025923 Bacteria 1012
328 Ga0207681_10756773 3300025923 Unclassified 810
329 Ga0207694_10202764 3300025924 Bacteria 1614
330 Ga0207659_10022883 3300025926 Bacteria 4167
331 Ga0207659_10278838 3300025926 Bacteria 1366
332 Ga0207659_10670836 3300025926 Unclassified 887
333 Ga0207687_10007379 3300025927 Bacteria 7240
334 Ga0207687_10165427 3300025927 Bacteria 1701
335 Ga0207687_10314354 3300025927 Bacteria 1266
336 Ga0207700_10083790 3300025928 Bacteria 2497
337 Ga0207700_10098615 3300025928 Unclassified 2325
338 Ga0207700_10887375 3300025928 Bacteria 798
339 Ga0207700_11015894 3300025928 Unclassified 742
340 Ga0207644_10178354 3300025931 Bacteria 1663
341 Ga0207644_10205434 3300025931 Bacteria 1555
342 Ga0207690_10531861 3300025932 Bacteria 954
343 Ga0207690_11130975 3300025932 Unclassified 653
344 Ga0207706_10017056 3300025933 Bacteria 6549
345 Ga0207686_10001259 3300025934 Bacteria 14614
346 Ga0207686_10222436 3300025934 Bacteria 1364
347 Ga0207709_10136522 3300025935 Bacteria 1680
348 Ga0207709_10994997 3300025935 Bacteria 685
349 Ga0207670_10048157 3300025936 Bacteria 2842
350 Ga0207670_10272382 3300025936 Bacteria 1316
351 Ga0207670_10336877 3300025936 Bacteria 1191
352 Ga0207670_10408864 3300025936 Bacteria 1086
353 Ga0207670_10522462 3300025936 Bacteria 966
354 Ga0207669_10033988 3300025937 Bacteria 2884
355 Ga0207704_10009379 3300025938 Bacteria 4721
356 Ga0207665_10708140 3300025939 Unclassified 792
357 Ga0207691_10000782 3300025940 Bacteria 31580
358 Ga0207691_10001205 3300025940 Bacteria 25758
359 Ga0207691_10271213 3300025940 Unclassified 1461
360 Ga0207711_10043053 3300025941 Bacteria 3849
361 Ga0207711_10254699 3300025941 Bacteria 1613
362 Ga0207711_10408691 3300025941 Bacteria 1262
363 Ga0207711_10437524 3300025941 Bacteria 1217
364 Ga0207689_10040561 3300025942 Bacteria 3853
365 Ga0207689_10054488 3300025942 Bacteria 3293
366 Ga0207689_10154160 3300025942 Bacteria 1894
367 Ga0207689_10154466 3300025942 Bacteria 1892
368 Ga0207689_10408067 3300025942 Bacteria 1133
369 Ga0207667_10003977 3300025949 Bacteria 18164
370 Ga0207667_10112500 3300025949 Bacteria 2807
371 Ga0207667_10396749 3300025949 Bacteria 1405
372 Ga0207651_10008115 3300025960 Bacteria 5645
373 Ga0207651_10145695 3300025960 Bacteria 1836
374 Ga0207651_10602861 3300025960 Bacteria 960
375 Ga0207651_10958038 3300025960 Bacteria 764
376 Ga0207712_10324160 3300025961 Bacteria 1272
377 Ga0207712_11228960 3300025961 Unclassified 669
378 Ga0207668_10328925 3300025972 Bacteria 1271
379 Ga0207640_10091809 3300025981 Bacteria 2104
380 Ga0207640_10603253 3300025981 Bacteria 930
381 Ga0207677_10067475 3300026023 Bacteria 2506
382 Ga0207677_10654355 3300026023 Unclassified 928
383 Ga0207703_10106677 3300026035 Bacteria 2383
384 Ga0207703_10255358 3300026035 Bacteria 1582
385 Ga0207703_10490385 3300026035 Bacteria 1152
386 Ga0207703_10710177 3300026035 Bacteria 956
387 Ga0207703_10750078 3300026035 Bacteria 930
388 Ga0207639_10047660 3300026041 Bacteria 3240
389 Ga0207678_10571942 3300026067 Bacteria 989
390 Ga0207708_10039626 3300026075 Bacteria 3591
391 Ga0207702_10987983 3300026078 Unclassified 835
392 Ga0207641_10063688 3300026088 Bacteria 3150
393 Ga0207641_10356629 3300026088 Bacteria 1395
394 Ga0207648_10007127 3300026089 Bacteria 11026
395 Ga0207648_10051633 3300026089 Bacteria 3594
396 Ga0207648_10660180 3300026089 Bacteria 967
397 Ga0207648_10954910 3300026089 Bacteria 802
398 Ga0207676_10000023 3300026095 Bacteria 266848
399 Ga0207676_10430365 3300026095 Bacteria 1240
400 Ga0207676_10801051 3300026095 Unclassified 919
401 Ga0207674_10329405 3300026116 Unclassified 1477
402 Ga0207675_100086674 3300026118 Bacteria 2940
403 Ga0207675_100088817 3300026118 Bacteria 2903
404 Ga0207675_100330413 3300026118 Bacteria 1490
405 Ga0207683_10049627 3300026121 Bacteria 3675
406 Ga0207683_10133100 3300026121 Bacteria 2237
407 Ga0207683_10143199 3300026121 Bacteria 2154
408 Ga0207683_10150211 3300026121 Bacteria 2102
409 Ga0207683_10190857 3300026121 Bacteria 1860
410 Ga0207683_10224405 3300026121 Bacteria 1712
411 Ga0207698_10881641 3300026142 Bacteria 901
412 Ga0209995_1002956 3300027471 Bacteria 2695
413 Ga0209970_1001206 3300027614 Bacteria 4549
414 Ga0210002_1004089 3300027617 Bacteria 2165
415 Ga0210002_1007570 3300027617 Bacteria 1648
416 Ga0209983_1001106 3300027665 Bacteria 5951
417 Ga0209983_1015983 3300027665 Bacteria 1548
418 Ga0209971_1007209 3300027682 Bacteria 2637
419 Ga0209966_1006724 3300027695 Bacteria 2001
420 Ga0209998_10005782 3300027717 Bacteria 2576
421 Ga0209998_10006731 3300027717 Bacteria 2387
422 Ga0209813_10037753 3300027866 Bacteria 1457
423 Ga0209974_10000488 3300027876 Bacteria 13238
424 Ga0209974_10002841 3300027876 Bacteria 6287
425 Ga0209974_10010836 3300027876 Bacteria 3071
426 Ga0209974_10017215 3300027876 Unclassified 2397
427 Ga0209974_10060141 3300027876 Bacteria 1285
428 Ga0207428_10000093 3300027907 Bacteria 123740
429 Ga0207428_10007605 3300027907 Bacteria 9871
430 Ga0207428_10320003 3300027907 Bacteria 1146
431 Ga0268266_10353010 3300028379 Bacteria 1382
432 Ga0268265_10018714 3300028380 Bacteria 4803
433 Ga0268265_10529007 3300028380 Bacteria 1116
434 Ga0268265_10591742 3300028380 Bacteria 1059
435 Ga0268264_10069865 3300028381 Bacteria 2971
436 Ga0268264_10294243 3300028381 Bacteria 1526
437 Ga0268264_10313781 3300028381 Bacteria 1480
438 Ga0268264_10359635 3300028381 Bacteria 1388
439 Ga0268264_10797438 3300028381 Unclassified 943
440 Ga0268264_10993949 3300028381 Bacteria 845
441 Ga0265330_10029650 3300031235 Bacteria 2459
442 Ga0265330_10071493 3300031235 Bacteria 1501
443 Ga0265332_10001558 3300031238 Bacteria 12604
444 Ga0265328_10000333 3300031239 Bacteria 22080
445 Ga0265320_10001586 3300031240 Bacteria 16339
446 Ga0265320_10027927 3300031240 Bacteria 2935
447 Ga0265329_10005953 3300031242 Bacteria 4884
448 Ga0265329_10194189 3300031242 Bacteria 667
449 Ga0265339_10030613 3300031249 Bacteria 3047
450 Ga0265331_10000074 3300031250 Bacteria 149282
451 Ga0265316_10000037 3300031344 Bacteria 149295
452 Ga0265316_10014208 3300031344 Bacteria 7022
453 Ga0265316_10194571 3300031344 Bacteria 1505
454 Ga0265316_10252198 3300031344 Bacteria 1295
455 Ga0316575_10064918 3300031665 Bacteria 1462
456 Ga0265314_10001565 3300031711 Bacteria 25163
457 Ga0265342_10002766 3300031712 Bacteria 14871
458 Ga0265342_10357312 3300031712 Bacteria 760
459 Ga0316576_10002618 3300031727 Bacteria 10290
460 Ga0316578_10023989 3300031728 Bacteria 3418
461 Ga0316578_10124624 3300031728 Bacteria 1549
462 Ga0307405_10026116 3300031731 Bacteria 3365
463 Ga0316577_10000887 3300031733 Bacteria 13164
464 Ga0307413_10026603 3300031824 Unclassified 3191
465 Ga0307413_10617554 3300031824 Unclassified 889
466 Ga0307410_10080185 3300031852 Bacteria 2289
467 Ga0307410_10173244 3300031852 Bacteria 1628
468 Ga0307406_10005578 3300031901 Bacteria 6883
469 Ga0307406_10017361 3300031901 Bacteria 4189
470 Ga0307407_10190331 3300031903 Unclassified 1367
471 Ga0307412_11114926 3300031911 Unclassified 703
472 Ga0307409_100002987 3300031995 Bacteria 9017
473 Ga0307409_100659781 3300031995 Bacteria 1041
474 Ga0307416_100038873 3300032002 Bacteria 3676
475 Ga0307414_10008825 3300032004 Bacteria 5751
476 Ga0307411_10002305 3300032005 Bacteria 8372
477 Ga0307415_100023924 3300032126 Bacteria 3803
478 Ga0316580_10043502 3300032139 Bacteria 1386
479 Ga0373938_0110204 3300034957 Bacteria 700
480 Ga0373926_0161968 3300035083 Bacteria 854
481 Ga0373940_0208251 3300035088 Bacteria 645
482 Ga0373944_0265077 3300035089 Unclassified 637
483 Ga0373952_0078100 3300035092 Unclassified 840
484 Ga0373923_0054975 3300035111 Bacteria 1677
485 Ga0373932_0038363 3300035112 Bacteria 1370
486 Ga0373939_0130793 3300035114 Unclassified 896
487 Ga0373941_0175073 3300035115 Bacteria 802
488 Ga0373945_0094019 3300035116 Bacteria 1165
489 Ga0373953_0384424 3300035117 Bacteria 617
490 Ga0373957_0060973 3300035120 Bacteria 1461
491 Ga0373943_0161233 3300035170 Bacteria 1221
492 Ga0373943_0360990 3300035170 Bacteria 834
493 Ga0316574_0151655 3300035398 Bacteria 1493
494 Ga0316574_0417716 3300035398 Bacteria 843
495 Ga0316574_0431643 3300035398 Unclassified 827
496 Ga0373924_0123791 3300035410 Bacteria 1123
497 Ga0373931_0107799 3300035691 Bacteria 1576
498 Ga0373931_0321296 3300035691 Unclassified 961
499 Ga0373935_0046623 3300035692 Bacteria 2738
500 Ga0373935_0063744 3300035692 Bacteria 2363
501 Ga0373935_0297343 3300035692 Bacteria 1140
502 Ga0373927_0003171 3300035695 Bacteria 11865
503 Ga0373933_0209215 3300035724 Bacteria 1249
504 Ga0373947_0000973 3300035725 Bacteria 17491
505 Ga0373947_0623864 3300035725 Bacteria 735
506 Ga0373937_0078446 3300036401 Bacteria 3052
507 Ga0373937_0080782 3300036401 Bacteria 3007
508 Ga0373937_0292221 3300036401 Bacteria 1540
509 Ga0316582_0001612 3300036647 Bacteria 10051
510 Ga0316584_0009459 3300036712 Bacteria 6767
511 Ga0373925_0282461 3300037068 Bacteria 1337
512 Ga0373925_1062826 3300037068 Unclassified 666
513 Ga0395899_0038946 3300037312 Bacteria 3560
514 Ga0395900_0074252 3300037418 Bacteria 3497
515 Ga0395900_0158701 3300037418 Bacteria 2308
516 Ga0395900_0177521 3300037418 Bacteria 2166
517 Ga0395900_0261301 3300037418 Bacteria 1729
518 Ga0395900_0968419 3300037418 Unclassified 772
519 Ga0395898_0613203 3300037466 Bacteria 1031
520 Ga0395898_0724700 3300037466 Unclassified 936
521 Ga0395898_1212946 3300037466 Unclassified 685
522 Ga0395905_0007520 3300037471 Bacteria 10838
523 Ga0395905_0009262 3300037471 Bacteria 9637
524 Ga0395905_0015939 3300037471 Bacteria 7142
525 Ga0395905_0059137 3300037471 Unclassified 3583
526 Ga0395905_0104358 3300037471 Bacteria 2661
527 Ga0395905_0112232 3300037471 Bacteria 2560
528 Ga0395905_0334473 3300037471 Bacteria 1405
529 Ga0395901_0009509 3300038443 Bacteria 9861
530 Ga0395901_0195882 3300038443 Bacteria 2119
531 Ga0242420_067264 3300038996 Bacteria 723
532 Ga0436365_0615089 3300039437 Bacteria 4390
533 Ga0436365_0818175 3300039437 Bacteria 2646
534 Ga0436365_0934652 3300039437 Bacteria 1960
535 Ga0436365_0954239 3300039437 Bacteria 40865
536 Ga0436365_1569769 3300039437 Bacteria 1072
537 Ga0436360_0597770 3300039438 Unclassified 654
538 Ga0436361_0201346 3300039447 Unclassified 874
539 Ga0436362_1167182 3300039453 Bacteria 1107
540 Ga0451793_1169250 3300041452 Bacteria 951
541 Ga0451807_0994039 3300041486 Bacteria 888
542 Ga0451855_0460759 3300041511 Unclassified 650
543 Ga0439451_074319 3300042009 Unclassified 681
544 Ga0451577_0082233 3300042876 Bacteria 2872
545 Ga0451577_1077996 3300042876 Bacteria 719
546 Ga0466972_0307991 3300044658 Bacteria 740
547 Ga0453683_0071402 3300044673 Bacteria 2172
548 Ga0466963_0328845 3300044694 Bacteria 1076
549 Ga0466964_0134967 3300044706 Unclassified 1128
550 Ga0453684_0009810 3300044712 Bacteria 16596
551 Ga0453684_2202211 3300044712 Unclassified 550
552 Ga0466968_0116095 3300044735 Bacteria 1208
553 Ga0466957_0927170 3300044842 Unclassified 623
554 Ga0466957_1032675 3300044842 Bacteria 591
555 Ga0451576_0105542 3300045051 Bacteria 2931
556 Ga0451576_0138123 3300045051 Bacteria 2542
557 Ga0451576_0343995 3300045051 Bacteria 1562
558 Ga0451576_0725542 3300045051 Bacteria 1044
559 Ga0451576_0847711 3300045051 Bacteria 959
560 Ga0451576_1122390 3300045051 Bacteria 822
561 Ga0466958_0254543 3300045836 Bacteria 1124
562 Ga0466967_0108448 3300045976 Bacteria 2548
563 Ga0466967_0398077 3300045976 Bacteria 1339
564 Ga0466967_0803312 3300045976 Bacteria 934
565 Ga0495592_0159924 3300046454 Bacteria 1551
566 Ga0495629_0068748 3300046459 Bacteria 2472
567 Ga0495651_0148839 3300046462 Bacteria 1690
568 Ga0495653_0233320 3300046463 Bacteria 1230
569 Ga0495580_0191758 3300046472 Bacteria 1409
570 Ga0495582_0070319 3300046473 Bacteria 1936
571 Ga0495606_0002102 3300046507 Bacteria 24240
572 Ga0495608_0263764 3300046511 Bacteria 1072
573 Ga0495608_0277901 3300046511 Bacteria 1040
574 Ga0495643_0448580 3300046522 Unclassified 562
575 Ga0495663_0225264 3300046525 Unclassified 660
576 Ga0495652_0415379 3300046529 Bacteria 949
577 Ga0495665_0304284 3300046531 Unclassified 816
578 Ga0495586_0023400 3300046535 Bacteria 3300
579 Ga0495598_0143707 3300046537 Bacteria 827
580 Ga0495645_0001271 3300046543 Bacteria 17186
581 Ga0495667_0143824 3300046559 Bacteria 1536
582 Ga0495656_0014728 3300046615 Bacteria 2938
583 Ga0495635_0222810 3300046663 Bacteria 1275
584 Ga0495657_0434219 3300046675 Bacteria 770
585 Ga0495647_0092968 3300046681 Bacteria 1239
586 Ga0495669_0008594 3300046684 Bacteria 4298
587 Ga0495613_0522298 3300046689 Bacteria 797
588 Ga0495624_0206593 3300046690 Bacteria 1192
589 Ga0495649_0023314 3300046694 Bacteria 3459
590 Ga0495600_0148197 3300046809 Bacteria 1520
591 Ga0495636_0303600 3300047318 Unclassified 747
592 Ga0495674_0040648 3300047319 Bacteria 4158
593 Ga0495674_0126183 3300047319 Bacteria 2159
594 Ga0495674_0798867 3300047319 Bacteria 734
595 Ga0495684_0721985 3300047471 Bacteria 658
596 Ga0495686_0352364 3300047472 Bacteria 800
597 Ga0495602_0147917 3300048088 Bacteria 1850
598 Ga0496102_0472436 3300048905 Bacteria 1175
599 Ga0496102_0504036 3300048905 Bacteria 1133
600 Ga0496102_0629095 3300048905 Bacteria 996
601 Ga0496103_0181434 3300048906 Bacteria 1353
602 Ga0496104_0267144 3300048907 Bacteria 1623
603 Ga0496104_0327081 3300048907 Unclassified 1446
604 Ga0496104_0455432 3300048907 Bacteria 1191
605 Ga0496106_0100219 3300048909 Bacteria 2246
606 Ga0496106_0239327 3300048909 Bacteria 1450
607 Ga0496107_0202885 3300048910 Bacteria 1474
608 Ga0496109_0001048 3300048912 Bacteria 22875
609 Ga0496109_0064971 3300048912 Bacteria 3340
610 Ga0496109_0342067 3300048912 Bacteria 1413
611 Ga0496109_0633663 3300048912 Bacteria 1006
612 Ga0496110_0134059 3300048913 Bacteria 2238
613 Ga0496112_0024395 3300048915 Bacteria 5789
614 Ga0496112_0165543 3300048915 Bacteria 2177
615 Ga0496112_0333462 3300048915 Bacteria 1461
616 Ga0496113_0050267 3300048916 Bacteria 3108
617 Ga0496113_0672007 3300048916 Bacteria 828
618 Ga0496114_0053533 3300048917 Bacteria 3364
619 Ga0496126_0221330 3300048929 Bacteria 1590
620 Ga0501296_012254 3300049519 Bacteria 1033
621 Ga0501031_0003951 3300049568 Bacteria 9549
622 Ga0501031_0322929 3300049568 Bacteria 1000
623 Ga0501032_0000055 3300049569 Bacteria 99207
624 Ga0501032_0250613 3300049569 Bacteria 1149
625 Ga0501032_0323217 3300049569 Bacteria 995
626 Ga0501033_0000163 3300049570 Bacteria 63913
627 Ga0501033_0004474 3300049570 Bacteria 11180
628 Ga0501033_0030963 3300049570 Bacteria 4021
629 Ga0501033_0087939 3300049570 Bacteria 2273
630 Ga0501033_0093781 3300049570 Bacteria 2195
631 Ga0501033_0382609 3300049570 Bacteria 983
632 Ga0501034_0001317 3300049571 Bacteria 33620
633 Ga0501034_0027468 3300049571 Bacteria 5789
634 Ga0501034_0057608 3300049571 Bacteria 3906
635 Ga0501034_0500188 3300049571 Bacteria 1129
636 Ga0501034_1305428 3300049571 Unclassified 602
637 Ga0501036_0000021 3300049572 Bacteria 114136
638 Ga0501036_0060170 3300049572 Bacteria 3217
639 Ga0501036_0442000 3300049572 Bacteria 1084
640 Ga0501036_0781683 3300049572 Unclassified 787
641 Ga0501037_0000314 3300049573 Bacteria 41093
642 Ga0501037_0032065 3300049573 Bacteria 3879
643 Ga0501037_0132679 3300049573 Bacteria 1785
644 Ga0501038_0000070 3300049574 Bacteria 84371
645 Ga0501038_0019324 3300049574 Bacteria 6145
646 Ga0501038_0084270 3300049574 Bacteria 2674
647 Ga0501038_0219673 3300049574 Bacteria 1517
648 Ga0501039_0000213 3300049575 Bacteria 42565
649 Ga0501039_0140107 3300049575 Bacteria 1900
650 Ga0501039_0343949 3300049575 Bacteria 1172
651 Ga0501039_0508366 3300049575 Bacteria 946
652 Ga0501039_0598376 3300049575 Bacteria 864
653 Ga0501040_0218298 3300049576 Unclassified 1356
654 Ga0501040_0437412 3300049576 Unclassified 941
655 Ga0501041_0019385 3300049577 Bacteria 4062
656 Ga0501042_0339622 3300049578 Bacteria 1086
657 Ga0501042_0739763 3300049578 Unclassified 715
658 Ga0501043_0000297 3300049579 Bacteria 44905
659 Ga0501043_0076647 3300049579 Bacteria 2627
660 Ga0501043_0245314 3300049579 Unclassified 1381
661 Ga0501043_0262793 3300049579 Bacteria 1327
662 Ga0501043_0651635 3300049579 Bacteria 773
663 Ga0501043_0935823 3300049579 Unclassified 620
664 Ga0501046_0001881 3300049580 Bacteria 19962
665 Ga0501046_0042476 3300049580 Bacteria 3625
666 Ga0501046_0527326 3300049580 Bacteria 844
667 Ga0501046_0888562 3300049580 Bacteria 622
668 Ga0501047_0000232 3300049581 Bacteria 66245
669 Ga0501047_0078166 3300049581 Bacteria 3182
670 Ga0501047_0445204 3300049581 Bacteria 1125
671 Ga0501048_0001340 3300049582 Bacteria 18669
672 Ga0501048_0198309 3300049582 Bacteria 1423
673 Ga0501048_0622691 3300049582 Unclassified 775
674 Ga0501067_0000177 3300049583 Bacteria 35936
675 Ga0501068_0000469 3300049584 Bacteria 20373
676 Ga0501069_0023848 3300049585 Bacteria 3335
677 Ga0501070_0005350 3300049586 Bacteria 10950
678 Ga0501070_0085898 3300049586 Bacteria 2605
679 Ga0501070_0205541 3300049586 Bacteria 1617
680 Ga0501070_0404273 3300049586 Bacteria 1104
681 Ga0501071_0107329 3300049587 Bacteria 2062
682 Ga0501071_0655139 3300049587 Bacteria 808
683 Ga0501071_0659454 3300049587 Unclassified 805
684 Ga0501072_0001306 3300049588 Bacteria 18665
685 Ga0501073_0001892 3300049589 Bacteria 15598
686 Ga0501074_0000019 3300049590 Bacteria 72385
687 Ga0501074_0316946 3300049590 Bacteria 1108
688 Ga0501074_0584248 3300049590 Bacteria 790
689 Ga0501074_0769516 3300049590 Bacteria 679
690 Ga0501075_0278200 3300049591 Bacteria 1275
691 Ga0501075_0415481 3300049591 Unclassified 1026
692 Ga0501075_0835130 3300049591 Bacteria 701
693 Ga0501076_0111501 3300049592 Unclassified 2211
694 Ga0501077_0079268 3300049593 Unclassified 2081
695 Ga0501077_0237321 3300049593 Bacteria 1159
696 Ga0501236_022072 3300049670 Bacteria 949
697 Ga0501079_0011682 3300049741 Bacteria 6708
698 Ga0501079_0131123 3300049741 Bacteria 1951
699 Ga0501079_0132875 3300049741 Bacteria 1937
700 Ga0501079_0280750 3300049741 Bacteria 1302
701 Ga0501079_0674374 3300049741 Bacteria 814
702 Ga0501080_0007211 3300049742 Bacteria 10036
703 Ga0501081_0162190 3300049743 Bacteria 1611
704 Ga0501081_0181596 3300049743 Bacteria 1522
705 Ga0501081_0318860 3300049743 Bacteria 1142
706 Ga0501081_0624129 3300049743 Bacteria 807
707 Ga0501083_0000300 3300049744 Bacteria 31205
708 Ga0501273_014237 3300049770 Unclassified 1022
709 Ga0501035_0000120 3300049822 Bacteria 94532
710 Ga0501035_0035233 3300049822 Bacteria 4542
711 Ga0501035_0040809 3300049822 Bacteria 4192
712 Ga0501035_0091749 3300049822 Bacteria 2673
713 Ga0501035_0406389 3300049822 Bacteria 1132
714 Ga0501044_0000179 3300049823 Bacteria 78633
715 Ga0501044_0005204 3300049823 Bacteria 14479
716 Ga0501044_0018980 3300049823 Bacteria 7362
717 Ga0501044_0045493 3300049823 Bacteria 4546
718 Ga0501044_0201207 3300049823 Bacteria 1950
719 Ga0501045_0010817 3300049824 Bacteria 6396
720 Ga0501045_0185857 3300049824 Unclassified 1548
721 Ga0501045_0396409 3300049824 Bacteria 1027
722 Ga0501045_0738430 3300049824 Bacteria 726
723 nmdc:mga00v17_59907_c1 3300050491 Unclassified 2337
724 nmdc:mga0k408_77900_c1 3300050493 Bacteria 1938
725 nmdc:mga06z11_872765_c1 3300050494 Bacteria 548
726 nmdc:mga05p37_1165785_c1 3300050507 Unclassified 800
727 nmdc:mga05p37_1245751_c1 3300050507 Unclassified 764
728 nmdc:mga05p37_130479_c1 3300050507 Bacteria 3083
729 nmdc:mga05p37_1404408_c1 3300050507 Unclassified 703
730 nmdc:mga05p37_172200_c1 3300050507 Bacteria 2640
731 nmdc:mga05p37_209654_c1 3300050507 Bacteria 2356
732 nmdc:mga05p37_212348_c1 3300050507 Bacteria 2339
733 nmdc:mga05p37_2525_c2 3300050507 Bacteria 14455
734 nmdc:mga05p37_256_c1 3300050507 Bacteria 54932
735 nmdc:mga05p37_322786_c1 3300050507 Bacteria 1827
736 nmdc:mga05p37_330564_c1 3300050507 Bacteria 1801
737 nmdc:mga05p37_333870_c1 3300050507 Bacteria 1789
738 nmdc:mga05p37_342697_c1 3300050507 Bacteria 1762
739 nmdc:mga05p37_365292_c1 3300050507 Bacteria 1696
740 nmdc:mga05p37_573311_c1 3300050507 Bacteria 1280
741 nmdc:mga05p37_809652_c1 3300050507 Bacteria 1023
742 nmdc:mga05p37_833_c1 3300050507 Bacteria 34555
743 nmdc:mga09592_193303_c1 3300050508 Bacteria 1761
744 nmdc:mga09592_236786_c1 3300050508 Bacteria 1582
745 nmdc:mga09592_257657_c1 3300050508 Bacteria 1512
746 nmdc:mga0qj67_105371_c1 3300050509 Bacteria 2275
747 nmdc:mga0qj67_352065_c1 3300050509 Bacteria 1190
748 nmdc:mga0qj67_515206_c1 3300050509 Unclassified 961
749 nmdc:mga0qj67_65793_c1 3300050509 Bacteria 2886
750 nmdc:mga0qj67_8851_c1 3300050509 Bacteria 7470
751 nmdc:mga06r32_132120_c1 3300050510 Bacteria 2469
752 nmdc:mga06r32_155563_c1 3300050510 Bacteria 2267
753 nmdc:mga06r32_177001_c1 3300050510 Bacteria 2118
754 nmdc:mga06r32_1930_c1 3300050510 Bacteria 18482
755 nmdc:mga06r32_20633_c1 3300050510 Bacteria 6069
756 nmdc:mga06r32_284865_c1 3300050510 Bacteria 1639
757 nmdc:mga06r32_313963_c1 3300050510 Bacteria 1553
758 nmdc:mga06r32_325733_c1 3300050510 Unclassified 1522
759 nmdc:mga06r32_34626_c1 3300050510 Bacteria 4763
760 nmdc:mga06r32_592594_c1 3300050510 Bacteria 1080
761 nmdc:mga06r32_75885_c1 3300050510 Bacteria 3264
762 nmdc:mga08y16_104935_c1 3300050511 Bacteria 2942
763 nmdc:mga08y16_1355784_c1 3300050511 Unclassified 676
764 nmdc:mga08y16_1870679_c1 3300050511 Unclassified 552
765 nmdc:mga08y16_58130_c1 3300050511 Bacteria 4041
766 nmdc:mga0n895_146735_c1 3300050512 Bacteria 2389
767 nmdc:mga0n895_178964_c1 3300050512 Bacteria 2152
768 nmdc:mga0n895_335161_c1 3300050512 Unclassified 1533
769 nmdc:mga0n895_385193_c1 3300050512 Bacteria 1418
770 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
771 nmdc:mga0rr50_39173_c1 3300050513 Bacteria 3436
772 nmdc:mga0rr50_53461_c1 3300050513 Bacteria 3005
773 nmdc:mga0rr50_808858_c1 3300050513 Bacteria 800
774 nmdc:mga0rr50_885_c1 3300050513 Bacteria 16201
775 nmdc:mga08x19_115427_c1 3300050514 Bacteria 1795
776 nmdc:mga08x19_405430_c1 3300050514 Bacteria 957
777 nmdc:mga08x19_51340_c1 3300050514 Bacteria 2649
778 nmdc:mga08x19_695_c1 3300050514 Bacteria 21618
779 nmdc:mga08x19_797896_c1 3300050514 Bacteria 671
780 nmdc:mga0a205_11815_c1 3300050515 Bacteria 8058
781 nmdc:mga0a205_262944_c1 3300050515 Bacteria 1106
782 nmdc:mga0a205_29268_c2 3300050515 Bacteria 4917
783 nmdc:mga0a205_65094_c1 3300050515 Bacteria 3521
784 nmdc:mga0a205_66748_c1 3300050515 Bacteria 3476
785 nmdc:mga0a205_73042_c1 3300050515 Bacteria 3315
786 nmdc:mga0a205_84127_c1 3300050515 Bacteria 3073
787 Ga0495595_0020227 3300053084 Bacteria 2896
788 Ga0495619_0131174 3300053085 Bacteria 1722
789 Ga0501084_0001025 3300054114 Bacteria 21662
790 Ga0501084_0351645 3300054114 Bacteria 1245
791 Ga0590077_016210 3300059426 Bacteria 1562
792 Ga0587083_0007500 3300059505 Bacteria 1673
793 Ga0587109_025901 3300059624 Bacteria 1081
794 Ga0501082_0002527 3300060353 Bacteria 16018
795 Ga0501082_0088535 3300060353 Bacteria 2672
796 Ga0501082_0318148 3300060353 Bacteria 1356
797 Ga0501082_0334269 3300060353 Bacteria 1320
798 Ga0501082_0672254 3300060353 Bacteria 906
799 Ga0530510_0022705 3300061734 Bacteria 4470
800 Ga0530510_0417265 3300061734 Unclassified 1013
801 2932800241 2932794094 Bacteria 7915132
802 Ga0070675_100177360
803 JGI25165J46597_1018651
804 rootH2_10035698
805 rootH2_10083533
806 rootL2_10141580
807 rootH1_10151438
808 Ga0065712_10102327
809 Ga0065715_10492090
810 Ga0070658_10711045
811 Ga0070676_10188013
812 Ga0070690_100494987
813 Ga0068869_100065280
814 Ga0068869_100122722
815 Ga0070680_100054088
816 Ga0070680_100086467
817 Ga0070682_100121874
818 Ga0068868_100258221
819 Ga0070660_100756065
820 Ga0070689_100028698
821 Ga0070689_100098189
822 Ga0070689_100247514
823 Ga0070689_100310444
824 Ga0070689_100411475
825 Ga0070689_101211979
826 Ga0070689_101324156
827 Ga0070687_100002848
828 Ga0070687_100102823
829 Ga0070661_100035788
830 Ga0070692_10014354
831 Ga0070692_10106336
832 Ga0070692_10189571
833 Ga0070668_100139938
834 Ga0070668_100331963
835 Ga0070669_100005918
836 Ga0070669_100052456
837 Ga0070669_100062077
838 Ga0070669_100984427
839 Ga0070675_100018637
840 Ga0070671_100123562
841 Ga0070671_100472548
842 Ga0070671_101219441
843 Ga0070674_100031475
844 Ga0070674_100062837
845 Ga0070673_100105727
846 Ga0070673_100203567
847 Ga0070688_101083381
848 Ga0070659_100839695
849 Ga0070667_100978557
850 Ga0070709_10727361
851 Ga0070713_100026778
852 Ga0070713_100225882
853 Ga0070713_100273412
854 Ga0070713_101317428
855 Ga0070701_10091831
856 Ga0070705_100000590
857 Ga0070705_100998485
858 Ga0070694_100062749
859 Ga0070708_100068778
860 Ga0070708_100176329
861 Ga0070708_100619722
862 Ga0070663_100641806
863 Ga0070678_100019827
864 Ga0070678_100214489
865 Ga0070678_100966101
866 Ga0070678_101056167
867 Ga0070662_100210454
868 Ga0070662_100802672
869 Ga0070681_10000234
870 Ga0070681_10007335
871 Ga0068867_100011643
872 Ga0068867_100142107
873 Ga0068867_100397836
874 Ga0068867_100639611
875 Ga0068867_100677063
876 Ga0070685_10005996
877 Ga0070685_10290502
878 Ga0070706_100057339
879 Ga0070706_100092325
880 Ga0070707_100052632
881 Ga0070698_100110887
882 Ga0070698_100206106
883 Ga0070698_100281455
884 Ga0070698_100689694
885 Ga0070698_100999187
886 Ga0070699_100000090
887 Ga0070699_100260195
888 Ga0070679_100003892
889 Ga0070679_100018627
890 Ga0070679_100270581
891 Ga0070679_100664968
892 Ga0070697_100026869
893 Ga0070697_100112055
894 Ga0068853_100077331
895 Ga0070672_100000377
896 Ga0070672_100284698
897 Ga0070672_100594393
898 Ga0070672_100828627
899 Ga0070686_100282532
900 Ga0070686_100392254
901 Ga0070686_100959409
902 Ga0070695_100016533
903 Ga0070695_100016629
904 Ga0070695_100112305
905 Ga0070695_100231682
906 Ga0070695_100244966
907 Ga0070695_100304315
908 Ga0070696_100000001
909 Ga0070696_100029173
910 Ga0070693_100000924
911 Ga0070665_100008057
912 Ga0070665_100430038
913 Ga0070665_101118879
914 Ga0070704_100040822
915 Ga0070704_100040843
916 Ga0070704_100054137
917 Ga0070704_100056130
918 Ga0070704_100078195
919 Ga0070704_100150598
920 Ga0070704_100169012
921 Ga0070704_100341734
922 Ga0068855_100204804
923 Ga0068855_100249663
924 Ga0068857_100171571
925 Ga0068857_100185608
926 Ga0068857_100193022
927 Ga0068857_100525487
928 Ga0068854_100249861
929 Ga0068854_100357742
930 Ga0068856_100877449
931 Ga0070702_100143049
932 Ga0070702_100691831
933 Ga0070702_100938733
934 Ga0068859_100013449
935 Ga0068859_100043319
936 Ga0068859_100124219
937 Ga0068864_100000103
938 Ga0068864_101146196
939 Ga0068866_10056253
940 Ga0068861_100062134
941 Ga0068861_100170398
942 Ga0068861_100325367
943 Ga0068861_101345694
944 Ga0068851_10086236
945 Ga0068870_10006617
946 Ga0068870_10075426
947 Ga0068863_100589186
948 Ga0068858_100036330
949 Ga0068858_100095035
950 Ga0068858_100511325
951 Ga0068858_100749311
952 Ga0068860_100096604
953 Ga0068860_100387126
954 Ga0068860_100428067
955 Ga0068860_101612464
956 Ga0068862_100051486
957 Ga0068862_100072619
958 Ga0068862_100243823
959 Ga0068862_100844130
960 Ga0081455_10000777
961 Ga0081455_10145792
962 Ga0081538_10003485
963 Ga0081538_10006428
964 Ga0081538_10083312
965 Ga0081539_10011114
966 Ga0070717_10150090
967 Ga0070717_10264646
968 Ga0070717_11026584
969 Ga0075363_100052165
970 Ga0075432_10051380
971 Ga0070716_100216370
972 Ga0075367_10001521
973 Ga0075366_10001960
974 Ga0097621_100646082
975 Ga0075370_10104693
976 Ga0068871_100052140
977 Ga0075428_100030632
978 Ga0075428_100211193
979 Ga0075430_100060511
980 Ga0075430_100492033
981 Ga0075431_100023037
982 Ga0075431_100042178
983 Ga0075431_100046425
984 Ga0075431_100051884
985 Ga0075431_100109619
986 Ga0075431_100239903
987 Ga0075431_101025867
988 Ga0075431_101139105
989 Ga0075431_101209273
990 Ga0075433_10007752
991 Ga0075433_10080389
992 Ga0075433_10166179
993 Ga0075433_10460663
994 Ga0075433_10521289
995 Ga0075433_10523123
996 Ga0075434_100008868
997 Ga0075434_100019059
998 Ga0075434_100142646
999 Ga0075434_100298111
1000 Ga0075434_101372536
1001 Ga0075429_100036613
1002 Ga0075429_100054197
1003 Ga0075429_100092847
1004 Ga0068865_100080478
1005 Ga0075436_100000744
1006 Ga0075436_100045243
1007 Ga0075436_100259155
1008 Ga0075436_100312925
1009 Ga0097620_100013449
1010 Ga0097620_100043320
1011 Ga0097620_100124223
1012 Ga0075435_100000039
1013 Ga0075435_100011142
1014 Ga0075435_100049145
1015 Ga0075435_100125194
1016 Ga0105240_10772816
1017 Ga0105240_11344960
1018 Ga0111539_10144660
1019 Ga0111539_10482517
1020 Ga0111539_11941803
1021 Ga0111539_11958537
1022 Ga0105245_10009869
1023 Ga0105245_10303010
1024 Ga0105247_10576653
1025 Ga0114129_10009458
1026 Ga0114129_10020084
1027 Ga0114129_10082798
1028 Ga0114129_10095664
1029 Ga0114129_10111005
1030 Ga0114129_10206798
1031 Ga0114129_10231964
1032 Ga0114129_10258637
1033 Ga0114129_10331720
1034 Ga0114129_10354968
1035 Ga0114129_10361970
1036 Ga0114129_10470446
1037 Ga0114129_10521486
1038 Ga0114129_10848780
1039 Ga0114129_10881138
1040 Ga0114129_12113717
1041 Ga0105243_10233139
1042 Ga0105243_10961193
1043 Ga0105241_10265813
1044 Ga0105241_10463123
1045 Ga0105241_11006640
1046 Ga0105242_10014061
1047 Ga0105242_10814038
1048 Ga0105242_12074803
1049 Ga0105248_10157609
1050 Ga0105248_10276527
1051 Ga0105248_10338952
1052 Ga0105248_11024908
1053 Ga0105248_12020665
1054 Ga0105237_10013872
1055 Ga0105237_10308479
1056 Ga0105237_11294565
1057 Ga0105249_10057277
1058 Ga0105249_10364331
1059 Ga0105249_10372343
1060 Ga0105249_10508413
1061 Ga0105249_11433104
1062 Ga0105239_10049261
1063 Ga0105239_10179263
1064 Ga0105239_10253681
1065 Ga0105239_11314564
1066 Ga0105246_10327693
1067 Ga0157369_10919262
1068 Ga0157374_11862816
1069 Ga0157378_10014673
1070 Ga0157378_10405060
1071 Ga0157378_10638710
1072 Ga0163162_10167540
1073 Ga0163162_11496184
1074 Ga0157372_10140106
1075 Ga0157372_11468260
1076 Ga0157375_10000175
1077 Ga0157375_10368649
1078 Ga0157375_11105341
1079 Ga0157375_12004913
1080 Ga0163163_10006535
1081 Ga0163163_10100345
1082 Ga0157380_10018599
1083 Ga0157380_10204014
1084 Ga0157380_10665915
1085 Ga0157377_10270950
1086 Ga0157379_10422140
1087 Ga0157376_10876449
1088 Ga0163161_10198804
1089 Ga0213876_10006420
1090 Ga0209148_1024874
1091 Ga0209233_1001888
1092 Ga0209455_1001960
1093 Ga0209455_1003306
1094 Ga0209758_1003267
1095 Ga0207656_10200995
1096 Ga0207642_10058745
1097 Ga0207645_10058452
1098 Ga0207645_10190602
1099 Ga0207645_10471467
1100 Ga0207643_10026989
1101 Ga0207643_10072345
1102 Ga0207705_10423129
1103 Ga0207684_10166243
1104 Ga0207684_10374487
1105 Ga0207654_10611857
1106 Ga0207707_10000438
1107 Ga0207707_10005914
1108 Ga0207707_10059322
1109 Ga0207707_10079773
1110 Ga0207695_10540705
1111 Ga0207671_10009243
1112 Ga0207660_10164909
1113 Ga0207662_10049169
1114 Ga0207662_10075668
1115 Ga0207662_10383709
1116 Ga0207657_10173603
1117 Ga0207657_10260332
1118 Ga0207649_10246927
1119 Ga0207652_10009057
1120 Ga0207652_10015253
1121 Ga0207652_10154419
1122 Ga0207646_10048608
1123 Ga0207646_10867988
1124 Ga0207646_11495729
1125 Ga0207681_10011336
1126 Ga0207681_10064171
1127 Ga0207681_10279108
1128 Ga0207681_10482768
1129 Ga0207681_10756773
1130 Ga0207694_10202764
1131 Ga0207659_10022883
1132 Ga0207659_10278838
1133 Ga0207659_10670836
1134 Ga0207687_10007379
1135 Ga0207687_10165427
1136 Ga0207687_10314354
1137 Ga0207700_10083790
1138 Ga0207700_10098615
1139 Ga0207700_10887375
1140 Ga0207700_11015894
1141 Ga0207644_10178354
1142 Ga0207644_10205434
1143 Ga0207690_10531861
1144 Ga0207690_11130975
1145 Ga0207706_10017056
1146 Ga0207686_10001259
1147 Ga0207686_10222436
1148 Ga0207709_10136522
1149 Ga0207709_10994997
1150 Ga0207670_10048157
1151 Ga0207670_10272382
1152 Ga0207670_10336877
1153 Ga0207670_10408864
1154 Ga0207670_10522462
1155 Ga0207669_10033988
1156 Ga0207704_10009379
1157 Ga0207665_10708140
1158 Ga0207691_10000782
1159 Ga0207691_10001205
1160 Ga0207691_10271213
1161 Ga0207711_10043053
1162 Ga0207711_10254699
1163 Ga0207711_10408691
1164 Ga0207711_10437524
1165 Ga0207689_10040561
1166 Ga0207689_10054488
1167 Ga0207689_10154160
1168 Ga0207689_10154466
1169 Ga0207689_10408067
1170 Ga0207667_10003977
1171 Ga0207667_10112500
1172 Ga0207667_10396749
1173 Ga0207651_10008115
1174 Ga0207651_10145695
1175 Ga0207651_10602861
1176 Ga0207651_10958038
1177 Ga0207712_10324160
1178 Ga0207712_11228960
1179 Ga0207668_10328925
1180 Ga0207640_10091809
1181 Ga0207640_10603253
1182 Ga0207677_10067475
1183 Ga0207677_10654355
1184 Ga0207703_10106677
1185 Ga0207703_10255358
1186 Ga0207703_10490385
1187 Ga0207703_10710177
1188 Ga0207703_10750078
1189 Ga0207639_10047660
1190 Ga0207678_10571942
1191 Ga0207708_10039626
1192 Ga0207702_10987983
1193 Ga0207641_10063688
1194 Ga0207641_10356629
1195 Ga0207648_10007127
1196 Ga0207648_10051633
1197 Ga0207648_10660180
1198 Ga0207648_10954910
1199 Ga0207676_10000023
1200 Ga0207676_10430365
1201 Ga0207676_10801051
1202 Ga0207674_10329405
1203 Ga0207675_100086674
1204 Ga0207675_100088817
1205 Ga0207675_100330413
1206 Ga0207683_10049627
1207 Ga0207683_10133100
1208 Ga0207683_10143199
1209 Ga0207683_10150211
1210 Ga0207683_10190857
1211 Ga0207683_10224405
1212 Ga0207698_10881641
1213 Ga0209995_1002956
1214 Ga0209970_1001206
1215 Ga0210002_1004089
1216 Ga0210002_1007570
1217 Ga0209983_1001106
1218 Ga0209983_1015983
1219 Ga0209971_1007209
1220 Ga0209966_1006724
1221 Ga0209998_10005782
1222 Ga0209998_10006731
1223 Ga0209813_10037753
1224 Ga0209974_10000488
1225 Ga0209974_10002841
1226 Ga0209974_10010836
1227 Ga0209974_10017215
1228 Ga0209974_10060141
1229 Ga0207428_10000093
1230 Ga0207428_10007605
1231 Ga0207428_10320003
1232 Ga0268266_10353010
1233 Ga0268265_10018714
1234 Ga0268265_10529007
1235 Ga0268265_10591742
1236 Ga0268264_10069865
1237 Ga0268264_10294243
1238 Ga0268264_10313781
1239 Ga0268264_10359635
1240 Ga0268264_10797438
1241 Ga0268264_10993949
1242 Ga0265330_10029650
1243 Ga0265330_10071493
1244 Ga0265332_10001558
1245 Ga0265328_10000333
1246 Ga0265320_10001586
1247 Ga0265320_10027927
1248 Ga0265329_10005953
1249 Ga0265329_10194189
1250 Ga0265339_10030613
1251 Ga0265331_10000074
1252 Ga0265316_10000037
1253 Ga0265316_10014208
1254 Ga0265316_10194571
1255 Ga0265316_10252198
1256 Ga0316575_10064918
1257 Ga0265314_10001565
1258 Ga0265342_10002766
1259 Ga0265342_10357312
1260 Ga0316576_10002618
1261 Ga0316578_10023989
1262 Ga0316578_10124624
1263 Ga0307405_10026116
1264 Ga0316577_10000887
1265 Ga0307413_10026603
1266 Ga0307413_10617554
1267 Ga0307410_10080185
1268 Ga0307410_10173244
1269 Ga0307406_10005578
1270 Ga0307406_10017361
1271 Ga0307407_10190331
1272 Ga0307412_11114926
1273 Ga0307409_100002987
1274 Ga0307409_100659781
1275 Ga0307416_100038873
1276 Ga0307414_10008825
1277 Ga0307411_10002305
1278 Ga0307415_100023924
1279 Ga0316580_10043502
1280 Ga0373938_0110204
1281 Ga0373926_0161968
1282 Ga0373940_0208251
1283 Ga0373944_0265077
1284 Ga0373952_0078100
1285 Ga0373923_0054975
1286 Ga0373932_0038363
1287 Ga0373939_0130793
1288 Ga0373941_0175073
1289 Ga0373945_0094019
1290 Ga0373953_0384424
1291 Ga0373957_0060973
1292 Ga0373943_0161233
1293 Ga0373943_0360990
1294 Ga0316574_0151655
1295 Ga0316574_0417716
1296 Ga0316574_0431643
1297 Ga0373924_0123791
1298 Ga0373931_0107799
1299 Ga0373931_0321296
1300 Ga0373935_0046623
1301 Ga0373935_0063744
1302 Ga0373935_0297343
1303 Ga0373927_0003171
1304 Ga0373933_0209215
1305 Ga0373947_0000973
1306 Ga0373947_0623864
1307 Ga0373937_0078446
1308 Ga0373937_0080782
1309 Ga0373937_0292221
1310 Ga0316582_0001612
1311 Ga0316584_0009459
1312 Ga0373925_0282461
1313 Ga0373925_1062826
1314 Ga0395899_0038946
1315 Ga0395900_0074252
1316 Ga0395900_0158701
1317 Ga0395900_0177521
1318 Ga0395900_0261301
1319 Ga0395900_0968419
1320 Ga0395898_0613203
1321 Ga0395898_0724700
1322 Ga0395898_1212946
1323 Ga0395905_0007520
1324 Ga0395905_0009262
1325 Ga0395905_0015939
1326 Ga0395905_0059137
1327 Ga0395905_0104358
1328 Ga0395905_0112232
1329 Ga0395905_0334473
1330 Ga0395901_0009509
1331 Ga0395901_0195882
1332 Ga0242420_067264
1333 Ga0436365_0615089
1334 Ga0436365_0818175
1335 Ga0436365_0934652
1336 Ga0436365_0954239
1337 Ga0436365_1569769
1338 Ga0436360_0597770
1339 Ga0436361_0201346
1340 Ga0436362_1167182
1341 Ga0451793_1169250
1342 Ga0451807_0994039
1343 Ga0451855_0460759
1344 Ga0439451_074319
1345 Ga0451577_0082233
1346 Ga0451577_1077996
1347 Ga0466972_0307991
1348 Ga0453683_0071402
1349 Ga0466963_0328845
1350 Ga0466964_0134967
1351 Ga0453684_0009810
1352 Ga0453684_2202211
1353 Ga0466968_0116095
1354 Ga0466957_0927170
1355 Ga0466957_1032675
1356 Ga0451576_0105542
1357 Ga0451576_0138123
1358 Ga0451576_0343995
1359 Ga0451576_0725542
1360 Ga0451576_0847711
1361 Ga0451576_1122390
1362 Ga0466958_0254543
1363 Ga0466967_0108448
1364 Ga0466967_0398077
1365 Ga0466967_0803312
1366 Ga0495592_0159924
1367 Ga0495629_0068748
1368 Ga0495651_0148839
1369 Ga0495653_0233320
1370 Ga0495580_0191758
1371 Ga0495582_0070319
1372 Ga0495606_0002102
1373 Ga0495608_0263764
1374 Ga0495608_0277901
1375 Ga0495643_0448580
1376 Ga0495663_0225264
1377 Ga0495652_0415379
1378 Ga0495665_0304284
1379 Ga0495586_0023400
1380 Ga0495598_0143707
1381 Ga0495645_0001271
1382 Ga0495667_0143824
1383 Ga0495656_0014728
1384 Ga0495635_0222810
1385 Ga0495657_0434219
1386 Ga0495647_0092968
1387 Ga0495669_0008594
1388 Ga0495613_0522298
1389 Ga0495624_0206593
1390 Ga0495649_0023314
1391 Ga0495600_0148197
1392 Ga0495636_0303600
1393 Ga0495674_0040648
1394 Ga0495674_0126183
1395 Ga0495674_0798867
1396 Ga0495684_0721985
1397 Ga0495686_0352364
1398 Ga0495602_0147917
1399 Ga0496102_0472436
1400 Ga0496102_0504036
1401 Ga0496102_0629095
1402 Ga0496103_0181434
1403 Ga0496104_0267144
1404 Ga0496104_0327081
1405 Ga0496104_0455432
1406 Ga0496106_0100219
1407 Ga0496106_0239327
1408 Ga0496107_0202885
1409 Ga0496109_0001048
1410 Ga0496109_0064971
1411 Ga0496109_0342067
1412 Ga0496109_0633663
1413 Ga0496110_0134059
1414 Ga0496112_0024395
1415 Ga0496112_0165543
1416 Ga0496112_0333462
1417 Ga0496113_0050267
1418 Ga0496113_0672007
1419 Ga0496114_0053533
1420 Ga0496126_0221330
1421 Ga0501296_012254
1422 Ga0501031_0003951
1423 Ga0501031_0322929
1424 Ga0501032_0000055
1425 Ga0501032_0250613
1426 Ga0501032_0323217
1427 Ga0501033_0000163
1428 Ga0501033_0004474
1429 Ga0501033_0030963
1430 Ga0501033_0087939
1431 Ga0501033_0093781
1432 Ga0501033_0382609
1433 Ga0501034_0001317
1434 Ga0501034_0027468
1435 Ga0501034_0057608
1436 Ga0501034_0500188
1437 Ga0501034_1305428
1438 Ga0501036_0000021
1439 Ga0501036_0060170
1440 Ga0501036_0442000
1441 Ga0501036_0781683
1442 Ga0501037_0000314
1443 Ga0501037_0032065
1444 Ga0501037_0132679
1445 Ga0501038_0000070
1446 Ga0501038_0019324
1447 Ga0501038_0084270
1448 Ga0501038_0219673
1449 Ga0501039_0000213
1450 Ga0501039_0140107
1451 Ga0501039_0343949
1452 Ga0501039_0508366
1453 Ga0501039_0598376
1454 Ga0501040_0218298
1455 Ga0501040_0437412
1456 Ga0501041_0019385
1457 Ga0501042_0339622
1458 Ga0501042_0739763
1459 Ga0501043_0000297
1460 Ga0501043_0076647
1461 Ga0501043_0245314
1462 Ga0501043_0262793
1463 Ga0501043_0651635
1464 Ga0501043_0935823
1465 Ga0501046_0001881
1466 Ga0501046_0042476
1467 Ga0501046_0527326
1468 Ga0501046_0888562
1469 Ga0501047_0000232
1470 Ga0501047_0078166
1471 Ga0501047_0445204
1472 Ga0501048_0001340
1473 Ga0501048_0198309
1474 Ga0501048_0622691
1475 Ga0501067_0000177
1476 Ga0501068_0000469
1477 Ga0501069_0023848
1478 Ga0501070_0005350
1479 Ga0501070_0085898
1480 Ga0501070_0205541
1481 Ga0501070_0404273
1482 Ga0501071_0107329
1483 Ga0501071_0655139
1484 Ga0501071_0659454
1485 Ga0501072_0001306
1486 Ga0501073_0001892
1487 Ga0501074_0000019
1488 Ga0501074_0316946
1489 Ga0501074_0584248
1490 Ga0501074_0769516
1491 Ga0501075_0278200
1492 Ga0501075_0415481
1493 Ga0501075_0835130
1494 Ga0501076_0111501
1495 Ga0501077_0079268
1496 Ga0501077_0237321
1497 Ga0501236_022072
1498 Ga0501079_0011682
1499 Ga0501079_0131123
1500 Ga0501079_0132875
1501 Ga0501079_0280750
1502 Ga0501079_0674374
1503 Ga0501080_0007211
1504 Ga0501081_0162190
1505 Ga0501081_0181596
1506 Ga0501081_0318860
1507 Ga0501081_0624129
1508 Ga0501083_0000300
1509 Ga0501273_014237
1510 Ga0501035_0000120
1511 Ga0501035_0035233
1512 Ga0501035_0040809
1513 Ga0501035_0091749
1514 Ga0501035_0406389
1515 Ga0501044_0000179
1516 Ga0501044_0005204
1517 Ga0501044_0018980
1518 Ga0501044_0045493
1519 Ga0501044_0201207
1520 Ga0501045_0010817
1521 Ga0501045_0185857
1522 Ga0501045_0396409
1523 Ga0501045_0738430
1524 nmdc:mga00v17_59907_c1
1525 nmdc:mga0k408_77900_c1
1526 nmdc:mga06z11_872765_c1
1527 nmdc:mga05p37_1165785_c1
1528 nmdc:mga05p37_1245751_c1
1529 nmdc:mga05p37_130479_c1
1530 nmdc:mga05p37_1404408_c1
1531 nmdc:mga05p37_172200_c1
1532 nmdc:mga05p37_209654_c1
1533 nmdc:mga05p37_212348_c1
1534 nmdc:mga05p37_2525_c2
1535 nmdc:mga05p37_256_c1
1536 nmdc:mga05p37_322786_c1
1537 nmdc:mga05p37_330564_c1
1538 nmdc:mga05p37_333870_c1
1539 nmdc:mga05p37_342697_c1
1540 nmdc:mga05p37_365292_c1
1541 nmdc:mga05p37_573311_c1
1542 nmdc:mga05p37_809652_c1
1543 nmdc:mga05p37_833_c1
1544 nmdc:mga09592_193303_c1
1545 nmdc:mga09592_236786_c1
1546 nmdc:mga09592_257657_c1
1547 nmdc:mga0qj67_105371_c1
1548 nmdc:mga0qj67_352065_c1
1549 nmdc:mga0qj67_515206_c1
1550 nmdc:mga0qj67_65793_c1
1551 nmdc:mga0qj67_8851_c1
1552 nmdc:mga06r32_132120_c1
1553 nmdc:mga06r32_155563_c1
1554 nmdc:mga06r32_177001_c1
1555 nmdc:mga06r32_1930_c1
1556 nmdc:mga06r32_20633_c1
1557 nmdc:mga06r32_284865_c1
1558 nmdc:mga06r32_313963_c1
1559 nmdc:mga06r32_325733_c1
1560 nmdc:mga06r32_34626_c1
1561 nmdc:mga06r32_592594_c1
1562 nmdc:mga06r32_75885_c1
1563 nmdc:mga08y16_104935_c1
1564 nmdc:mga08y16_1355784_c1
1565 nmdc:mga08y16_1870679_c1
1566 nmdc:mga08y16_58130_c1
1567 nmdc:mga0n895_146735_c1
1568 nmdc:mga0n895_178964_c1
1569 nmdc:mga0n895_335161_c1
1570 nmdc:mga0n895_385193_c1
1571 nmdc:mga0rr50_1_c1
1572 nmdc:mga0rr50_39173_c1
1573 nmdc:mga0rr50_53461_c1
1574 nmdc:mga0rr50_808858_c1
1575 nmdc:mga0rr50_885_c1
1576 nmdc:mga08x19_115427_c1
1577 nmdc:mga08x19_405430_c1
1578 nmdc:mga08x19_51340_c1
1579 nmdc:mga08x19_695_c1
1580 nmdc:mga08x19_797896_c1
1581 nmdc:mga0a205_11815_c1
1582 nmdc:mga0a205_262944_c1
1583 nmdc:mga0a205_29268_c2
1584 nmdc:mga0a205_65094_c1
1585 nmdc:mga0a205_66748_c1
1586 nmdc:mga0a205_73042_c1
1587 nmdc:mga0a205_84127_c1
1588 Ga0495595_0020227
1589 Ga0495619_0131174
1590 Ga0501084_0001025
1591 Ga0501084_0351645
1592 Ga0590077_016210
1593 Ga0587083_0007500
1594 Ga0587109_025901
1595 Ga0501082_0002527
1596 Ga0501082_0088535
1597 Ga0501082_0318148
1598 Ga0501082_0334269
1599 Ga0501082_0672254
1600 Ga0530510_0022705
1601 Ga0530510_0417265
1602 2932800241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

8

176

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7928 5 176
6loe-assembly1.cif.gz_D cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7812 5 176
7p4y-assembly1.cif.gz_B glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.7602 3 35
6f0k-assembly1.cif.gz_D alternative complex iii 0.7394 5 172
6f0k-assembly1.cif.gz_D alternative complex iii 0.7254 5 172
ID Description Score Start End Superfamily
1nzaA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.744 6 43 3.30.70.120
af_Q61144_347_440_1.10.472.100 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Presenilin 0.7115 57 120 1.10.472.100
af_Q54DE8_365_465_1.10.472.100 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Presenilin 0.7072 55 120 1.10.472.100
af_A4HU35_25_141_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7024 54 124 1.10.10.1740
af_Q6ZGV9_11_120_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6888 54 124 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8495 1 176 GO:0016020
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.8408 1 176 GO:0016020
AF-A0A7C2F4Z7-F1-model_v4 DUF3341 domain-containing protein 0.8379 51 122 GO:0005886
AF-A0A3D3RA05-F1-model_v4 Uncharacterized protein 0.8298 4 175 GO:0009055
GO:0020037
AF-A0A518CNK7-F1-model_v4 Cytochrome c domain-containing protein 0.8292 2 176 GO:0009055
GO:0016020
GO:0020037
GO:0046872

Map