F481370

General Info

Members Datasets Scaffolds Average Seq Length
800 409 1600 140

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_101081694|Ga0070697_1010816941
Length 167
Sequence VPEEPIGGIVEGRGEPGLIRKLQQRRPAVKVKDAMHKGVDWVSPDTPVTELAKLMCEHDIGAIPIGENDRLIGMVTDRDIVCKGLTQDSFDARRATARDVMTPGIHCCRDDDDLAKAVRHMEKLQVRRLPVINKSRRMIGILSLGDVSNSAPGDLLSECVKSVSAHH

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
113 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
114 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
194 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
205 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
223 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
232 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
233 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
236 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
237 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
238 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
250 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
287 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
307 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
312 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
313 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
314 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
315 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
316 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
317 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
318 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
319 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
342 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
343 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
354 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
365 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
366 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
370 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
371 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
372 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
373 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
374 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
375 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
376 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
377 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
378 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
379 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
380 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
381 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
382 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
383 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
384 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
391 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
392 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
393 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
394 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
395 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
396 2791355199
397 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
398 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
399 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
400 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
401 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
402 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
403 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
404 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
405 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
406 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
407 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
408 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
409 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.62
Metatranscriptomes 1.13
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 1.12
Rhizoplane 9.88
Rhizosphere 77.5
Stem 0
Stem Tuber 0
Unclassified 4.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_101081694 3300005536 Bacteria 713
2 JGI24739J22299_10119679 3300001989 Bacteria 787
3 JGI24738J21930_10042791 3300002075 Bacteria 920
4 JGI25404J52841_10029538 3300003659 Bacteria 1175
5 JGI25404J52841_10087223 3300003659 Bacteria 652
6 Ga0058859_11767341 3300004798 Bacteria 586
7 Ga0065704_10085298 3300005289 Unclassified 3236
8 Ga0065707_10081825 3300005295 Bacteria 35840
9 Ga0070676_10130130 3300005328 Bacteria 1591
10 Ga0070690_100070242 3300005330 Bacteria 2274
11 Ga0068869_100056420 3300005334 Bacteria 2865
12 Ga0070666_11018119 3300005335 Bacteria 615
13 Ga0070680_100037419 3300005336 Bacteria 3921
14 Ga0068868_100032162 3300005338 Bacteria 4034
15 Ga0068868_100466624 3300005338 Bacteria 1101
16 Ga0068868_101915992 3300005338 Bacteria 561
17 Ga0070660_100981063 3300005339 Bacteria 714
18 Ga0070689_100405901 3300005340 Bacteria 1153
19 Ga0070691_10433970 3300005341 Bacteria 747
20 Ga0070668_100029672 3300005347 Bacteria 4155
21 Ga0070668_100042864 3300005347 Bacteria 3468
22 Ga0070668_100110748 3300005347 Bacteria 2185
23 Ga0070668_100369238 3300005347 Bacteria 1218
24 Ga0070668_100654108 3300005347 Bacteria 924
25 Ga0070669_100675491 3300005353 Bacteria 871
26 Ga0070675_100134723 3300005354 Bacteria 2107
27 Ga0070671_100521933 3300005355 Bacteria 1023
28 Ga0070671_100873955 3300005355 Bacteria 785
29 Ga0070674_100042557 3300005356 Bacteria 3086
30 Ga0070674_100176448 3300005356 Bacteria 1633
31 Ga0070674_100245941 3300005356 Bacteria 1403
32 Ga0070673_100299747 3300005364 Bacteria 1415
33 Ga0070688_100508763 3300005365 Bacteria 909
34 Ga0070659_100549665 3300005366 Bacteria 988
35 Ga0070659_101004171 3300005366 Bacteria 732
36 Ga0070667_101233957 3300005367 Bacteria 700
37 Ga0070667_101810547 3300005367 Bacteria 575
38 Ga0070667_101966931 3300005367 Bacteria 551
39 Ga0070709_10170003 3300005434 Bacteria 1522
40 Ga0070709_10369627 3300005434 Bacteria 1064
41 Ga0070714_100308872 3300005435 Bacteria 1476
42 Ga0070714_101051402 3300005435 Bacteria 793
43 Ga0070714_101581140 3300005435 Bacteria 640
44 Ga0070714_102063858 3300005435 Bacteria 556
45 Ga0070713_100150121 3300005436 Bacteria 2072
46 Ga0070713_100243085 3300005436 Bacteria 1640
47 Ga0070713_100454862 3300005436 Bacteria 1203
48 Ga0070713_101078595 3300005436 Bacteria 776
49 Ga0070710_10010182 3300005437 Bacteria 4613
50 Ga0070710_10016401 3300005437 Bacteria 3769
51 Ga0070710_10030874 3300005437 Bacteria 2886
52 Ga0070710_10295494 3300005437 Bacteria 1056
53 Ga0070710_10713434 3300005437 Bacteria 709
54 Ga0070710_10765654 3300005437 Bacteria 687
55 Ga0070701_10188352 3300005438 Bacteria 1213
56 Ga0070711_100055732 3300005439 Bacteria 2732
57 Ga0070711_100100497 3300005439 Bacteria 2103
58 Ga0070711_100131966 3300005439 Bacteria 1861
59 Ga0070711_100193734 3300005439 Bacteria 1564
60 Ga0070711_100316472 3300005439 Bacteria 1245
61 Ga0070711_100391703 3300005439 Bacteria 1126
62 Ga0070700_100319879 3300005441 Bacteria 1139
63 Ga0070694_100922816 3300005444 Bacteria 722
64 Ga0070708_100370231 3300005445 Bacteria 1351
65 Ga0070708_100589034 3300005445 Bacteria 1048
66 Ga0070708_101037406 3300005445 Bacteria 768
67 Ga0070663_100006006 3300005455 Bacteria 7266
68 Ga0070663_100029289 3300005455 Bacteria 3760
69 Ga0070663_100105833 3300005455 Bacteria 2106
70 Ga0070663_100237394 3300005455 Bacteria 1438
71 Ga0070678_100150999 3300005456 Bacteria 1871
72 Ga0070678_100900924 3300005456 Bacteria 808
73 Ga0070678_100934164 3300005456 Bacteria 794
74 Ga0070662_100049300 3300005457 Bacteria 3036
75 Ga0070662_100169725 3300005457 Bacteria 1712
76 Ga0070681_10053708 3300005458 Bacteria 4015
77 Ga0068867_100143361 3300005459 Bacteria 1869
78 Ga0068867_101385144 3300005459 Unclassified 652
79 Ga0070685_10046850 3300005466 Bacteria 2484
80 Ga0070707_100757465 3300005468 Bacteria 934
81 Ga0070698_100314929 3300005471 Bacteria 1495
82 Ga0070698_100506402 3300005471 Bacteria 1145
83 Ga0070698_100604026 3300005471 Bacteria 1037
84 Ga0070699_100008170 3300005518 Bacteria 9079
85 Ga0070699_100295585 3300005518 Bacteria 1453
86 Ga0070684_101175187 3300005535 Bacteria 722
87 Ga0068853_100043005 3300005539 Bacteria 3864
88 Ga0070672_100109634 3300005543 Bacteria 2248
89 Ga0070672_100893190 3300005543 Bacteria 785
90 Ga0070686_100409077 3300005544 Bacteria 1034
91 Ga0070696_100048704 3300005546 Bacteria 2942
92 Ga0070696_100141975 3300005546 Bacteria 1756
93 Ga0070696_100452102 3300005546 Bacteria 1014
94 Ga0070693_100012586 3300005547 Bacteria 4284
95 Ga0070693_100333787 3300005547 Bacteria 1033
96 Ga0070665_100127983 3300005548 Bacteria 2542
97 Ga0070665_100159787 3300005548 Bacteria 2255
98 Ga0070665_100720683 3300005548 Bacteria 1010
99 Ga0070704_100927169 3300005549 Bacteria 785
100 Ga0068855_100069955 3300005563 Bacteria 4083
101 Ga0068855_100303387 3300005563 Bacteria 1768
102 Ga0070664_102298041 3300005564 Bacteria 512
103 Ga0068857_100120817 3300005577 Bacteria 2359
104 Ga0068854_100084227 3300005578 Bacteria 2352
105 Ga0068854_100173640 3300005578 Bacteria 1679
106 Ga0068856_100233505 3300005614 Bacteria 1855
107 Ga0070702_100081174 3300005615 Bacteria 1943
108 Ga0070702_100229711 3300005615 Unclassified 1246
109 Ga0070702_100383105 3300005615 Bacteria 1000
110 Ga0068852_101182612 3300005616 Bacteria 786
111 Ga0068859_100050609 3300005617 Bacteria 4173
112 Ga0068859_100061027 3300005617 Bacteria 3799
113 Ga0068864_100088108 3300005618 Bacteria 2734
114 Ga0068864_100979896 3300005618 Bacteria 838
115 Ga0068866_10151198 3300005718 Bacteria 1344
116 Ga0068866_10742639 3300005718 Bacteria 677
117 Ga0068861_100047084 3300005719 Bacteria 3254
118 Ga0068861_100330804 3300005719 Bacteria 1330
119 Ga0068861_100463001 3300005719 Bacteria 1138
120 Ga0068870_10025971 3300005840 Bacteria 2914
121 Ga0068870_10049938 3300005840 Bacteria 2209
122 Ga0068863_100398081 3300005841 Bacteria 1346
123 Ga0068863_100415957 3300005841 Bacteria 1316
124 Ga0068863_100497172 3300005841 Bacteria 1201
125 Ga0068858_100320407 3300005842 Bacteria 1481
126 Ga0068858_101074751 3300005842 Bacteria 790
127 Ga0068862_100218264 3300005844 Bacteria 1725
128 Ga0068862_100506618 3300005844 Bacteria 1146
129 Ga0081455_10003576 3300005937 Bacteria 17837
130 Ga0081455_10006795 3300005937 Bacteria 12198
131 Ga0081455_10065309 3300005937 Bacteria 3044
132 Ga0081455_10096538 3300005937 Bacteria 2383
133 Ga0081540_1000452 3300005983 Bacteria 40681
134 Ga0081540_1012048 3300005983 Bacteria 5722
135 Ga0081540_1015298 3300005983 Bacteria 4862
136 Ga0081540_1015434 3300005983 Bacteria 4838
137 Ga0081540_1148550 3300005983 Bacteria 929
138 Ga0081539_10120709 3300005985 Bacteria 1302
139 Ga0081539_10238500 3300005985 Bacteria 816
140 Ga0070717_10249575 3300006028 Bacteria 1567
141 Ga0070717_10426297 3300006028 Bacteria 1193
142 Ga0070717_10973162 3300006028 Bacteria 773
143 Ga0075365_10034831 3300006038 Bacteria 3254
144 Ga0075365_10160773 3300006038 Bacteria 1565
145 Ga0075365_10332465 3300006038 Bacteria 1070
146 Ga0075365_11292950 3300006038 Bacteria 512
147 Ga0075368_10019597 3300006042 Bacteria 2554
148 Ga0075368_10031223 3300006042 Bacteria 2065
149 Ga0075368_10108636 3300006042 Bacteria 1142
150 Ga0075368_10132851 3300006042 Bacteria 1035
151 Ga0075363_100000708 3300006048 Bacteria 11296
152 Ga0075363_100068293 3300006048 Bacteria 1927
153 Ga0075363_100224723 3300006048 Bacteria 1077
154 Ga0075364_10287653 3300006051 Bacteria 1118
155 Ga0075432_10264069 3300006058 Bacteria 703
156 Ga0075432_10271200 3300006058 Bacteria 695
157 Ga0070715_10052396 3300006163 Bacteria 1760
158 Ga0070715_10137261 3300006163 Bacteria 1183
159 Ga0070715_10172838 3300006163 Bacteria 1077
160 Ga0070715_10614951 3300006163 Bacteria 639
161 Ga0070716_100343747 3300006173 Bacteria 1053
162 Ga0070712_100102648 3300006175 Bacteria 2118
163 Ga0070712_100114051 3300006175 Bacteria 2022
164 Ga0070712_100160508 3300006175 Unclassified 1735
165 Ga0070712_100247208 3300006175 Bacteria 1423
166 Ga0070712_100774876 3300006175 Bacteria 822
167 Ga0075362_10036869 3300006177 Bacteria 2141
168 Ga0075362_10197773 3300006177 Bacteria 978
169 Ga0075362_10586003 3300006177 Bacteria 575
170 Ga0075367_10012771 3300006178 Bacteria 4492
171 Ga0075367_10093240 3300006178 Bacteria 1834
172 Ga0075367_10620213 3300006178 Bacteria 687
173 Ga0075369_10037070 3300006186 Bacteria 2076
174 Ga0075369_10177791 3300006186 Bacteria 979
175 Ga0075366_10082444 3300006195 Bacteria 1921
176 Ga0075366_10301990 3300006195 Bacteria 979
177 Ga0075366_10863045 3300006195 Bacteria 563
178 Ga0097621_100115737 3300006237 Bacteria 2269
179 Ga0097621_100270927 3300006237 Bacteria 1492
180 Ga0097621_100508886 3300006237 Bacteria 1091
181 Ga0075370_10059635 3300006353 Bacteria 2172
182 Ga0075370_10065684 3300006353 Bacteria 2069
183 Ga0068871_100078395 3300006358 Bacteria 2732
184 Ga0068871_100105396 3300006358 Bacteria 2366
185 Ga0068871_100233656 3300006358 Bacteria 1596
186 Ga0075428_100080986 3300006844 Bacteria 3544
187 Ga0075428_100125694 3300006844 Bacteria 2791
188 Ga0075428_100347230 3300006844 Bacteria 1593
189 Ga0075428_100489543 3300006844 Bacteria 1316
190 Ga0075428_100684755 3300006844 Bacteria 1093
191 Ga0075428_102047488 3300006844 Bacteria 593
192 Ga0075430_100001022 3300006846 Bacteria 22142
193 Ga0075430_100063797 3300006846 Bacteria 3094
194 Ga0075430_101400565 3300006846 Bacteria 575
195 Ga0075431_100010545 3300006847 Bacteria 9290
196 Ga0075431_100077791 3300006847 Bacteria 3423
197 Ga0075431_100150418 3300006847 Bacteria 2397
198 Ga0075431_100459519 3300006847 Bacteria 1268
199 Ga0075433_10029672 3300006852 Bacteria 4662
200 Ga0075433_10044777 3300006852 Bacteria 3845
201 Ga0075433_10933133 3300006852 Bacteria 757
202 Ga0075434_100001215 3300006871 Bacteria 21397
203 Ga0075434_100015591 3300006871 Bacteria 7294
204 Ga0075434_100132025 3300006871 Bacteria 2517
205 Ga0075434_100994370 3300006871 Bacteria 853
206 Ga0075434_101499553 3300006871 Bacteria 683
207 Ga0075429_100000941 3300006880 Bacteria 23046
208 Ga0075429_100878455 3300006880 Bacteria 785
209 Ga0068865_100143914 3300006881 Bacteria 1801
210 Ga0075436_100001625 3300006914 Bacteria 15378
211 Ga0075436_101001843 3300006914 Bacteria 627
212 Ga0097620_100050607 3300006931 Bacteria 4173
213 Ga0097620_100061023 3300006931 Bacteria 3799
214 Ga0075435_100037938 3300007076 Bacteria 3840
215 Ga0075435_100122823 3300007076 Bacteria 2168
216 Ga0075435_100283853 3300007076 Bacteria 1413
217 Ga0075435_100461693 3300007076 Bacteria 1096
218 Ga0075435_101059256 3300007076 Bacteria 708
219 Ga0075435_101404466 3300007076 Bacteria 612
220 Ga0099794_10441285 3300007265 Bacteria 682
221 Ga0099795_10000063 3300007788 Bacteria 19141
222 Ga0111539_10093709 3300009094 Bacteria 3528
223 Ga0111539_10122619 3300009094 Unclassified 3046
224 Ga0111539_10163413 3300009094 Bacteria 2604
225 Ga0111539_10710864 3300009094 Bacteria 1170
226 Ga0105245_10015376 3300009098 Bacteria 6671
227 Ga0105245_10067584 3300009098 Unclassified 3237
228 Ga0105245_10070864 3300009098 Bacteria 3164
229 Ga0105245_11267252 3300009098 Bacteria 786
230 Ga0105245_12597743 3300009098 Bacteria 560
231 Ga0105247_10024677 3300009101 Plasmid 3624
232 Ga0105247_10188961 3300009101 Bacteria 1378
233 Ga0105247_10411578 3300009101 Bacteria 966
234 Ga0114129_10001230 3300009147 Bacteria 34074
235 Ga0114129_10039272 3300009147 Bacteria 6674
236 Ga0114129_10115916 3300009147 Bacteria 3692
237 Ga0114129_11859356 3300009147 Bacteria 731
238 Ga0114129_12331616 3300009147 Bacteria 642
239 Ga0105243_10017714 3300009148 Bacteria 5387
240 Ga0105243_10050658 3300009148 Bacteria 3281
241 Ga0105243_10072933 3300009148 Bacteria 2780
242 Ga0105243_12210899 3300009148 Bacteria 587
243 Ga0105241_10086245 3300009174 Bacteria 2469
244 Ga0105241_10522669 3300009174 Bacteria 1061
245 Ga0105242_10093533 3300009176 Unclassified 2534
246 Ga0105242_10210602 3300009176 Bacteria 1732
247 Ga0105242_10239436 3300009176 Bacteria 1631
248 Ga0105242_10859494 3300009176 Bacteria 903
249 Ga0105242_10996184 3300009176 Bacteria 845
250 Ga0105248_10045185 3300009177 Bacteria 4939
251 Ga0105248_10134392 3300009177 Bacteria 2791
252 Ga0105248_10263751 3300009177 Bacteria 1939
253 Ga0105248_11308022 3300009177 Bacteria 820
254 Ga0105248_11683662 3300009177 Bacteria 719
255 Ga0105237_10144489 3300009545 Bacteria 2373
256 Ga0105237_10651280 3300009545 Bacteria 1060
257 Ga0105238_10419713 3300009551 Bacteria 1332
258 Ga0105249_10418177 3300009553 Bacteria 1374
259 Ga0105249_10568512 3300009553 Bacteria 1186
260 Ga0105249_10962571 3300009553 Bacteria 922
261 Ga0099796_10019680 3300010159 Bacteria 2051
262 Ga0105239_10392690 3300010375 Bacteria 1569
263 Ga0105239_11632974 3300010375 Unclassified 746
264 Ga0105246_10053420 3300011119 Plasmid 2780
265 Ga0157337_1018287 3300012483 Bacteria 624
266 Ga0157321_1038893 3300012487 Bacteria 516
267 Ga0157327_1060874 3300012512 Bacteria 563
268 Ga0157373_10882711 3300013100 Bacteria 663
269 Ga0157369_11994271 3300013105 Bacteria 589
270 Ga0157374_10035771 3300013296 Bacteria 4545
271 Ga0157374_10177852 3300013296 Bacteria 2077
272 Ga0157374_10923587 3300013296 Bacteria 891
273 Ga0157374_11155787 3300013296 Bacteria 795
274 Ga0157378_10015429 3300013297 Bacteria 6692
275 Ga0157378_10107367 3300013297 Bacteria 2554
276 Ga0157378_11216052 3300013297 Bacteria 793
277 Ga0163162_10135166 3300013306 Bacteria 2576
278 Ga0163162_10143080 3300013306 Bacteria 2506
279 Ga0163162_10585223 3300013306 Bacteria 1243
280 Ga0157372_10087511 3300013307 Bacteria 3535
281 Ga0157372_11683529 3300013307 Bacteria 730
282 Ga0157375_10255737 3300013308 Bacteria 1913
283 Ga0157375_10719793 3300013308 Bacteria 1151
284 Ga0157375_11476638 3300013308 Bacteria 802
285 Ga0163163_10066750 3300014325 Plasmid 3574
286 Ga0163163_10408634 3300014325 Bacteria 1416
287 Ga0163163_10547598 3300014325 Bacteria 1219
288 Ga0163163_11005106 3300014325 Bacteria 897
289 Ga0157380_10135146 3300014326 Bacteria 2110
290 Ga0157380_10162268 3300014326 Bacteria 1944
291 Ga0157380_11495370 3300014326 Bacteria 728
292 Ga0157379_10028790 3300014968 Bacteria 4940
293 Ga0157376_10044204 3300014969 Unclassified 3660
294 Ga0157376_10647307 3300014969 Bacteria 1057
295 Ga0157376_11024393 3300014969 Bacteria 849
296 Ga0157376_12629958 3300014969 Bacteria 543
297 Ga0182006_1295852 3300015261 Bacteria 531
298 Ga0163161_10320140 3300017792 Bacteria 1226
299 Ga0163161_10396309 3300017792 Bacteria 1106
300 Ga0197907_11254886 3300020069 Bacteria 653
301 Ga0206356_10895189 3300020070 Bacteria 593
302 Ga0206352_11103349 3300020078 Bacteria 591
303 Ga0206350_10040023 3300020080 Bacteria 632
304 Ga0206354_11352027 3300020081 Bacteria 513
305 Ga0213874_10135199 3300021377 Bacteria 850
306 Ga0228598_1008889 3300024227 Bacteria 2020
307 Ga0209758_1056836 3300025297 Bacteria 1319
308 Ga0207697_10029871 3300025315 Bacteria 2231
309 Ga0207653_10309537 3300025885 Bacteria 613
310 Ga0207682_10085991 3300025893 Bacteria 1355
311 Ga0207692_10153304 3300025898 Bacteria 1321
312 Ga0207692_10318629 3300025898 Bacteria 951
313 Ga0207692_11091005 3300025898 Bacteria 528
314 Ga0207710_10102720 3300025900 Bacteria 1350
315 Ga0207710_10204766 3300025900 Bacteria 975
316 Ga0207688_10053231 3300025901 Bacteria 2269
317 Ga0207647_10081814 3300025904 Bacteria 1934
318 Ga0207685_10038743 3300025905 Bacteria 1764
319 Ga0207685_10117707 3300025905 Bacteria 1161
320 Ga0207699_10014301 3300025906 Bacteria 4087
321 Ga0207699_10415427 3300025906 Bacteria 960
322 Ga0207699_10429897 3300025906 Bacteria 944
323 Ga0207645_10374495 3300025907 Bacteria 955
324 Ga0207645_10392914 3300025907 Bacteria 932
325 Ga0207643_10106995 3300025908 Bacteria 1644
326 Ga0207684_10032665 3300025910 Bacteria 4425
327 Ga0207684_10066618 3300025910 Bacteria 3059
328 Ga0207684_10261874 3300025910 Bacteria 1492
329 Ga0207654_10411077 3300025911 Bacteria 943
330 Ga0207707_10755572 3300025912 Bacteria 813
331 Ga0207693_10051041 3300025915 Bacteria 3247
332 Ga0207693_10053524 3300025915 Bacteria 3166
333 Ga0207693_10057253 3300025915 Bacteria 3055
334 Ga0207693_10227887 3300025915 Bacteria 1463
335 Ga0207693_10241951 3300025915 Bacteria 1416
336 Ga0207693_11216320 3300025915 Bacteria 567
337 Ga0207663_10044110 3300025916 Bacteria 2735
338 Ga0207663_10067700 3300025916 Bacteria 2291
339 Ga0207663_10172645 3300025916 Bacteria 1537
340 Ga0207663_11703018 3300025916 Bacteria 507
341 Ga0207662_10175103 3300025918 Bacteria 1378
342 Ga0207657_10095278 3300025919 Bacteria 2477
343 Ga0207657_10800822 3300025919 Unclassified 728
344 Ga0207652_10236483 3300025921 Unclassified 1647
345 Ga0207652_10965653 3300025921 Bacteria 750
346 Ga0207646_10516518 3300025922 Bacteria 1075
347 Ga0207650_10336750 3300025925 Bacteria 1238
348 Ga0207687_10065659 3300025927 Bacteria 2577
349 Ga0207687_10138166 3300025927 Bacteria 1845
350 Ga0207687_10236275 3300025927 Unclassified 1446
351 Ga0207700_10101373 3300025928 Bacteria 2297
352 Ga0207700_10189036 3300025928 Bacteria 1730
353 Ga0207700_11159021 3300025928 Unclassified 690
354 Ga0207700_11583880 3300025928 Bacteria 580
355 Ga0207664_10084538 3300025929 Bacteria 2588
356 Ga0207664_10603261 3300025929 Bacteria 986
357 Ga0207664_10842807 3300025929 Bacteria 824
358 Ga0207690_10087169 3300025932 Bacteria 2196
359 Ga0207690_10898953 3300025932 Bacteria 734
360 Ga0207706_10029450 3300025933 Bacteria 4900
361 Ga0207706_10085974 3300025933 Bacteria 2764
362 Ga0207706_10642520 3300025933 Bacteria 909
363 Ga0207686_10147896 3300025934 Bacteria 1632
364 Ga0207686_10447096 3300025934 Bacteria 993
365 Ga0207709_10014669 3300025935 Bacteria 4331
366 Ga0207709_10665348 3300025935 Bacteria 830
367 Ga0207669_10307271 3300025937 Bacteria 1208
368 Ga0207704_10894924 3300025938 Bacteria 746
369 Ga0207665_10028593 3300025939 Bacteria 3683
370 Ga0207665_10122425 3300025939 Bacteria 1839
371 Ga0207665_10173084 3300025939 Unclassified 1560
372 Ga0207691_10016222 3300025940 Bacteria 7072
373 Ga0207711_10734854 3300025941 Bacteria 920
374 Ga0207689_10033448 3300025942 Bacteria 4272
375 Ga0207679_10243543 3300025945 Bacteria 1525
376 Ga0207651_10077658 3300025960 Bacteria 2378
377 Ga0207712_10103177 3300025961 Bacteria 2125
378 Ga0207712_10476552 3300025961 Bacteria 1063
379 Ga0207712_11269475 3300025961 Bacteria 658
380 Ga0207668_11108581 3300025972 Bacteria 710
381 Ga0207668_11619308 3300025972 Bacteria 584
382 Ga0207658_10322261 3300025986 Bacteria 1338
383 Ga0207658_10576945 3300025986 Bacteria 1009
384 Ga0207677_10030545 3300026023 Bacteria 3440
385 Ga0207677_10112027 3300026023 Bacteria 2034
386 Ga0207703_10500226 3300026035 Bacteria 1141
387 Ga0207703_11074292 3300026035 Bacteria 773
388 Ga0207703_11259207 3300026035 Bacteria 711
389 Ga0207703_11327457 3300026035 Bacteria 692
390 Ga0207639_10072381 3300026041 Bacteria 2699
391 Ga0207678_10013134 3300026067 Bacteria 7265
392 Ga0207678_10079604 3300026067 Bacteria 2805
393 Ga0207678_10327204 3300026067 Bacteria 1319
394 Ga0207708_10155316 3300026075 Bacteria 1804
395 Ga0207702_10530239 3300026078 Bacteria 1150
396 Ga0207641_10433680 3300026088 Bacteria 1267
397 Ga0207641_10687862 3300026088 Bacteria 1006
398 Ga0207648_10172489 3300026089 Bacteria 1912
399 Ga0207676_10094703 3300026095 Bacteria 2461
400 Ga0207676_11527080 3300026095 Bacteria 665
401 Ga0207676_11715760 3300026095 Bacteria 626
402 Ga0207674_10343697 3300026116 Bacteria 1443
403 Ga0207675_100085159 3300026118 Bacteria 2966
404 Ga0207675_100099979 3300026118 Bacteria 2732
405 Ga0207675_100113537 3300026118 Bacteria 2558
406 Ga0207675_100210427 3300026118 Bacteria 1870
407 Ga0207675_100257690 3300026118 Bacteria 1690
408 Ga0207683_10068019 3300026121 Bacteria 3143
409 Ga0207683_10102401 3300026121 Bacteria 2557
410 Ga0207683_11424434 3300026121 Bacteria 640
411 Ga0207698_11060505 3300026142 Bacteria 822
412 Ga0207698_12497692 3300026142 Bacteria 527
413 Ga0209813_10102334 3300027866 Bacteria 976
414 Ga0209813_10139790 3300027866 Bacteria 859
415 Ga0207428_10000415 3300027907 Bacteria 53058
416 Ga0268266_10003949 3300028379 Bacteria 14401
417 Ga0268266_10013710 3300028379 Bacteria 6980
418 Ga0268266_10017138 3300028379 Bacteria 6185
419 Ga0268265_10158788 3300028380 Bacteria 1917
420 Ga0268265_10298210 3300028380 Bacteria 1450
421 Ga0268265_10605599 3300028380 Bacteria 1047
422 Ga0268264_10479050 3300028381 Bacteria 1210
423 Ga0307517_10274782 3300028786 Bacteria 966
424 Ga0307517_10412402 3300028786 Bacteria 711
425 Ga0307515_10381402 3300028794 Bacteria 1042
426 Ga0307511_10240131 3300030521 Bacteria 885
427 Ga0307513_10455936 3300031456 Bacteria 1002
428 Ga0307509_10556339 3300031507 Bacteria 824
429 Ga0307408_100095301 3300031548 Bacteria 2256
430 Ga0307406_11979127 3300031901 Bacteria 520
431 Ga0307412_10128694 3300031911 Bacteria 1836
432 Ga0307412_11066657 3300031911 Bacteria 717
433 Ga0307416_100839664 3300032002 Bacteria 1016
434 Ga0307416_102412085 3300032002 Bacteria 625
435 Ga0307415_100085711 3300032126 Bacteria 2264
436 Ga0307415_100322188 3300032126 Bacteria 1289
437 Ga0307510_10349234 3300033180 Bacteria 930
438 Ga0373928_0267716 3300035084 Unclassified 514
439 Ga0373929_0018733 3300035085 Bacteria 1379
440 Ga0373944_0077382 3300035089 Bacteria 1093
441 Ga0373923_0160896 3300035111 Bacteria 1024
442 Ga0373923_0198796 3300035111 Bacteria 926
443 Ga0373936_0369142 3300035113 Bacteria 655
444 Ga0373939_0151353 3300035114 Bacteria 845
445 Ga0373945_0060420 3300035116 Unclassified 1413
446 Ga0373943_0093809 3300035170 Bacteria 1558
447 Ga0373943_0160314 3300035170 Bacteria 1224
448 Ga0373943_0196202 3300035170 Bacteria 1116
449 Ga0373946_0005476 3300035171 Unclassified 4580
450 Ga0373946_0043759 3300035171 Bacteria 1846
451 Ga0373962_0311259 3300035242 Unclassified 561
452 Ga0373924_0104998 3300035410 Bacteria 1218
453 Ga0373931_1022089 3300035691 Bacteria 560
454 Ga0373935_0073448 3300035692 Bacteria 2210
455 Ga0373935_0092147 3300035692 Bacteria 1985
456 Ga0373935_1037595 3300035692 Bacteria 609
457 Ga0373935_1309286 3300035692 Bacteria 541
458 Ga0373927_0052873 3300035695 Unclassified 2626
459 Ga0373927_0187357 3300035695 Bacteria 1357
460 Ga0373927_0703861 3300035695 Bacteria 667
461 Ga0373933_0262430 3300035724 Bacteria 1114
462 Ga0373933_0300933 3300035724 Bacteria 1038
463 Ga0373947_0105959 3300035725 Unclassified 1771
464 Ga0373947_0372454 3300035725 Bacteria 960
465 Ga0373937_0129275 3300036401 Unclassified 2358
466 Ga0373937_0262985 3300036401 Bacteria 1627
467 Ga0373937_0540339 3300036401 Bacteria 1107
468 Ga0373925_0074111 3300037068 Bacteria 2578
469 Ga0373925_0282708 3300037068 Bacteria 1336
470 Ga0395899_0551241 3300037312 Bacteria 741
471 Ga0395900_0616880 3300037418 Bacteria 1024
472 Ga0395898_1042914 3300037466 Bacteria 752
473 Ga0395905_0031705 3300037471 Bacteria 4973
474 Ga0436364_1420841 3300037853 Bacteria 1231
475 Ga0395901_1537213 3300038443 Bacteria 620
476 Ga0436365_0025969 3300039437 Bacteria 2210
477 Ga0436361_0047063 3300039447 Bacteria 836
478 Ga0436361_0610927 3300039447 Bacteria 2040
479 Ga0436363_0448624 3300039450 Bacteria 860
480 Ga0439461_0187007 3300041410 Bacteria 551
481 Ga0451839_1121085 3300041496 Bacteria 652
482 Ga0451841_0837473 3300041498 Bacteria 552
483 Ga0451853_4035773 3300041512 Bacteria 1002
484 Ga0439442_093481 3300042002 Bacteria 648
485 Ga0439459_0086187 3300042438 Bacteria 749
486 Ga0439440_0072517 3300042993 Unclassified 899
487 Ga0495617_072026 3300046452 Bacteria 1136
488 Ga0495627_134681 3300046453 Bacteria 694
489 Ga0495603_0072169 3300046455 Bacteria 2028
490 Ga0495603_0431341 3300046455 Bacteria 755
491 Ga0495603_0459954 3300046455 Bacteria 729
492 Ga0495590_0214408 3300046457 Bacteria 710
493 Ga0495629_0037185 3300046459 Bacteria 3431
494 Ga0495638_0084089 3300046460 Bacteria 1926
495 Ga0495641_0021236 3300046461 Bacteria 3270
496 Ga0495641_0338695 3300046461 Bacteria 679
497 Ga0495651_0383975 3300046462 Unclassified 920
498 Ga0495653_0194561 3300046463 Bacteria 1381
499 Ga0495580_0106822 3300046472 Unclassified 1944
500 Ga0495582_0310154 3300046473 Unclassified 907
501 Ga0495582_0850822 3300046473 Bacteria 527
502 Ga0495605_0215586 3300046474 Bacteria 831
503 Ga0495605_0277169 3300046474 Bacteria 713
504 Ga0495639_0023174 3300046475 Bacteria 2727
505 Ga0495639_0290791 3300046475 Bacteria 813
506 Ga0495662_0167557 3300046476 Unclassified 1082
507 Ga0495662_0206371 3300046476 Bacteria 968
508 Ga0495662_0446120 3300046476 Bacteria 635
509 Ga0495662_0466417 3300046476 Bacteria 619
510 Ga0495664_0042313 3300046477 Bacteria 2697
511 Ga0495664_0124017 3300046477 Bacteria 1562
512 Ga0495584_0054430 3300046491 Bacteria 2014
513 Ga0495584_0084261 3300046491 Bacteria 1601
514 Ga0495584_0184124 3300046491 Bacteria 1061
515 Ga0495585_0046448 3300046492 Bacteria 2422
516 Ga0495594_0063300 3300046499 Bacteria 2049
517 Ga0495594_0512666 3300046499 Bacteria 681
518 Ga0495607_0550522 3300046501 Bacteria 506
519 Ga0495583_0176490 3300046506 Bacteria 876
520 Ga0495606_0063349 3300046507 Bacteria 2357
521 Ga0495616_0077073 3300046513 Bacteria 1601
522 Ga0495618_0337000 3300046514 Unclassified 931
523 Ga0495620_0067017 3300046515 Bacteria 1478
524 Ga0495628_0310957 3300046516 Bacteria 1165
525 Ga0495630_0094552 3300046517 Bacteria 2259
526 Ga0495630_0163429 3300046517 Bacteria 1695
527 Ga0495630_0431525 3300046517 Bacteria 1009
528 Ga0495631_0255712 3300046518 Bacteria 746
529 Ga0495632_0318384 3300046519 Bacteria 687
530 Ga0495643_0352827 3300046522 Bacteria 658
531 Ga0495644_0015068 3300046523 Bacteria 2961
532 Ga0495666_0047484 3300046526 Bacteria 2068
533 Ga0495642_0302768 3300046528 Bacteria 700
534 Ga0495652_0074357 3300046529 Bacteria 2826
535 Ga0495665_0235949 3300046531 Unclassified 943
536 Ga0495665_0291941 3300046531 Bacteria 836
537 Ga0495640_0018467 3300046533 Bacteria 5169
538 Ga0495640_0165644 3300046533 Bacteria 1414
539 Ga0495640_0368664 3300046533 Bacteria 884
540 Ga0495586_0049451 3300046535 Bacteria 2273
541 Ga0495598_0070111 3300046537 Bacteria 1102
542 Ga0495609_0224240 3300046538 Bacteria 780
543 Ga0495621_0091804 3300046539 Bacteria 1145
544 Ga0495645_0045910 3300046543 Bacteria 3186
545 Ga0495622_0222349 3300046557 Bacteria 836
546 Ga0495633_0136352 3300046558 Bacteria 1135
547 Ga0495667_0189598 3300046559 Unclassified 1318
548 Ga0495667_0667553 3300046559 Bacteria 645
549 Ga0495656_0014149 3300046615 Bacteria 2985
550 Ga0495656_0024319 3300046615 Bacteria 2391
551 Ga0495668_0129696 3300046616 Bacteria 1380
552 Ga0495634_0013130 3300046642 Bacteria 5985
553 Ga0495634_0064660 3300046642 Bacteria 2424
554 Ga0495634_0066757 3300046642 Bacteria 2381
555 Ga0495634_0084907 3300046642 Bacteria 2064
556 Ga0495611_0240428 3300046648 Bacteria 840
557 Ga0495625_0421106 3300046660 Bacteria 830
558 Ga0495625_0745487 3300046660 Bacteria 574
559 Ga0495635_0145215 3300046663 Unclassified 1615
560 Ga0495635_0197958 3300046663 Bacteria 1363
561 Ga0495635_0401372 3300046663 Bacteria 911
562 Ga0495588_0285076 3300046674 Unclassified 870
563 Ga0495588_0299610 3300046674 Bacteria 846
564 Ga0495588_0414618 3300046674 Bacteria 707
565 Ga0495599_0349600 3300046678 Unclassified 886
566 Ga0495647_0198777 3300046681 Bacteria 879
567 Ga0495613_0201391 3300046689 Bacteria 1403
568 Ga0495613_0243811 3300046689 Bacteria 1256
569 Ga0495624_0101062 3300046690 Unclassified 1775
570 Ga0495670_0278277 3300046691 Bacteria 895
571 Ga0495589_0186189 3300046794 Bacteria 983
572 Ga0495600_0141531 3300046809 Bacteria 1560
573 Ga0495660_0388256 3300046810 Bacteria 614
574 Ga0495581_0354787 3300047315 Bacteria 856
575 Ga0495581_0404270 3300047315 Unclassified 796
576 Ga0495581_0540189 3300047315 Bacteria 677
577 Ga0495674_0027359 3300047319 Bacteria 5211
578 Ga0495674_0083828 3300047319 Bacteria 2732
579 Ga0495674_0103725 3300047319 Bacteria 2417
580 Ga0495674_0328131 3300047319 Bacteria 1245
581 Ga0495676_0116127 3300047321 Bacteria 1955
582 Ga0495676_0218525 3300047321 Bacteria 1315
583 Ga0495676_0825657 3300047321 Bacteria 596
584 Ga0495680_0063409 3300047322 Unclassified 2838
585 Ga0495680_0362559 3300047322 Bacteria 1007
586 Ga0495683_0207905 3300047323 Bacteria 879
587 Ga0495677_0020738 3300047445 Bacteria 2382
588 Ga0495677_0253844 3300047445 Bacteria 688
589 Ga0495673_0154180 3300047469 Bacteria 886
590 Ga0495684_0058018 3300047471 Unclassified 2949
591 Ga0495684_0262776 3300047471 Bacteria 1251
592 Ga0495686_0215774 3300047472 Bacteria 1094
593 Ga0495593_0032164 3300047673 Bacteria 2861
594 Ga0495593_0370378 3300047673 Bacteria 716
595 Ga0495614_0448276 3300048089 Unclassified 610
596 Ga0495615_0014847 3300048090 Bacteria 1654
597 Ga0496100_0004388 3300048903 Bacteria 7470
598 Ga0496100_0121196 3300048903 Bacteria 1830
599 Ga0496100_0134325 3300048903 Bacteria 1746
600 Ga0496100_0558093 3300048903 Bacteria 886
601 Ga0496101_0015688 3300048904 Bacteria 5112
602 Ga0496101_0027203 3300048904 Bacteria 3982
603 Ga0496102_0022011 3300048905 Bacteria 5646
604 Ga0496102_0023126 3300048905 Bacteria 5515
605 Ga0496102_0055534 3300048905 Bacteria 3611
606 Ga0496102_0073217 3300048905 Bacteria 3149
607 Ga0496102_0140638 3300048905 Bacteria 2263
608 Ga0496102_0144090 3300048905 Bacteria 2235
609 Ga0496102_0191926 3300048905 Bacteria 1925
610 Ga0496102_0230746 3300048905 Bacteria 1745
611 Ga0496103_0006839 3300048906 Bacteria 6807
612 Ga0496103_0304694 3300048906 Bacteria 1025
613 Ga0496103_0459327 3300048906 Bacteria 816
614 Ga0496104_0024394 3300048907 Bacteria 5563
615 Ga0496104_0031626 3300048907 Bacteria 4922
616 Ga0496104_0045171 3300048907 Bacteria 4142
617 Ga0496104_0195139 3300048907 Bacteria 1937
618 Ga0496104_0255609 3300048907 Bacteria 1664
619 Ga0496105_0018552 3300048908 Bacteria 5597
620 Ga0496105_0032234 3300048908 Bacteria 4299
621 Ga0496105_0353868 3300048908 Bacteria 1172
622 Ga0496105_0593483 3300048908 Bacteria 860
623 Ga0496105_0818484 3300048908 Bacteria 707
624 Ga0496106_0017163 3300048909 Bacteria 5359
625 Ga0496106_0130299 3300048909 Bacteria 1972
626 Ga0496106_0157855 3300048909 Bacteria 1792
627 Ga0496106_0169618 3300048909 Bacteria 1729
628 Ga0496106_0270914 3300048909 Bacteria 1359
629 Ga0496106_1122278 3300048909 Bacteria 615
630 Ga0496107_0017114 3300048910 Bacteria 5097
631 Ga0496107_0102580 3300048910 Bacteria 2098
632 Ga0496107_0190518 3300048910 Bacteria 1523
633 Ga0496107_0367681 3300048910 Bacteria 1070
634 Ga0496108_0017297 3300048911 Bacteria 5897
635 Ga0496108_0057564 3300048911 Bacteria 3266
636 Ga0496108_0107954 3300048911 Bacteria 2377
637 Ga0496108_0194324 3300048911 Unclassified 1759
638 Ga0496108_0298228 3300048911 Bacteria 1404
639 Ga0496108_0389156 3300048911 Bacteria 1218
640 Ga0496108_0906748 3300048911 Bacteria 756
641 Ga0496109_0025024 3300048912 Bacteria 5315
642 Ga0496109_0037488 3300048912 Bacteria 4379
643 Ga0496109_0136084 3300048912 Bacteria 2296
644 Ga0496109_0298706 3300048912 Bacteria 1518
645 Ga0496109_0541605 3300048912 Bacteria 1098
646 Ga0496110_0053379 3300048913 Bacteria 3553
647 Ga0496110_0080826 3300048913 Bacteria 2897
648 Ga0496110_0357146 3300048913 Bacteria 1331
649 Ga0496110_0505976 3300048913 Bacteria 1099
650 Ga0496110_0754555 3300048913 Bacteria 876
651 Ga0496110_0928504 3300048913 Bacteria 777
652 Ga0496111_0015187 3300048914 Bacteria 5279
653 Ga0496111_0202154 3300048914 Bacteria 1477
654 Ga0496111_0291018 3300048914 Bacteria 1211
655 Ga0496112_0032534 3300048915 Bacteria 5065
656 Ga0496112_0036880 3300048915 Bacteria 4769
657 Ga0496112_0040505 3300048915 Bacteria 4555
658 Ga0496112_0071644 3300048915 Bacteria 3425
659 Ga0496113_0013254 3300048916 Bacteria 5577
660 Ga0496113_0133103 3300048916 Bacteria 1952
661 Ga0496113_0147988 3300048916 Bacteria 1851
662 Ga0496113_0252807 3300048916 Bacteria 1407
663 Ga0496113_0327771 3300048916 Bacteria 1228
664 Ga0496113_0840579 3300048916 Bacteria 728
665 Ga0496114_0019446 3300048917 Bacteria 5502
666 Ga0496114_0051569 3300048917 Bacteria 3426
667 Ga0496114_0151476 3300048917 Bacteria 2012
668 Ga0496114_0233160 3300048917 Bacteria 1618
669 Ga0496114_0270016 3300048917 Bacteria 1499
670 Ga0496114_0323532 3300048917 Bacteria 1363
671 Ga0496114_0428559 3300048917 Bacteria 1172
672 Ga0496115_0005667 3300048918 Bacteria 9087
673 Ga0496115_0070933 3300048918 Bacteria 2825
674 Ga0496115_0445896 3300048918 Bacteria 1046
675 Ga0496115_1106608 3300048918 Bacteria 600
676 Ga0496116_0275085 3300048919 Bacteria 820
677 Ga0496118_0569283 3300048921 Bacteria 548
678 Ga0496119_0418957 3300048922 Bacteria 636
679 Ga0496121_0202116 3300048924 Bacteria 1415
680 Ga0496125_0089142 3300048928 Bacteria 2321
681 Ga0496126_0199526 3300048929 Bacteria 1690
682 Ga0501038_0130279 3300049574 Bacteria 2066
683 Ga0501040_0307363 3300049576 Bacteria 1134
684 Ga0501041_0337816 3300049577 Bacteria 951
685 Ga0501041_0410498 3300049577 Bacteria 858
686 Ga0501042_0604064 3300049578 Bacteria 798
687 Ga0501043_0786895 3300049579 Bacteria 689
688 Ga0501046_0887724 3300049580 Bacteria 622
689 Ga0501047_0060515 3300049581 Bacteria 3654
690 Ga0501048_0628997 3300049582 Bacteria 771
691 Ga0501048_1197998 3300049582 Bacteria 546
692 Ga0501070_0322895 3300049586 Bacteria 1255
693 Ga0501072_0173965 3300049588 Bacteria 1718
694 Ga0501074_1075040 3300049590 Bacteria 565
695 Ga0501076_0105976 3300049592 Bacteria 2269
696 Ga0501079_0204328 3300049741 Bacteria 1543
697 Ga0501080_0561232 3300049742 Bacteria 1016
698 Ga0501080_0742059 3300049742 Bacteria 864
699 Ga0501083_0603966 3300049744 Bacteria 714
700 Ga0501035_0692231 3300049822 Bacteria 823
701 Ga0501045_0664619 3300049824 Bacteria 770
702 nmdc:mga03683_85090_c1 3300050489 Bacteria 528
703 nmdc:mga03n38_404198_c1 3300050490 Bacteria 752
704 nmdc:mga03n38_81_c1 3300050490 Bacteria 20378
705 nmdc:mga00v17_175612_c1 3300050491 Bacteria 1382
706 nmdc:mga0yw44_12481_c1 3300050492 Bacteria 4431
707 nmdc:mga0yw44_5734_c1 3300050492 Bacteria 5917
708 nmdc:mga0yw44_59949_c1 3300050492 Bacteria 2330
709 nmdc:mga0k408_162594_c1 3300050493 Bacteria 1330
710 nmdc:mga0k408_184637_c1 3300050493 Bacteria 1244
711 nmdc:mga06z11_4118_c1 3300050494 Bacteria 5681
712 nmdc:mga06z11_46730_c1 3300050494 Bacteria 2195
713 nmdc:mga04h51_295744_c1 3300050495 Bacteria 659
714 nmdc:mga04h51_70264_c1 3300050495 Bacteria 1221
715 nmdc:mga07m45_369018_c1 3300050496 Bacteria 834
716 nmdc:mga05p37_1126851_c1 3300050507 Bacteria 819
717 nmdc:mga05p37_116503_c1 3300050507 Bacteria 3284
718 nmdc:mga05p37_281_c1 3300050507 Bacteria 50198
719 nmdc:mga05p37_59600_c1 3300050507 Bacteria 4701
720 nmdc:mga05p37_69762_c2 3300050507 Bacteria 2265
721 nmdc:mga05p37_938_c1 3300050507 Bacteria 32835
722 nmdc:mga09592_283901_c1 3300050508 Bacteria 1435
723 nmdc:mga09592_3312_c1 3300050508 Bacteria 13044
724 nmdc:mga0qj67_15384_c1 3300050509 Bacteria 5793
725 nmdc:mga0qj67_62361_c1 3300050509 Bacteria 2962
726 nmdc:mga06r32_153848_c1 3300050510 Bacteria 2280
727 nmdc:mga06r32_30972_c1 3300050510 Bacteria 5021
728 nmdc:mga06r32_820831_c1 3300050510 Bacteria 889
729 nmdc:mga08y16_1073174_c1 3300050511 Bacteria 782
730 nmdc:mga08y16_17462_c1 3300050511 Bacteria 7557
731 nmdc:mga08y16_30756_c1 3300050511 Bacteria 5647
732 nmdc:mga0n895_11553_c1 3300050512 Bacteria 7887
733 nmdc:mga0n895_288385_c1 3300050512 Bacteria 1664
734 nmdc:mga0n895_63183_c1 3300050512 Bacteria 3661
735 nmdc:mga0n895_88398_c1 3300050512 Bacteria 3098
736 nmdc:mga0rr50_140457_c1 3300050513 Bacteria 1943
737 nmdc:mga0rr50_1850940_c1 3300050513 Bacteria 508
738 nmdc:mga0rr50_6215_c1 3300050513 Bacteria 7239
739 nmdc:mga0rr50_96630_c1 3300050513 Bacteria 2312
740 nmdc:mga08x19_2436_c1 3300050514 Bacteria 11297
741 nmdc:mga0a205_311362_c1 3300050515 Bacteria 1446
742 nmdc:mga0a205_439909_c1 3300050515 Bacteria 1165
743 nmdc:mga0a205_462201_c1 3300050515 Bacteria 1128
744 nmdc:mga0a205_571_c1 3300050515 Bacteria 29236
745 nmdc:mga0a205_64981_c1 3300050515 Bacteria 3525
746 nmdc:mga0sz30_144276_c1 3300050516 Bacteria 1052
747 nmdc:mga0sz30_285208_c1 3300050516 Bacteria 736
748 Ga0495601_0000802 3300053077 Bacteria 16972
749 Ga0495601_0192847 3300053077 Bacteria 1331
750 Ga0495601_0426809 3300053077 Bacteria 858
751 Ga0495612_0011324 3300053078 Bacteria 3594
752 Ga0495595_0589408 3300053084 Bacteria 568
753 Ga0495619_0004945 3300053085 Bacteria 8466
754 Ga0495619_0013813 3300053085 Bacteria 5096
755 Ga0495619_0220885 3300053085 Bacteria 1312
756 Ga0495619_0354430 3300053085 Bacteria 1015
757 Ga0495619_0497515 3300053085 Bacteria 838
758 Ga0500578_0210919 3300053086 Bacteria 1185
759 Ga0500646_0031243 3300053090 Bacteria 1465
760 Ga0500641_0033474 3300053096 Bacteria 2040
761 Ga0500555_186288 3300053103 Bacteria 501
762 Ga0500594_0015687 3300053118 Bacteria 1831
763 Ga0500597_225077 3300053120 Bacteria 778
764 Ga0500621_158384 3300053126 Bacteria 842
765 Ga0500655_019152 3300053133 Bacteria 1274
766 Ga0500577_0049721 3300053142 Bacteria 1569
767 Ga0500589_191533 3300053147 Bacteria 794
768 Ga0500616_0024888 3300053153 Unclassified 3322
769 Ga0500622_0122172 3300053156 Bacteria 1262
770 Ga0500633_0120035 3300053160 Bacteria 978
771 Ga0500634_0036542 3300053161 Bacteria 2674
772 Ga0500645_006584 3300053730 Bacteria 4126
773 Ga0500645_109368 3300053730 Bacteria 776
774 Ga0500587_076133 3300053739 Bacteria 535
775 Ga0501084_0420027 3300054114 Bacteria 1130
776 Ga0587083_0247623 3300059505 Bacteria 530
777 Ga0587090_123830 3300059510 Bacteria 563
778 Ga0587094_123144 3300059513 Bacteria 521
779 Ga0501082_0324327 3300060353 Bacteria 1342
780 Ga0530510_0199078 3300061734 Bacteria 1487
781 Ga0530510_0306716 3300061734 Bacteria 1188
782 2513691888 2513237101 Bacteria 7952346
783 2524438664 2524023205 Bacteria 8918781
784 2524465422 2524023210 Bacteria 9029266
785 2728747842 2728368998 Bacteria 8720350
786 2745080544 2744054633 Bacteria 8678936
787 2793077314
788 2824607574 2824600985 Bacteria 8488197
789 2824612019 2824609381 Bacteria 8672835
790 2824657142 2824653114 Bacteria 8493680
791 2857527264 2857524615 Bacteria 6615449
792 2874609664 2874604998 Bacteria 7834745
793 2876814410 2876808645 Bacteria 8824342
794 2879118468 2879110137 Bacteria 8907982
795 2888427229 2888419890 Bacteria 7857137
796 2889040521 2889033259 Bacteria 9099371
797 2919078381 2919073203 Bacteria 6531949
798 2922367660 2922361189 Bacteria 7436256
799 8006997673 8006994254 Bacteria 8309700
800 8056681459 8056681323 Bacteria 8472857
801 Ga0070697_101081694
802 JGI24739J22299_10119679
803 JGI24738J21930_10042791
804 JGI25404J52841_10029538
805 JGI25404J52841_10087223
806 Ga0058859_11767341
807 Ga0065704_10085298
808 Ga0065707_10081825
809 Ga0070676_10130130
810 Ga0070690_100070242
811 Ga0068869_100056420
812 Ga0070666_11018119
813 Ga0070680_100037419
814 Ga0068868_100032162
815 Ga0068868_100466624
816 Ga0068868_101915992
817 Ga0070660_100981063
818 Ga0070689_100405901
819 Ga0070691_10433970
820 Ga0070668_100029672
821 Ga0070668_100042864
822 Ga0070668_100110748
823 Ga0070668_100369238
824 Ga0070668_100654108
825 Ga0070669_100675491
826 Ga0070675_100134723
827 Ga0070671_100521933
828 Ga0070671_100873955
829 Ga0070674_100042557
830 Ga0070674_100176448
831 Ga0070674_100245941
832 Ga0070673_100299747
833 Ga0070688_100508763
834 Ga0070659_100549665
835 Ga0070659_101004171
836 Ga0070667_101233957
837 Ga0070667_101810547
838 Ga0070667_101966931
839 Ga0070709_10170003
840 Ga0070709_10369627
841 Ga0070714_100308872
842 Ga0070714_101051402
843 Ga0070714_101581140
844 Ga0070714_102063858
845 Ga0070713_100150121
846 Ga0070713_100243085
847 Ga0070713_100454862
848 Ga0070713_101078595
849 Ga0070710_10010182
850 Ga0070710_10016401
851 Ga0070710_10030874
852 Ga0070710_10295494
853 Ga0070710_10713434
854 Ga0070710_10765654
855 Ga0070701_10188352
856 Ga0070711_100055732
857 Ga0070711_100100497
858 Ga0070711_100131966
859 Ga0070711_100193734
860 Ga0070711_100316472
861 Ga0070711_100391703
862 Ga0070700_100319879
863 Ga0070694_100922816
864 Ga0070708_100370231
865 Ga0070708_100589034
866 Ga0070708_101037406
867 Ga0070663_100006006
868 Ga0070663_100029289
869 Ga0070663_100105833
870 Ga0070663_100237394
871 Ga0070678_100150999
872 Ga0070678_100900924
873 Ga0070678_100934164
874 Ga0070662_100049300
875 Ga0070662_100169725
876 Ga0070681_10053708
877 Ga0068867_100143361
878 Ga0068867_101385144
879 Ga0070685_10046850
880 Ga0070707_100757465
881 Ga0070698_100314929
882 Ga0070698_100506402
883 Ga0070698_100604026
884 Ga0070699_100008170
885 Ga0070699_100295585
886 Ga0070684_101175187
887 Ga0068853_100043005
888 Ga0070672_100109634
889 Ga0070672_100893190
890 Ga0070686_100409077
891 Ga0070696_100048704
892 Ga0070696_100141975
893 Ga0070696_100452102
894 Ga0070693_100012586
895 Ga0070693_100333787
896 Ga0070665_100127983
897 Ga0070665_100159787
898 Ga0070665_100720683
899 Ga0070704_100927169
900 Ga0068855_100069955
901 Ga0068855_100303387
902 Ga0070664_102298041
903 Ga0068857_100120817
904 Ga0068854_100084227
905 Ga0068854_100173640
906 Ga0068856_100233505
907 Ga0070702_100081174
908 Ga0070702_100229711
909 Ga0070702_100383105
910 Ga0068852_101182612
911 Ga0068859_100050609
912 Ga0068859_100061027
913 Ga0068864_100088108
914 Ga0068864_100979896
915 Ga0068866_10151198
916 Ga0068866_10742639
917 Ga0068861_100047084
918 Ga0068861_100330804
919 Ga0068861_100463001
920 Ga0068870_10025971
921 Ga0068870_10049938
922 Ga0068863_100398081
923 Ga0068863_100415957
924 Ga0068863_100497172
925 Ga0068858_100320407
926 Ga0068858_101074751
927 Ga0068862_100218264
928 Ga0068862_100506618
929 Ga0081455_10003576
930 Ga0081455_10006795
931 Ga0081455_10065309
932 Ga0081455_10096538
933 Ga0081540_1000452
934 Ga0081540_1012048
935 Ga0081540_1015298
936 Ga0081540_1015434
937 Ga0081540_1148550
938 Ga0081539_10120709
939 Ga0081539_10238500
940 Ga0070717_10249575
941 Ga0070717_10426297
942 Ga0070717_10973162
943 Ga0075365_10034831
944 Ga0075365_10160773
945 Ga0075365_10332465
946 Ga0075365_11292950
947 Ga0075368_10019597
948 Ga0075368_10031223
949 Ga0075368_10108636
950 Ga0075368_10132851
951 Ga0075363_100000708
952 Ga0075363_100068293
953 Ga0075363_100224723
954 Ga0075364_10287653
955 Ga0075432_10264069
956 Ga0075432_10271200
957 Ga0070715_10052396
958 Ga0070715_10137261
959 Ga0070715_10172838
960 Ga0070715_10614951
961 Ga0070716_100343747
962 Ga0070712_100102648
963 Ga0070712_100114051
964 Ga0070712_100160508
965 Ga0070712_100247208
966 Ga0070712_100774876
967 Ga0075362_10036869
968 Ga0075362_10197773
969 Ga0075362_10586003
970 Ga0075367_10012771
971 Ga0075367_10093240
972 Ga0075367_10620213
973 Ga0075369_10037070
974 Ga0075369_10177791
975 Ga0075366_10082444
976 Ga0075366_10301990
977 Ga0075366_10863045
978 Ga0097621_100115737
979 Ga0097621_100270927
980 Ga0097621_100508886
981 Ga0075370_10059635
982 Ga0075370_10065684
983 Ga0068871_100078395
984 Ga0068871_100105396
985 Ga0068871_100233656
986 Ga0075428_100080986
987 Ga0075428_100125694
988 Ga0075428_100347230
989 Ga0075428_100489543
990 Ga0075428_100684755
991 Ga0075428_102047488
992 Ga0075430_100001022
993 Ga0075430_100063797
994 Ga0075430_101400565
995 Ga0075431_100010545
996 Ga0075431_100077791
997 Ga0075431_100150418
998 Ga0075431_100459519
999 Ga0075433_10029672
1000 Ga0075433_10044777
1001 Ga0075433_10933133
1002 Ga0075434_100001215
1003 Ga0075434_100015591
1004 Ga0075434_100132025
1005 Ga0075434_100994370
1006 Ga0075434_101499553
1007 Ga0075429_100000941
1008 Ga0075429_100878455
1009 Ga0068865_100143914
1010 Ga0075436_100001625
1011 Ga0075436_101001843
1012 Ga0097620_100050607
1013 Ga0097620_100061023
1014 Ga0075435_100037938
1015 Ga0075435_100122823
1016 Ga0075435_100283853
1017 Ga0075435_100461693
1018 Ga0075435_101059256
1019 Ga0075435_101404466
1020 Ga0099794_10441285
1021 Ga0099795_10000063
1022 Ga0111539_10093709
1023 Ga0111539_10122619
1024 Ga0111539_10163413
1025 Ga0111539_10710864
1026 Ga0105245_10015376
1027 Ga0105245_10067584
1028 Ga0105245_10070864
1029 Ga0105245_11267252
1030 Ga0105245_12597743
1031 Ga0105247_10024677
1032 Ga0105247_10188961
1033 Ga0105247_10411578
1034 Ga0114129_10001230
1035 Ga0114129_10039272
1036 Ga0114129_10115916
1037 Ga0114129_11859356
1038 Ga0114129_12331616
1039 Ga0105243_10017714
1040 Ga0105243_10050658
1041 Ga0105243_10072933
1042 Ga0105243_12210899
1043 Ga0105241_10086245
1044 Ga0105241_10522669
1045 Ga0105242_10093533
1046 Ga0105242_10210602
1047 Ga0105242_10239436
1048 Ga0105242_10859494
1049 Ga0105242_10996184
1050 Ga0105248_10045185
1051 Ga0105248_10134392
1052 Ga0105248_10263751
1053 Ga0105248_11308022
1054 Ga0105248_11683662
1055 Ga0105237_10144489
1056 Ga0105237_10651280
1057 Ga0105238_10419713
1058 Ga0105249_10418177
1059 Ga0105249_10568512
1060 Ga0105249_10962571
1061 Ga0099796_10019680
1062 Ga0105239_10392690
1063 Ga0105239_11632974
1064 Ga0105246_10053420
1065 Ga0157337_1018287
1066 Ga0157321_1038893
1067 Ga0157327_1060874
1068 Ga0157373_10882711
1069 Ga0157369_11994271
1070 Ga0157374_10035771
1071 Ga0157374_10177852
1072 Ga0157374_10923587
1073 Ga0157374_11155787
1074 Ga0157378_10015429
1075 Ga0157378_10107367
1076 Ga0157378_11216052
1077 Ga0163162_10135166
1078 Ga0163162_10143080
1079 Ga0163162_10585223
1080 Ga0157372_10087511
1081 Ga0157372_11683529
1082 Ga0157375_10255737
1083 Ga0157375_10719793
1084 Ga0157375_11476638
1085 Ga0163163_10066750
1086 Ga0163163_10408634
1087 Ga0163163_10547598
1088 Ga0163163_11005106
1089 Ga0157380_10135146
1090 Ga0157380_10162268
1091 Ga0157380_11495370
1092 Ga0157379_10028790
1093 Ga0157376_10044204
1094 Ga0157376_10647307
1095 Ga0157376_11024393
1096 Ga0157376_12629958
1097 Ga0182006_1295852
1098 Ga0163161_10320140
1099 Ga0163161_10396309
1100 Ga0197907_11254886
1101 Ga0206356_10895189
1102 Ga0206352_11103349
1103 Ga0206350_10040023
1104 Ga0206354_11352027
1105 Ga0213874_10135199
1106 Ga0228598_1008889
1107 Ga0209758_1056836
1108 Ga0207697_10029871
1109 Ga0207653_10309537
1110 Ga0207682_10085991
1111 Ga0207692_10153304
1112 Ga0207692_10318629
1113 Ga0207692_11091005
1114 Ga0207710_10102720
1115 Ga0207710_10204766
1116 Ga0207688_10053231
1117 Ga0207647_10081814
1118 Ga0207685_10038743
1119 Ga0207685_10117707
1120 Ga0207699_10014301
1121 Ga0207699_10415427
1122 Ga0207699_10429897
1123 Ga0207645_10374495
1124 Ga0207645_10392914
1125 Ga0207643_10106995
1126 Ga0207684_10032665
1127 Ga0207684_10066618
1128 Ga0207684_10261874
1129 Ga0207654_10411077
1130 Ga0207707_10755572
1131 Ga0207693_10051041
1132 Ga0207693_10053524
1133 Ga0207693_10057253
1134 Ga0207693_10227887
1135 Ga0207693_10241951
1136 Ga0207693_11216320
1137 Ga0207663_10044110
1138 Ga0207663_10067700
1139 Ga0207663_10172645
1140 Ga0207663_11703018
1141 Ga0207662_10175103
1142 Ga0207657_10095278
1143 Ga0207657_10800822
1144 Ga0207652_10236483
1145 Ga0207652_10965653
1146 Ga0207646_10516518
1147 Ga0207650_10336750
1148 Ga0207687_10065659
1149 Ga0207687_10138166
1150 Ga0207687_10236275
1151 Ga0207700_10101373
1152 Ga0207700_10189036
1153 Ga0207700_11159021
1154 Ga0207700_11583880
1155 Ga0207664_10084538
1156 Ga0207664_10603261
1157 Ga0207664_10842807
1158 Ga0207690_10087169
1159 Ga0207690_10898953
1160 Ga0207706_10029450
1161 Ga0207706_10085974
1162 Ga0207706_10642520
1163 Ga0207686_10147896
1164 Ga0207686_10447096
1165 Ga0207709_10014669
1166 Ga0207709_10665348
1167 Ga0207669_10307271
1168 Ga0207704_10894924
1169 Ga0207665_10028593
1170 Ga0207665_10122425
1171 Ga0207665_10173084
1172 Ga0207691_10016222
1173 Ga0207711_10734854
1174 Ga0207689_10033448
1175 Ga0207679_10243543
1176 Ga0207651_10077658
1177 Ga0207712_10103177
1178 Ga0207712_10476552
1179 Ga0207712_11269475
1180 Ga0207668_11108581
1181 Ga0207668_11619308
1182 Ga0207658_10322261
1183 Ga0207658_10576945
1184 Ga0207677_10030545
1185 Ga0207677_10112027
1186 Ga0207703_10500226
1187 Ga0207703_11074292
1188 Ga0207703_11259207
1189 Ga0207703_11327457
1190 Ga0207639_10072381
1191 Ga0207678_10013134
1192 Ga0207678_10079604
1193 Ga0207678_10327204
1194 Ga0207708_10155316
1195 Ga0207702_10530239
1196 Ga0207641_10433680
1197 Ga0207641_10687862
1198 Ga0207648_10172489
1199 Ga0207676_10094703
1200 Ga0207676_11527080
1201 Ga0207676_11715760
1202 Ga0207674_10343697
1203 Ga0207675_100085159
1204 Ga0207675_100099979
1205 Ga0207675_100113537
1206 Ga0207675_100210427
1207 Ga0207675_100257690
1208 Ga0207683_10068019
1209 Ga0207683_10102401
1210 Ga0207683_11424434
1211 Ga0207698_11060505
1212 Ga0207698_12497692
1213 Ga0209813_10102334
1214 Ga0209813_10139790
1215 Ga0207428_10000415
1216 Ga0268266_10003949
1217 Ga0268266_10013710
1218 Ga0268266_10017138
1219 Ga0268265_10158788
1220 Ga0268265_10298210
1221 Ga0268265_10605599
1222 Ga0268264_10479050
1223 Ga0307517_10274782
1224 Ga0307517_10412402
1225 Ga0307515_10381402
1226 Ga0307511_10240131
1227 Ga0307513_10455936
1228 Ga0307509_10556339
1229 Ga0307408_100095301
1230 Ga0307406_11979127
1231 Ga0307412_10128694
1232 Ga0307412_11066657
1233 Ga0307416_100839664
1234 Ga0307416_102412085
1235 Ga0307415_100085711
1236 Ga0307415_100322188
1237 Ga0307510_10349234
1238 Ga0373928_0267716
1239 Ga0373929_0018733
1240 Ga0373944_0077382
1241 Ga0373923_0160896
1242 Ga0373923_0198796
1243 Ga0373936_0369142
1244 Ga0373939_0151353
1245 Ga0373945_0060420
1246 Ga0373943_0093809
1247 Ga0373943_0160314
1248 Ga0373943_0196202
1249 Ga0373946_0005476
1250 Ga0373946_0043759
1251 Ga0373962_0311259
1252 Ga0373924_0104998
1253 Ga0373931_1022089
1254 Ga0373935_0073448
1255 Ga0373935_0092147
1256 Ga0373935_1037595
1257 Ga0373935_1309286
1258 Ga0373927_0052873
1259 Ga0373927_0187357
1260 Ga0373927_0703861
1261 Ga0373933_0262430
1262 Ga0373933_0300933
1263 Ga0373947_0105959
1264 Ga0373947_0372454
1265 Ga0373937_0129275
1266 Ga0373937_0262985
1267 Ga0373937_0540339
1268 Ga0373925_0074111
1269 Ga0373925_0282708
1270 Ga0395899_0551241
1271 Ga0395900_0616880
1272 Ga0395898_1042914
1273 Ga0395905_0031705
1274 Ga0436364_1420841
1275 Ga0395901_1537213
1276 Ga0436365_0025969
1277 Ga0436361_0047063
1278 Ga0436361_0610927
1279 Ga0436363_0448624
1280 Ga0439461_0187007
1281 Ga0451839_1121085
1282 Ga0451841_0837473
1283 Ga0451853_4035773
1284 Ga0439442_093481
1285 Ga0439459_0086187
1286 Ga0439440_0072517
1287 Ga0495617_072026
1288 Ga0495627_134681
1289 Ga0495603_0072169
1290 Ga0495603_0431341
1291 Ga0495603_0459954
1292 Ga0495590_0214408
1293 Ga0495629_0037185
1294 Ga0495638_0084089
1295 Ga0495641_0021236
1296 Ga0495641_0338695
1297 Ga0495651_0383975
1298 Ga0495653_0194561
1299 Ga0495580_0106822
1300 Ga0495582_0310154
1301 Ga0495582_0850822
1302 Ga0495605_0215586
1303 Ga0495605_0277169
1304 Ga0495639_0023174
1305 Ga0495639_0290791
1306 Ga0495662_0167557
1307 Ga0495662_0206371
1308 Ga0495662_0446120
1309 Ga0495662_0466417
1310 Ga0495664_0042313
1311 Ga0495664_0124017
1312 Ga0495584_0054430
1313 Ga0495584_0084261
1314 Ga0495584_0184124
1315 Ga0495585_0046448
1316 Ga0495594_0063300
1317 Ga0495594_0512666
1318 Ga0495607_0550522
1319 Ga0495583_0176490
1320 Ga0495606_0063349
1321 Ga0495616_0077073
1322 Ga0495618_0337000
1323 Ga0495620_0067017
1324 Ga0495628_0310957
1325 Ga0495630_0094552
1326 Ga0495630_0163429
1327 Ga0495630_0431525
1328 Ga0495631_0255712
1329 Ga0495632_0318384
1330 Ga0495643_0352827
1331 Ga0495644_0015068
1332 Ga0495666_0047484
1333 Ga0495642_0302768
1334 Ga0495652_0074357
1335 Ga0495665_0235949
1336 Ga0495665_0291941
1337 Ga0495640_0018467
1338 Ga0495640_0165644
1339 Ga0495640_0368664
1340 Ga0495586_0049451
1341 Ga0495598_0070111
1342 Ga0495609_0224240
1343 Ga0495621_0091804
1344 Ga0495645_0045910
1345 Ga0495622_0222349
1346 Ga0495633_0136352
1347 Ga0495667_0189598
1348 Ga0495667_0667553
1349 Ga0495656_0014149
1350 Ga0495656_0024319
1351 Ga0495668_0129696
1352 Ga0495634_0013130
1353 Ga0495634_0064660
1354 Ga0495634_0066757
1355 Ga0495634_0084907
1356 Ga0495611_0240428
1357 Ga0495625_0421106
1358 Ga0495625_0745487
1359 Ga0495635_0145215
1360 Ga0495635_0197958
1361 Ga0495635_0401372
1362 Ga0495588_0285076
1363 Ga0495588_0299610
1364 Ga0495588_0414618
1365 Ga0495599_0349600
1366 Ga0495647_0198777
1367 Ga0495613_0201391
1368 Ga0495613_0243811
1369 Ga0495624_0101062
1370 Ga0495670_0278277
1371 Ga0495589_0186189
1372 Ga0495600_0141531
1373 Ga0495660_0388256
1374 Ga0495581_0354787
1375 Ga0495581_0404270
1376 Ga0495581_0540189
1377 Ga0495674_0027359
1378 Ga0495674_0083828
1379 Ga0495674_0103725
1380 Ga0495674_0328131
1381 Ga0495676_0116127
1382 Ga0495676_0218525
1383 Ga0495676_0825657
1384 Ga0495680_0063409
1385 Ga0495680_0362559
1386 Ga0495683_0207905
1387 Ga0495677_0020738
1388 Ga0495677_0253844
1389 Ga0495673_0154180
1390 Ga0495684_0058018
1391 Ga0495684_0262776
1392 Ga0495686_0215774
1393 Ga0495593_0032164
1394 Ga0495593_0370378
1395 Ga0495614_0448276
1396 Ga0495615_0014847
1397 Ga0496100_0004388
1398 Ga0496100_0121196
1399 Ga0496100_0134325
1400 Ga0496100_0558093
1401 Ga0496101_0015688
1402 Ga0496101_0027203
1403 Ga0496102_0022011
1404 Ga0496102_0023126
1405 Ga0496102_0055534
1406 Ga0496102_0073217
1407 Ga0496102_0140638
1408 Ga0496102_0144090
1409 Ga0496102_0191926
1410 Ga0496102_0230746
1411 Ga0496103_0006839
1412 Ga0496103_0304694
1413 Ga0496103_0459327
1414 Ga0496104_0024394
1415 Ga0496104_0031626
1416 Ga0496104_0045171
1417 Ga0496104_0195139
1418 Ga0496104_0255609
1419 Ga0496105_0018552
1420 Ga0496105_0032234
1421 Ga0496105_0353868
1422 Ga0496105_0593483
1423 Ga0496105_0818484
1424 Ga0496106_0017163
1425 Ga0496106_0130299
1426 Ga0496106_0157855
1427 Ga0496106_0169618
1428 Ga0496106_0270914
1429 Ga0496106_1122278
1430 Ga0496107_0017114
1431 Ga0496107_0102580
1432 Ga0496107_0190518
1433 Ga0496107_0367681
1434 Ga0496108_0017297
1435 Ga0496108_0057564
1436 Ga0496108_0107954
1437 Ga0496108_0194324
1438 Ga0496108_0298228
1439 Ga0496108_0389156
1440 Ga0496108_0906748
1441 Ga0496109_0025024
1442 Ga0496109_0037488
1443 Ga0496109_0136084
1444 Ga0496109_0298706
1445 Ga0496109_0541605
1446 Ga0496110_0053379
1447 Ga0496110_0080826
1448 Ga0496110_0357146
1449 Ga0496110_0505976
1450 Ga0496110_0754555
1451 Ga0496110_0928504
1452 Ga0496111_0015187
1453 Ga0496111_0202154
1454 Ga0496111_0291018
1455 Ga0496112_0032534
1456 Ga0496112_0036880
1457 Ga0496112_0040505
1458 Ga0496112_0071644
1459 Ga0496113_0013254
1460 Ga0496113_0133103
1461 Ga0496113_0147988
1462 Ga0496113_0252807
1463 Ga0496113_0327771
1464 Ga0496113_0840579
1465 Ga0496114_0019446
1466 Ga0496114_0051569
1467 Ga0496114_0151476
1468 Ga0496114_0233160
1469 Ga0496114_0270016
1470 Ga0496114_0323532
1471 Ga0496114_0428559
1472 Ga0496115_0005667
1473 Ga0496115_0070933
1474 Ga0496115_0445896
1475 Ga0496115_1106608
1476 Ga0496116_0275085
1477 Ga0496118_0569283
1478 Ga0496119_0418957
1479 Ga0496121_0202116
1480 Ga0496125_0089142
1481 Ga0496126_0199526
1482 Ga0501038_0130279
1483 Ga0501040_0307363
1484 Ga0501041_0337816
1485 Ga0501041_0410498
1486 Ga0501042_0604064
1487 Ga0501043_0786895
1488 Ga0501046_0887724
1489 Ga0501047_0060515
1490 Ga0501048_0628997
1491 Ga0501048_1197998
1492 Ga0501070_0322895
1493 Ga0501072_0173965
1494 Ga0501074_1075040
1495 Ga0501076_0105976
1496 Ga0501079_0204328
1497 Ga0501080_0561232
1498 Ga0501080_0742059
1499 Ga0501083_0603966
1500 Ga0501035_0692231
1501 Ga0501045_0664619
1502 nmdc:mga03683_85090_c1
1503 nmdc:mga03n38_404198_c1
1504 nmdc:mga03n38_81_c1
1505 nmdc:mga00v17_175612_c1
1506 nmdc:mga0yw44_12481_c1
1507 nmdc:mga0yw44_5734_c1
1508 nmdc:mga0yw44_59949_c1
1509 nmdc:mga0k408_162594_c1
1510 nmdc:mga0k408_184637_c1
1511 nmdc:mga06z11_4118_c1
1512 nmdc:mga06z11_46730_c1
1513 nmdc:mga04h51_295744_c1
1514 nmdc:mga04h51_70264_c1
1515 nmdc:mga07m45_369018_c1
1516 nmdc:mga05p37_1126851_c1
1517 nmdc:mga05p37_116503_c1
1518 nmdc:mga05p37_281_c1
1519 nmdc:mga05p37_59600_c1
1520 nmdc:mga05p37_69762_c2
1521 nmdc:mga05p37_938_c1
1522 nmdc:mga09592_283901_c1
1523 nmdc:mga09592_3312_c1
1524 nmdc:mga0qj67_15384_c1
1525 nmdc:mga0qj67_62361_c1
1526 nmdc:mga06r32_153848_c1
1527 nmdc:mga06r32_30972_c1
1528 nmdc:mga06r32_820831_c1
1529 nmdc:mga08y16_1073174_c1
1530 nmdc:mga08y16_17462_c1
1531 nmdc:mga08y16_30756_c1
1532 nmdc:mga0n895_11553_c1
1533 nmdc:mga0n895_288385_c1
1534 nmdc:mga0n895_63183_c1
1535 nmdc:mga0n895_88398_c1
1536 nmdc:mga0rr50_140457_c1
1537 nmdc:mga0rr50_1850940_c1
1538 nmdc:mga0rr50_6215_c1
1539 nmdc:mga0rr50_96630_c1
1540 nmdc:mga08x19_2436_c1
1541 nmdc:mga0a205_311362_c1
1542 nmdc:mga0a205_439909_c1
1543 nmdc:mga0a205_462201_c1
1544 nmdc:mga0a205_571_c1
1545 nmdc:mga0a205_64981_c1
1546 nmdc:mga0sz30_144276_c1
1547 nmdc:mga0sz30_285208_c1
1548 Ga0495601_0000802
1549 Ga0495601_0192847
1550 Ga0495601_0426809
1551 Ga0495612_0011324
1552 Ga0495595_0589408
1553 Ga0495619_0004945
1554 Ga0495619_0013813
1555 Ga0495619_0220885
1556 Ga0495619_0354430
1557 Ga0495619_0497515
1558 Ga0500578_0210919
1559 Ga0500646_0031243
1560 Ga0500641_0033474
1561 Ga0500555_186288
1562 Ga0500594_0015687
1563 Ga0500597_225077
1564 Ga0500621_158384
1565 Ga0500655_019152
1566 Ga0500577_0049721
1567 Ga0500589_191533
1568 Ga0500616_0024888
1569 Ga0500622_0122172
1570 Ga0500633_0120035
1571 Ga0500634_0036542
1572 Ga0500645_006584
1573 Ga0500645_109368
1574 Ga0500587_076133
1575 Ga0501084_0420027
1576 Ga0587083_0247623
1577 Ga0587090_123830
1578 Ga0587094_123144
1579 Ga0501082_0324327
1580 Ga0530510_0199078
1581 Ga0530510_0306716
1582 2513691888
1583 2524438664
1584 2524465422
1585 2728747842
1586 2745080544
1587 2793077314
1588 2824607574
1589 2824612019
1590 2824657142
1591 2857527264
1592 2874609664
1593 2876814410
1594 2879118468
1595 2888427229
1596 2889040521
1597 2919078381
1598 2922367660
1599 8006997673
1600 8056681459

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

31

83

0.96

PF00571

CBS

CBS domain

97

153

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xkf-assembly2.cif.gz_A crystal structure of hypoxic response protein i (hrpi) with two coordinated zinc ions 0.9209 1 124
1xkf-assembly2.cif.gz_A crystal structure of hypoxic response protein i (hrpi) with two coordinated zinc ions 0.9137 1 124
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9078 2 121
2p9m-assembly1.cif.gz_B crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.9069 1 121
2p9m-assembly2.cif.gz_C crystal structure of conserved hypothetical protein mj0922 from methanocaldococcus jannaschii dsm 2661 0.9051 1 121
ID Description Score Start End Superfamily
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.925 1 121 3.10.580.10
af_Q2FXM2_188_307_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9128 1 121 3.10.580.10
af_P17115_194_318_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9125 1 121 3.10.580.10
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9078 2 121 3.10.580.10
af_Q58332_1_138_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9061 1 121 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A528J1H1-F1-model_v4 CBS domain-containing protein 0.9808 1 115
AF-A0A7V9ZVQ2-F1-model_v4 CBS domain-containing protein 0.9578 1 135
AF-A0A3E0H8D5-F1-model_v4 CBS domain protein 0.9569 1 121
AF-A0A239BSW5-F1-model_v4 CBS domain-containing protein 0.9496 1 138
AF-A0A7K0A424-F1-model_v4 CBS domain-containing protein 0.9487 1 121

Map