F481233
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 797 | 412 | 758 | 422 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10142253|Ga0070666_101422532 |
| Length | 474 |
| Sequence | MSRPMLQCSIMNLSRRRPTDIGDCRLPRADIQGANSVGRRSSQDTPPMIPPRSRTKAIFWTLVLSVVATVLVLAFTGGEKKLDEQVTREYALHDAQYQRSLGVMLGPPITEGNRFEALHNGDRIFPPMLAAIRSARQSITFETYIYWSGDIGRAFADALSERSRAGVKVHVLLDWVGSAKVDEEFVKEMEDAGVQIRKFHKPNWYDITRMNNRTHRKLLVVDGRIGFTGGVGIAPAWTGDAQDAEHWRDSHFKVEGPVVAQMQAVFMDNWIKVSGDVLHGERYFPPIARIGSGRAQMFSSSPSGGSESMHLMYLLSIAAATKSIDLSSAYFVPDDLTVGALVAARQRGVRVRIITPGPIIDSQTVRGASRAAWGPLLEAGAEISEYQPTMFHCKVFTVDGLLVSVGSTNFDNRSFRLNDEANLNIYDEAFAALQTVQFEADLKQSRRITLEGWRERPLTEKALEHLASLLSAQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 2 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 3 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 4 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 7 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 9 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 10 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 11 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 12 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 13 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 14 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 15 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 16 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 17 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 18 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 19 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 20 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 21 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 22 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 23 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 24 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 25 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 26 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 27 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 28 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 29 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 30 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 31 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 32 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 33 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 34 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 35 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 36 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 37 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 38 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 39 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 40 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 41 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 42 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 43 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 44 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 55 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 56 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 66 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 117 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 118 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 156 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 222 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 223 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 225 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 235 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 236 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 247 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 248 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 249 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 250 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 251 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 252 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 253 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 254 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 255 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 256 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 257 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 258 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 259 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 260 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 261 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 262 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 263 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 266 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 267 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 268 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 375 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 380 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 381 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 382 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 383 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 384 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 385 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 386 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 387 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 388 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 390 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 397 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 404 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 405 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 406 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 407 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 409 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 410 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 411 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 412 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.98 |
| Metatranscriptomes | 0.13 |
| Isolates | 4.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.9 |
| Nodule | 1 |
| Rhizoplane | 4.64 |
| Rhizosphere | 79.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10014361 | 3300001979 | Bacteria | 2923 |
| 2 | JGI25156J39149_1000817 | 3300002705 | Bacteria | 15862 |
| 3 | JGI25159J45721_1011057 | 3300002987 | Bacteria | 2242 |
| 4 | JGI25151J46595_10000695 | 3300003187 | Bacteria | 28309 |
| 5 | rootH2_10027177 | 3300003320 | Bacteria | 3574 |
| 6 | rootH2_10072399 | 3300003320 | Bacteria | 1755 |
| 7 | rootL2_10003812 | 3300003322 | Bacteria | 12708 |
| 8 | rootL2_10050965 | 3300003322 | Bacteria | 9047 |
| 9 | rootL2_10229093 | 3300003322 | Bacteria | 3950 |
| 10 | JGI25160J50197_1000284 | 3300003354 | Bacteria | 36681 |
| 11 | Ga0006562J51391_1083712 | 3300003578 | Bacteria | 3760 |
| 12 | Ga0055533_1000104 | 3300003756 | Bacteria | 106505 |
| 13 | Ga0055532_1000003 | 3300003758 | Bacteria | 494004 |
| 14 | Ga0055525_1000081 | 3300003759 | Bacteria | 161329 |
| 15 | Ga0055527_1000006 | 3300003760 | Bacteria | 494004 |
| 16 | Ga0055535_1000003 | 3300003761 | Bacteria | 494004 |
| 17 | Ga0055535_1005347 | 3300003761 | Bacteria | 2841 |
| 18 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 19 | Ga0055542_1000007 | 3300003762 | Bacteria | 494004 |
| 20 | Ga0055529_1000003 | 3300003763 | Bacteria | 494004 |
| 21 | Ga0055526_1004027 | 3300003771 | Bacteria | 9030 |
| 22 | Ga0055536_1000311 | 3300003781 | Bacteria | 36625 |
| 23 | Ga0055534_1000122 | 3300003784 | Bacteria | 57847 |
| 24 | Ga0065165_1002073 | 3300005262 | Bacteria | 18437 |
| 25 | Ga0065165_1021691 | 3300005262 | Bacteria | 2223 |
| 26 | Ga0065714_10084178 | 3300005288 | Bacteria | 2212 |
| 27 | Ga0065704_10154625 | 3300005289 | Bacteria | 1401 |
| 28 | Ga0065715_10027957 | 3300005293 | Bacteria | 1551 |
| 29 | Ga0065707_10102580 | 3300005295 | Bacteria | 2797 |
| 30 | Ga0070658_10102832 | 3300005327 | Bacteria | 2363 |
| 31 | Ga0070658_10196924 | 3300005327 | Bacteria | 1699 |
| 32 | Ga0070676_10003180 | 3300005328 | Bacteria | 8509 |
| 33 | Ga0070683_100016319 | 3300005329 | Bacteria | 6548 |
| 34 | Ga0070683_100073389 | 3300005329 | Bacteria | 3195 |
| 35 | Ga0070690_100016783 | 3300005330 | Bacteria | 4394 |
| 36 | Ga0070690_100114862 | 3300005330 | Bacteria | 1801 |
| 37 | Ga0070670_100008481 | 3300005331 | Bacteria | 8765 |
| 38 | Ga0070670_100027500 | 3300005331 | Bacteria | 4892 |
| 39 | Ga0070670_100141349 | 3300005331 | Bacteria | 2082 |
| 40 | Ga0070677_10002361 | 3300005333 | Bacteria | 6032 |
| 41 | Ga0068869_100041629 | 3300005334 | Bacteria | 3291 |
| 42 | Ga0068869_100047125 | 3300005334 | Bacteria | 3112 |
| 43 | Ga0068869_100071431 | 3300005334 | Bacteria | 2570 |
| 44 | Ga0070666_10022166 | 3300005335 | Bacteria | 4123 |
| 45 | Ga0070666_10081654 | 3300005335 | Bacteria | 2210 |
| 46 | Ga0070666_10142253 | 3300005335 | Bacteria | 1671 |
| 47 | Ga0068868_100006737 | 3300005338 | Bacteria | 8157 |
| 48 | Ga0068868_100036751 | 3300005338 | Bacteria | 3794 |
| 49 | Ga0070689_100052468 | 3300005340 | Bacteria | 3154 |
| 50 | Ga0070661_100005733 | 3300005344 | Bacteria | 8559 |
| 51 | Ga0070661_100020175 | 3300005344 | Bacteria | 4752 |
| 52 | Ga0070661_100114766 | 3300005344 | Bacteria | 2014 |
| 53 | Ga0070668_100000690 | 3300005347 | Bacteria | 23000 |
| 54 | Ga0070669_100007962 | 3300005353 | Bacteria | 7568 |
| 55 | Ga0070675_100003131 | 3300005354 | Bacteria | 12512 |
| 56 | Ga0070675_100008750 | 3300005354 | Bacteria | 7864 |
| 57 | Ga0070675_100033538 | 3300005354 | Bacteria | 4163 |
| 58 | Ga0070675_100067216 | 3300005354 | Bacteria | 2966 |
| 59 | Ga0070675_100100919 | 3300005354 | Bacteria | 2430 |
| 60 | Ga0070675_100201977 | 3300005354 | Bacteria | 1725 |
| 61 | Ga0070671_100006234 | 3300005355 | Bacteria | 9501 |
| 62 | Ga0070671_100013088 | 3300005355 | Bacteria | 6685 |
| 63 | Ga0070671_100062343 | 3300005355 | Bacteria | 3105 |
| 64 | Ga0070674_100058263 | 3300005356 | Bacteria | 2684 |
| 65 | Ga0070673_100045968 | 3300005364 | Bacteria | 3389 |
| 66 | Ga0070673_100076727 | 3300005364 | Bacteria | 2699 |
| 67 | Ga0070673_100241587 | 3300005364 | Bacteria | 1570 |
| 68 | Ga0070688_100005610 | 3300005365 | Bacteria | 6622 |
| 69 | Ga0070667_100027282 | 3300005367 | Bacteria | 4752 |
| 70 | Ga0070667_100046717 | 3300005367 | Bacteria | 3643 |
| 71 | Ga0070714_100017632 | 3300005435 | Bacteria | 5787 |
| 72 | Ga0070700_100013454 | 3300005441 | Bacteria | 4596 |
| 73 | Ga0070663_100044327 | 3300005455 | Bacteria | 3135 |
| 74 | Ga0070678_100213830 | 3300005456 | Bacteria | 1599 |
| 75 | Ga0070662_100143323 | 3300005457 | Bacteria | 1854 |
| 76 | Ga0068867_100002311 | 3300005459 | Bacteria | 13412 |
| 77 | Ga0068867_100175642 | 3300005459 | Bacteria | 1699 |
| 78 | Ga0068867_100185725 | 3300005459 | Bacteria | 1656 |
| 79 | Ga0068867_100201238 | 3300005459 | Bacteria | 1594 |
| 80 | Ga0070698_100011813 | 3300005471 | Bacteria | 9267 |
| 81 | Ga0068853_100145314 | 3300005539 | Bacteria | 2131 |
| 82 | Ga0070672_100011658 | 3300005543 | Bacteria | 6137 |
| 83 | Ga0070672_100045038 | 3300005543 | Bacteria | 3410 |
| 84 | Ga0070693_100003577 | 3300005547 | Bacteria | 7252 |
| 85 | Ga0070693_100111353 | 3300005547 | Bacteria | 1684 |
| 86 | Ga0070665_100114259 | 3300005548 | Bacteria | 2702 |
| 87 | Ga0070704_100003754 | 3300005549 | Bacteria | 8745 |
| 88 | Ga0070704_100167852 | 3300005549 | Bacteria | 1742 |
| 89 | Ga0068855_100020707 | 3300005563 | Bacteria | 7887 |
| 90 | Ga0068855_100023836 | 3300005563 | Bacteria | 7331 |
| 91 | Ga0068855_100065592 | 3300005563 | Bacteria | 4233 |
| 92 | Ga0070664_100009052 | 3300005564 | Bacteria | 8078 |
| 93 | Ga0070664_100019005 | 3300005564 | Bacteria | 5650 |
| 94 | Ga0070664_100022410 | 3300005564 | Bacteria | 5207 |
| 95 | Ga0068857_100001323 | 3300005577 | Bacteria | 19468 |
| 96 | Ga0068857_100039610 | 3300005577 | Bacteria | 4175 |
| 97 | Ga0068857_100156892 | 3300005577 | Bacteria | 2064 |
| 98 | Ga0068854_100008729 | 3300005578 | Bacteria | 6523 |
| 99 | Ga0068856_100002037 | 3300005614 | Bacteria | 20987 |
| 100 | Ga0068852_100001203 | 3300005616 | Bacteria | 17184 |
| 101 | Ga0068852_100010271 | 3300005616 | Bacteria | 6985 |
| 102 | Ga0068852_100037047 | 3300005616 | Bacteria | 4088 |
| 103 | Ga0068859_100001157 | 3300005617 | Bacteria | 26939 |
| 104 | Ga0068859_100033940 | 3300005617 | Bacteria | 5123 |
| 105 | Ga0068859_100036035 | 3300005617 | Bacteria | 4965 |
| 106 | Ga0068859_100042745 | 3300005617 | Bacteria | 4552 |
| 107 | Ga0068859_100121205 | 3300005617 | Bacteria | 2682 |
| 108 | Ga0068859_100175348 | 3300005617 | Bacteria | 2226 |
| 109 | Ga0068864_100000432 | 3300005618 | Bacteria | 36300 |
| 110 | Ga0068864_100011633 | 3300005618 | Bacteria | 7267 |
| 111 | Ga0068864_100195970 | 3300005618 | Bacteria | 1853 |
| 112 | Ga0068866_10077396 | 3300005718 | Bacteria | 1776 |
| 113 | Ga0068861_100084734 | 3300005719 | Bacteria | 2489 |
| 114 | Ga0068851_10001660 | 3300005834 | Bacteria | 9750 |
| 115 | Ga0068851_10009554 | 3300005834 | Bacteria | 4514 |
| 116 | Ga0068851_10016048 | 3300005834 | Bacteria | 3578 |
| 117 | Ga0068870_10054364 | 3300005840 | Bacteria | 2129 |
| 118 | Ga0068870_10077819 | 3300005840 | Bacteria | 1825 |
| 119 | Ga0068863_100003841 | 3300005841 | Bacteria | 14856 |
| 120 | Ga0068863_100021826 | 3300005841 | Bacteria | 6109 |
| 121 | Ga0068863_100051848 | 3300005841 | Bacteria | 3888 |
| 122 | Ga0068863_100139114 | 3300005841 | Bacteria | 2320 |
| 123 | Ga0068858_100023855 | 3300005842 | Bacteria | 5699 |
| 124 | Ga0068858_100027380 | 3300005842 | Bacteria | 5296 |
| 125 | Ga0068858_100045414 | 3300005842 | Bacteria | 4071 |
| 126 | Ga0068860_100106666 | 3300005843 | Bacteria | 2676 |
| 127 | Ga0068862_100014905 | 3300005844 | Bacteria | 6457 |
| 128 | Ga0068862_100028911 | 3300005844 | Bacteria | 4669 |
| 129 | Ga0068862_100255010 | 3300005844 | Bacteria | 1600 |
| 130 | Ga0081539_10003666 | 3300005985 | Bacteria | 18444 |
| 131 | Ga0075363_100091824 | 3300006048 | Bacteria | 1672 |
| 132 | Ga0075432_10016023 | 3300006058 | Bacteria | 2559 |
| 133 | Ga0075362_10015066 | 3300006177 | Bacteria | 3137 |
| 134 | Ga0075362_10043920 | 3300006177 | Bacteria | 1980 |
| 135 | Ga0075369_10011318 | 3300006186 | Bacteria | 3509 |
| 136 | Ga0097621_100104451 | 3300006237 | Bacteria | 2387 |
| 137 | Ga0097621_100199374 | 3300006237 | Bacteria | 1737 |
| 138 | Ga0075370_10000078 | 3300006353 | Bacteria | 29531 |
| 139 | Ga0075370_10001330 | 3300006353 | Bacteria | 10606 |
| 140 | Ga0075370_10016805 | 3300006353 | Bacteria | 3942 |
| 141 | Ga0068871_100036096 | 3300006358 | Bacteria | 3933 |
| 142 | Ga0068871_100039244 | 3300006358 | Bacteria | 3787 |
| 143 | Ga0075428_100005190 | 3300006844 | Bacteria | 14466 |
| 144 | Ga0075430_100015096 | 3300006846 | Bacteria | 6574 |
| 145 | Ga0075429_100105785 | 3300006880 | Bacteria | 2458 |
| 146 | Ga0068865_100034173 | 3300006881 | Bacteria | 3410 |
| 147 | Ga0097620_100001157 | 3300006931 | Bacteria | 26939 |
| 148 | Ga0097620_100033938 | 3300006931 | Bacteria | 5123 |
| 149 | Ga0097620_100036036 | 3300006931 | Bacteria | 4965 |
| 150 | Ga0097620_100042744 | 3300006931 | Bacteria | 4552 |
| 151 | Ga0097620_100121207 | 3300006931 | Bacteria | 2682 |
| 152 | Ga0097620_100175345 | 3300006931 | Bacteria | 2226 |
| 153 | Ga0105240_10002223 | 3300009093 | Bacteria | 31573 |
| 154 | Ga0105240_10013577 | 3300009093 | Bacteria | 11179 |
| 155 | Ga0105240_10034345 | 3300009093 | Bacteria | 6542 |
| 156 | Ga0105240_10324486 | 3300009093 | Bacteria | 1754 |
| 157 | Ga0111539_10004782 | 3300009094 | Bacteria | 17670 |
| 158 | Ga0111539_10022189 | 3300009094 | Bacteria | 7804 |
| 159 | Ga0111539_10037225 | 3300009094 | Bacteria | 5878 |
| 160 | Ga0111539_10425792 | 3300009094 | Bacteria | 1546 |
| 161 | Ga0105245_10025899 | 3300009098 | Bacteria | 5159 |
| 162 | Ga0105245_10075167 | 3300009098 | Bacteria | 3076 |
| 163 | Ga0114129_10037773 | 3300009147 | Bacteria | 6815 |
| 164 | Ga0114129_10339812 | 3300009147 | Bacteria | 1992 |
| 165 | Ga0114129_10478489 | 3300009147 | Bacteria | 1630 |
| 166 | Ga0105243_10008685 | 3300009148 | Bacteria | 7789 |
| 167 | Ga0105243_10020229 | 3300009148 | Bacteria | 5047 |
| 168 | Ga0105243_10073832 | 3300009148 | Bacteria | 2765 |
| 169 | Ga0105243_10156934 | 3300009148 | Bacteria | 1958 |
| 170 | Ga0105243_10158812 | 3300009148 | Bacteria | 1947 |
| 171 | Ga0105241_10021547 | 3300009174 | Bacteria | 4766 |
| 172 | Ga0105241_10024317 | 3300009174 | Bacteria | 4498 |
| 173 | Ga0105242_10002231 | 3300009176 | Bacteria | 15286 |
| 174 | Ga0105242_10003323 | 3300009176 | Bacteria | 12514 |
| 175 | Ga0105242_10014279 | 3300009176 | Bacteria | 6152 |
| 176 | Ga0105242_10181326 | 3300009176 | Bacteria | 1858 |
| 177 | Ga0105242_10251145 | 3300009176 | Bacteria | 1594 |
| 178 | Ga0105248_10020065 | 3300009177 | Bacteria | 7402 |
| 179 | Ga0105248_10060209 | 3300009177 | Bacteria | 4263 |
| 180 | Ga0105248_10067706 | 3300009177 | Bacteria | 4009 |
| 181 | Ga0105248_10249680 | 3300009177 | Bacteria | 1997 |
| 182 | Ga0105237_10000373 | 3300009545 | Bacteria | 63672 |
| 183 | Ga0105237_10067780 | 3300009545 | Bacteria | 3562 |
| 184 | Ga0105238_10007050 | 3300009551 | Bacteria | 11239 |
| 185 | Ga0105238_10010414 | 3300009551 | Bacteria | 9334 |
| 186 | Ga0105239_10007855 | 3300010375 | Bacteria | 12196 |
| 187 | Ga0105239_10027359 | 3300010375 | Bacteria | 6277 |
| 188 | Ga0105246_10005667 | 3300011119 | Bacteria | 7620 |
| 189 | Ga0105246_10216083 | 3300011119 | Bacteria | 1500 |
| 190 | Ga0157373_10025982 | 3300013100 | Bacteria | 4231 |
| 191 | Ga0157371_10023628 | 3300013102 | Bacteria | 4496 |
| 192 | Ga0157371_10062249 | 3300013102 | Bacteria | 2645 |
| 193 | Ga0157370_10145322 | 3300013104 | Bacteria | 2209 |
| 194 | Ga0157370_10199081 | 3300013104 | Bacteria | 1858 |
| 195 | Ga0157369_10011382 | 3300013105 | Bacteria | 10102 |
| 196 | Ga0157369_10015394 | 3300013105 | Bacteria | 8623 |
| 197 | Ga0157369_10043206 | 3300013105 | Bacteria | 4913 |
| 198 | Ga0157369_10115690 | 3300013105 | Bacteria | 2848 |
| 199 | Ga0157378_10037143 | 3300013297 | Bacteria | 4314 |
| 200 | Ga0157378_10052405 | 3300013297 | Bacteria | 3631 |
| 201 | Ga0163162_10028692 | 3300013306 | Bacteria | 5508 |
| 202 | Ga0157372_10008220 | 3300013307 | Bacteria | 11089 |
| 203 | Ga0157372_10147093 | 3300013307 | Unclassified | 2717 |
| 204 | Ga0157372_10220896 | 3300013307 | Bacteria | 2196 |
| 205 | Ga0157375_10009659 | 3300013308 | Bacteria | 8481 |
| 206 | Ga0157375_10026803 | 3300013308 | Bacteria | 5378 |
| 207 | Ga0157375_10060881 | 3300013308 | Bacteria | 3746 |
| 208 | Ga0163163_10006631 | 3300014325 | Bacteria | 10141 |
| 209 | Ga0163163_10007305 | 3300014325 | Bacteria | 9743 |
| 210 | Ga0157380_10030503 | 3300014326 | Bacteria | 4130 |
| 211 | Ga0182008_10000669 | 3300014497 | Bacteria | 24850 |
| 212 | Ga0182008_10002058 | 3300014497 | Bacteria | 12882 |
| 213 | Ga0182008_10004332 | 3300014497 | Bacteria | 8303 |
| 214 | Ga0157379_10006277 | 3300014968 | Bacteria | 10237 |
| 215 | Ga0157379_10232763 | 3300014968 | Bacteria | 1670 |
| 216 | Ga0182007_10001253 | 3300015262 | Bacteria | 13797 |
| 217 | Ga0182007_10027555 | 3300015262 | Bacteria | 1958 |
| 218 | Ga0183361_10006 | 3300016635 | Bacteria | 368532 |
| 219 | Ga0163161_10000117 | 3300017792 | Bacteria | 75699 |
| 220 | Ga0163161_10004592 | 3300017792 | Bacteria | 9610 |
| 221 | Ga0163161_10037759 | 3300017792 | Bacteria | 3463 |
| 222 | Ga0163161_10078831 | 3300017792 | Bacteria | 2421 |
| 223 | Ga0163161_10100253 | 3300017792 | Bacteria | 2155 |
| 224 | Ga0163161_10102846 | 3300017792 | Bacteria | 2128 |
| 225 | Ga0213876_10029348 | 3300021384 | Bacteria | 2898 |
| 226 | Ga0209674_100025 | 3300025226 | Bacteria | 515942 |
| 227 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 228 | Ga0209672_100709 | 3300025228 | Bacteria | 16591 |
| 229 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 230 | Ga0209147_100791 | 3300025229 | Bacteria | 15333 |
| 231 | Ga0209563_100015 | 3300025230 | Bacteria | 879901 |
| 232 | Ga0209563_101042 | 3300025230 | Bacteria | 8019 |
| 233 | Ga0207427_101164 | 3300025231 | Bacteria | 10275 |
| 234 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 235 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 236 | Ga0207425_1000635 | 3300025245 | Bacteria | 19836 |
| 237 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 238 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 239 | Ga0209148_1000413 | 3300025254 | Bacteria | 48939 |
| 240 | Ga0209759_1000014 | 3300025256 | Bacteria | 396291 |
| 241 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 242 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 243 | Ga0209130_1004806 | 3300025284 | Bacteria | 4960 |
| 244 | Ga0209130_1015288 | 3300025284 | Bacteria | 1896 |
| 245 | Ga0209675_1000120 | 3300025291 | Bacteria | 108551 |
| 246 | Ga0209676_1000918 | 3300025292 | Bacteria | 36677 |
| 247 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 248 | Ga0209025_1000102 | 3300025294 | Bacteria | 228393 |
| 249 | Ga0209025_1001195 | 3300025294 | Bacteria | 36677 |
| 250 | Ga0209564_1000982 | 3300025295 | Bacteria | 35839 |
| 251 | Ga0209564_1002345 | 3300025295 | Bacteria | 15292 |
| 252 | Ga0209758_1008239 | 3300025297 | Bacteria | 6824 |
| 253 | Ga0209050_1008771 | 3300025298 | Bacteria | 5315 |
| 254 | Ga0207426_1000737 | 3300025302 | Bacteria | 37388 |
| 255 | Ga0207426_1010023 | 3300025302 | Bacteria | 3707 |
| 256 | Ga0207656_10013430 | 3300025321 | Bacteria | 3131 |
| 257 | Ga0207656_10055245 | 3300025321 | Bacteria | 1728 |
| 258 | Ga0207682_10000677 | 3300025893 | Bacteria | 15860 |
| 259 | Ga0207642_10015711 | 3300025899 | Bacteria | 2830 |
| 260 | Ga0207688_10029342 | 3300025901 | Bacteria | 3028 |
| 261 | Ga0207680_10004782 | 3300025903 | Bacteria | 6448 |
| 262 | Ga0207645_10137757 | 3300025907 | Bacteria | 1590 |
| 263 | Ga0207643_10035712 | 3300025908 | Bacteria | 2788 |
| 264 | Ga0207705_10046473 | 3300025909 | Bacteria | 3120 |
| 265 | Ga0207705_10179559 | 3300025909 | Bacteria | 1597 |
| 266 | Ga0207654_10004080 | 3300025911 | Bacteria | 7358 |
| 267 | Ga0207695_10018467 | 3300025913 | Bacteria | 8064 |
| 268 | Ga0207671_10006670 | 3300025914 | Bacteria | 10228 |
| 269 | Ga0207660_10084349 | 3300025917 | Bacteria | 2342 |
| 270 | Ga0207662_10066090 | 3300025918 | Bacteria | 2179 |
| 271 | Ga0207657_10004403 | 3300025919 | Bacteria | 14895 |
| 272 | Ga0207649_10010572 | 3300025920 | Bacteria | 5076 |
| 273 | Ga0207649_10012209 | 3300025920 | Bacteria | 4757 |
| 274 | Ga0207650_10005355 | 3300025925 | Bacteria | 8752 |
| 275 | Ga0207650_10021295 | 3300025925 | Bacteria | 4582 |
| 276 | Ga0207650_10052406 | 3300025925 | Bacteria | 3022 |
| 277 | Ga0207650_10182815 | 3300025925 | Bacteria | 1672 |
| 278 | Ga0207659_10001257 | 3300025926 | Bacteria | 15167 |
| 279 | Ga0207659_10038396 | 3300025926 | Bacteria | 3331 |
| 280 | Ga0207659_10083917 | 3300025926 | Bacteria | 2363 |
| 281 | Ga0207659_10212884 | 3300025926 | Bacteria | 1550 |
| 282 | Ga0207687_10039884 | 3300025927 | Bacteria | 3217 |
| 283 | Ga0207687_10102355 | 3300025927 | Bacteria | 2110 |
| 284 | Ga0207664_10009160 | 3300025929 | Bacteria | 6938 |
| 285 | Ga0207644_10003508 | 3300025931 | Bacteria | 10153 |
| 286 | Ga0207644_10026722 | 3300025931 | Bacteria | 3981 |
| 287 | Ga0207644_10137580 | 3300025931 | Bacteria | 1877 |
| 288 | Ga0207690_10014969 | 3300025932 | Bacteria | 4697 |
| 289 | Ga0207706_10030537 | 3300025933 | Bacteria | 4807 |
| 290 | Ga0207706_10036810 | 3300025933 | Bacteria | 4347 |
| 291 | Ga0207706_10049363 | 3300025933 | Bacteria | 3719 |
| 292 | Ga0207706_10061044 | 3300025933 | Bacteria | 3320 |
| 293 | Ga0207686_10004796 | 3300025934 | Bacteria | 7259 |
| 294 | Ga0207686_10008036 | 3300025934 | Bacteria | 5692 |
| 295 | Ga0207686_10030105 | 3300025934 | Bacteria | 3210 |
| 296 | Ga0207709_10064594 | 3300025935 | Bacteria | 2299 |
| 297 | Ga0207709_10095786 | 3300025935 | Bacteria | 1951 |
| 298 | Ga0207670_10051788 | 3300025936 | Bacteria | 2759 |
| 299 | Ga0207670_10180804 | 3300025936 | Bacteria | 1588 |
| 300 | Ga0207669_10009370 | 3300025937 | Bacteria | 4659 |
| 301 | Ga0207669_10015234 | 3300025937 | Bacteria | 3873 |
| 302 | Ga0207704_10029962 | 3300025938 | Bacteria | 3044 |
| 303 | Ga0207704_10085452 | 3300025938 | Bacteria | 2054 |
| 304 | Ga0207704_10130213 | 3300025938 | Bacteria | 1741 |
| 305 | Ga0207691_10007030 | 3300025940 | Bacteria | 10858 |
| 306 | Ga0207691_10268096 | 3300025940 | Bacteria | 1471 |
| 307 | Ga0207711_10022297 | 3300025941 | Bacteria | 5294 |
| 308 | Ga0207711_10023504 | 3300025941 | Bacteria | 5159 |
| 309 | Ga0207711_10235859 | 3300025941 | Bacteria | 1676 |
| 310 | Ga0207689_10008236 | 3300025942 | Bacteria | 9082 |
| 311 | Ga0207689_10036416 | 3300025942 | Bacteria | 4086 |
| 312 | Ga0207689_10067944 | 3300025942 | Bacteria | 2929 |
| 313 | Ga0207689_10069755 | 3300025942 | Bacteria | 2888 |
| 314 | Ga0207689_10121572 | 3300025942 | Bacteria | 2147 |
| 315 | Ga0207661_10023282 | 3300025944 | Bacteria | 4678 |
| 316 | Ga0207679_10009197 | 3300025945 | Bacteria | 6317 |
| 317 | Ga0207667_10015769 | 3300025949 | Bacteria | 8568 |
| 318 | Ga0207667_10038166 | 3300025949 | Bacteria | 5131 |
| 319 | Ga0207667_10179760 | 3300025949 | Bacteria | 2173 |
| 320 | Ga0207651_10216223 | 3300025960 | Bacteria | 1546 |
| 321 | Ga0207651_10293909 | 3300025960 | Bacteria | 1348 |
| 322 | Ga0207668_10010104 | 3300025972 | Bacteria | 5688 |
| 323 | Ga0207668_10023525 | 3300025972 | Bacteria | 3962 |
| 324 | Ga0207658_10012117 | 3300025986 | Bacteria | 5880 |
| 325 | Ga0207658_10012437 | 3300025986 | Bacteria | 5815 |
| 326 | Ga0207677_10003447 | 3300026023 | Bacteria | 8382 |
| 327 | Ga0207677_10256746 | 3300026023 | Bacteria | 1422 |
| 328 | Ga0207703_10010387 | 3300026035 | Bacteria | 7283 |
| 329 | Ga0207703_10021334 | 3300026035 | Bacteria | 5071 |
| 330 | Ga0207703_10044045 | 3300026035 | Bacteria | 3584 |
| 331 | Ga0207703_10053603 | 3300026035 | Bacteria | 3278 |
| 332 | Ga0207703_10205623 | 3300026035 | Bacteria | 1752 |
| 333 | Ga0207639_10051558 | 3300026041 | Bacteria | 3130 |
| 334 | Ga0207678_10068085 | 3300026067 | Bacteria | 3055 |
| 335 | Ga0207708_10002375 | 3300026075 | Bacteria | 13829 |
| 336 | Ga0207702_10019314 | 3300026078 | Bacteria | 5638 |
| 337 | Ga0207702_10096428 | 3300026078 | Bacteria | 2601 |
| 338 | Ga0207641_10006864 | 3300026088 | Bacteria | 9527 |
| 339 | Ga0207641_10045855 | 3300026088 | Bacteria | 3683 |
| 340 | Ga0207648_10004518 | 3300026089 | Bacteria | 14261 |
| 341 | Ga0207648_10006030 | 3300026089 | Bacteria | 12086 |
| 342 | Ga0207648_10010427 | 3300026089 | Bacteria | 8806 |
| 343 | Ga0207648_10097865 | 3300026089 | Bacteria | 2568 |
| 344 | Ga0207648_10223160 | 3300026089 | Bacteria | 1675 |
| 345 | Ga0207676_10000825 | 3300026095 | Bacteria | 24199 |
| 346 | Ga0207676_10016097 | 3300026095 | Bacteria | 5409 |
| 347 | Ga0207676_10031805 | 3300026095 | Bacteria | 3970 |
| 348 | Ga0207674_10000040 | 3300026116 | Bacteria | 130571 |
| 349 | Ga0207674_10008453 | 3300026116 | Bacteria | 11889 |
| 350 | Ga0207674_10028584 | 3300026116 | Bacteria | 5882 |
| 351 | Ga0207675_100019900 | 3300026118 | Bacteria | 6265 |
| 352 | Ga0207675_100031263 | 3300026118 | Bacteria | 4959 |
| 353 | Ga0207675_100049298 | 3300026118 | Bacteria | 3931 |
| 354 | Ga0207675_100071972 | 3300026118 | Bacteria | 3233 |
| 355 | Ga0207675_100233694 | 3300026118 | Bacteria | 1774 |
| 356 | Ga0207683_10014465 | 3300026121 | Bacteria | 6718 |
| 357 | Ga0207683_10038409 | 3300026121 | Bacteria | 4173 |
| 358 | Ga0207683_10051858 | 3300026121 | Bacteria | 3594 |
| 359 | Ga0207683_10059246 | 3300026121 | Bacteria | 3364 |
| 360 | Ga0207683_10232189 | 3300026121 | Bacteria | 1683 |
| 361 | Ga0207698_10009113 | 3300026142 | Bacteria | 6306 |
| 362 | Ga0207698_10016948 | 3300026142 | Bacteria | 4929 |
| 363 | Ga0207698_10032211 | 3300026142 | Bacteria | 3794 |
| 364 | Ga0209974_10003857 | 3300027876 | Bacteria | 5372 |
| 365 | Ga0207428_10048780 | 3300027907 | Bacteria | 3395 |
| 366 | Ga0268266_10151459 | 3300028379 | Bacteria | 2091 |
| 367 | Ga0268265_10042827 | 3300028380 | Bacteria | 3362 |
| 368 | Ga0268265_10106495 | 3300028380 | Bacteria | 2278 |
| 369 | Ga0268265_10186240 | 3300028380 | Bacteria | 1788 |
| 370 | Ga0265318_10010305 | 3300028577 | Bacteria | 4075 |
| 371 | Ga0265336_10001755 | 3300028666 | Bacteria | 9510 |
| 372 | Ga0307517_10022697 | 3300028786 | Bacteria | 7850 |
| 373 | Ga0307515_10000873 | 3300028794 | Bacteria | 69237 |
| 374 | Ga0265338_10004084 | 3300028800 | Bacteria | 19993 |
| 375 | Ga0265324_10008934 | 3300029957 | Bacteria | 3943 |
| 376 | Ga0265320_10012959 | 3300031240 | Bacteria | 4818 |
| 377 | Ga0265327_10005921 | 3300031251 | Bacteria | 9985 |
| 378 | Ga0265316_10014355 | 3300031344 | Bacteria | 6976 |
| 379 | Ga0307509_10000362 | 3300031507 | Bacteria | 76407 |
| 380 | Ga0265314_10003034 | 3300031711 | Bacteria | 16588 |
| 381 | Ga0307405_10016521 | 3300031731 | Bacteria | 4027 |
| 382 | Ga0307410_10008845 | 3300031852 | Bacteria | 5614 |
| 383 | Ga0307406_10013812 | 3300031901 | Bacteria | 4634 |
| 384 | Ga0307412_10099696 | 3300031911 | Bacteria | 2052 |
| 385 | Ga0307409_100015210 | 3300031995 | Bacteria | 5040 |
| 386 | Ga0307409_100102200 | 3300031995 | Bacteria | 2381 |
| 387 | Ga0307416_100003413 | 3300032002 | Bacteria | 9324 |
| 388 | Ga0307414_10040091 | 3300032004 | Bacteria | 3160 |
| 389 | Ga0307411_10007310 | 3300032005 | Bacteria | 5611 |
| 390 | Ga0307411_10028997 | 3300032005 | Bacteria | 3373 |
| 391 | Ga0307411_10074613 | 3300032005 | Bacteria | 2312 |
| 392 | Ga0307415_100043205 | 3300032126 | Bacteria | 3005 |
| 393 | Ga0307415_100070129 | 3300032126 | Bacteria | 2460 |
| 394 | Ga0373927_0070937 | 3300035695 | Bacteria | 2255 |
| 395 | Ga0373925_0053742 | 3300037068 | Bacteria | 3012 |
| 396 | Ga0395899_0003672 | 3300037312 | Bacteria | 12148 |
| 397 | Ga0395899_0057041 | 3300037312 | Bacteria | 2884 |
| 398 | Ga0395900_0000532 | 3300037418 | Bacteria | 53751 |
| 399 | Ga0395900_0011395 | 3300037418 | Bacteria | 9100 |
| 400 | Ga0395898_0133661 | 3300037466 | Bacteria | 2375 |
| 401 | Ga0395898_0198431 | 3300037466 | Bacteria | 1916 |
| 402 | Ga0395898_0258587 | 3300037466 | Bacteria | 1660 |
| 403 | Ga0395905_0000076 | 3300037471 | Bacteria | 164190 |
| 404 | Ga0395905_0026610 | 3300037471 | Bacteria | 5454 |
| 405 | Ga0395905_0047612 | 3300037471 | Bacteria | 4017 |
| 406 | Ga0395905_0052012 | 3300037471 | Bacteria | 3836 |
| 407 | Ga0395905_0091400 | 3300037471 | Bacteria | 2854 |
| 408 | Ga0395905_0132695 | 3300037471 | Bacteria | 2342 |
| 409 | Ga0395905_0169701 | 3300037471 | Bacteria | 2049 |
| 410 | Ga0395905_0238178 | 3300037471 | Bacteria | 1701 |
| 411 | Ga0395901_0000765 | 3300038443 | Bacteria | 36025 |
| 412 | Ga0395901_0002180 | 3300038443 | Bacteria | 19989 |
| 413 | Ga0395901_0010811 | 3300038443 | Bacteria | 9250 |
| 414 | Ga0395901_0150421 | 3300038443 | Bacteria | 2446 |
| 415 | Ga0395901_0212631 | 3300038443 | Bacteria | 2023 |
| 416 | Ga0436365_1875695 | 3300039437 | Bacteria | 4743 |
| 417 | Ga0439436_0002503 | 3300041404 | Bacteria | 5527 |
| 418 | Ga0439461_0002679 | 3300041410 | Bacteria | 2873 |
| 419 | Ga0439466_0004282 | 3300041411 | Bacteria | 5511 |
| 420 | Ga0439465_0001337 | 3300041413 | Bacteria | 7919 |
| 421 | Ga0439431_0002212 | 3300041997 | Bacteria | 4288 |
| 422 | Ga0439433_0000393 | 3300041999 | Bacteria | 7867 |
| 423 | Ga0439445_0001138 | 3300042004 | Bacteria | 5700 |
| 424 | Ga0439432_002995 | 3300042006 | Bacteria | 6290 |
| 425 | Ga0439432_015490 | 3300042006 | Bacteria | 2572 |
| 426 | Ga0439449_0000440 | 3300042007 | Bacteria | 15398 |
| 427 | Ga0439449_0002955 | 3300042007 | Bacteria | 6617 |
| 428 | Ga0439452_002568 | 3300042010 | Bacteria | 6655 |
| 429 | Ga0439452_004053 | 3300042010 | Bacteria | 4982 |
| 430 | Ga0439457_002668 | 3300042014 | Bacteria | 5028 |
| 431 | Ga0439462_0016150 | 3300042015 | Bacteria | 1927 |
| 432 | Ga0450911_000229 | 3300042115 | Bacteria | 21702 |
| 433 | Ga0450894_004420 | 3300042131 | Bacteria | 1826 |
| 434 | Ga0450898_008797 | 3300042134 | Bacteria | 1603 |
| 435 | Ga0450906_008648 | 3300042145 | Bacteria | 1963 |
| 436 | Ga0439446_0001674 | 3300042156 | Bacteria | 5136 |
| 437 | Ga0439434_0013114 | 3300042435 | Bacteria | 2458 |
| 438 | Ga0439434_0016440 | 3300042435 | Bacteria | 2210 |
| 439 | Ga0439464_0005012 | 3300042439 | Bacteria | 3406 |
| 440 | Ga0450918_000020 | 3300042531 | Bacteria | 32421 |
| 441 | Ga0450893_0007321 | 3300042532 | Bacteria | 1793 |
| 442 | Ga0451577_0026810 | 3300042876 | Bacteria | 5217 |
| 443 | Ga0466965_0004074 | 3300044683 | Bacteria | 6484 |
| 444 | Ga0466965_0010097 | 3300044683 | Bacteria | 4396 |
| 445 | Ga0466966_0009150 | 3300044684 | Bacteria | 6558 |
| 446 | Ga0466966_0037902 | 3300044684 | Bacteria | 3106 |
| 447 | Ga0466966_0047195 | 3300044684 | Bacteria | 2747 |
| 448 | Ga0466961_0026881 | 3300044693 | Bacteria | 3700 |
| 449 | Ga0466964_0001291 | 3300044706 | Bacteria | 8539 |
| 450 | Ga0466971_0031803 | 3300044719 | Bacteria | 2363 |
| 451 | Ga0466968_0000336 | 3300044735 | Bacteria | 15168 |
| 452 | Ga0466957_0003305 | 3300044842 | Bacteria | 8825 |
| 453 | Ga0466959_0090080 | 3300045049 | Bacteria | 2203 |
| 454 | Ga0466958_0076424 | 3300045836 | Bacteria | 2055 |
| 455 | Ga0466967_0022557 | 3300045976 | Bacteria | 5140 |
| 456 | Ga0495627_011509 | 3300046453 | Bacteria | 3173 |
| 457 | Ga0495603_0051244 | 3300046455 | Bacteria | 2453 |
| 458 | Ga0495590_0000194 | 3300046457 | Bacteria | 34520 |
| 459 | Ga0495590_0009293 | 3300046457 | Bacteria | 3728 |
| 460 | Ga0495591_004761 | 3300046458 | Bacteria | 6496 |
| 461 | Ga0495629_0004887 | 3300046459 | Bacteria | 10062 |
| 462 | Ga0495629_0028547 | 3300046459 | Bacteria | 3960 |
| 463 | Ga0495629_0092876 | 3300046459 | Bacteria | 2106 |
| 464 | Ga0495638_0025106 | 3300046460 | Bacteria | 3877 |
| 465 | Ga0495651_0022359 | 3300046462 | Bacteria | 4915 |
| 466 | Ga0495651_0069077 | 3300046462 | Bacteria | 2692 |
| 467 | Ga0495653_0031825 | 3300046463 | Bacteria | 4191 |
| 468 | Ga0495650_0000173 | 3300046471 | Bacteria | 142734 |
| 469 | Ga0495650_0001016 | 3300046471 | Bacteria | 31640 |
| 470 | Ga0495650_0001137 | 3300046471 | Bacteria | 28827 |
| 471 | Ga0495650_0003845 | 3300046471 | Bacteria | 10646 |
| 472 | Ga0495650_0005666 | 3300046471 | Bacteria | 8014 |
| 473 | Ga0495650_0007897 | 3300046471 | Bacteria | 6315 |
| 474 | Ga0495650_0013987 | 3300046471 | Bacteria | 4209 |
| 475 | Ga0495650_0025527 | 3300046471 | Bacteria | 2767 |
| 476 | Ga0495580_0001751 | 3300046472 | Bacteria | 19089 |
| 477 | Ga0495580_0032788 | 3300046472 | Bacteria | 3744 |
| 478 | Ga0495580_0067042 | 3300046472 | Bacteria | 2511 |
| 479 | Ga0495582_0005030 | 3300046473 | Bacteria | 7408 |
| 480 | Ga0495582_0014926 | 3300046473 | Bacteria | 4269 |
| 481 | Ga0495582_0024795 | 3300046473 | Bacteria | 3283 |
| 482 | Ga0495605_0000166 | 3300046474 | Bacteria | 83477 |
| 483 | Ga0495605_0016349 | 3300046474 | Bacteria | 4016 |
| 484 | Ga0495639_0009692 | 3300046475 | Bacteria | 4133 |
| 485 | Ga0495664_0008135 | 3300046477 | Bacteria | 5839 |
| 486 | Ga0495584_0000755 | 3300046491 | Bacteria | 21387 |
| 487 | Ga0495584_0001114 | 3300046491 | Bacteria | 16663 |
| 488 | Ga0495584_0021488 | 3300046491 | Bacteria | 3277 |
| 489 | Ga0495585_0000742 | 3300046492 | Bacteria | 29008 |
| 490 | Ga0495585_0008221 | 3300046492 | Bacteria | 6333 |
| 491 | Ga0495585_0017784 | 3300046492 | Bacteria | 4103 |
| 492 | Ga0495585_0046655 | 3300046492 | Bacteria | 2415 |
| 493 | Ga0495585_0065816 | 3300046492 | Bacteria | 1985 |
| 494 | Ga0495585_0094558 | 3300046492 | Bacteria | 1606 |
| 495 | Ga0495594_0009364 | 3300046499 | Bacteria | 5059 |
| 496 | Ga0495596_0000282 | 3300046500 | Bacteria | 33869 |
| 497 | Ga0495596_0000815 | 3300046500 | Bacteria | 18857 |
| 498 | Ga0495596_0001341 | 3300046500 | Bacteria | 14167 |
| 499 | Ga0495596_0006576 | 3300046500 | Bacteria | 5333 |
| 500 | Ga0495596_0008577 | 3300046500 | Bacteria | 4541 |
| 501 | Ga0495596_0017959 | 3300046500 | Bacteria | 2920 |
| 502 | Ga0495607_0000569 | 3300046501 | Bacteria | 36001 |
| 503 | Ga0495607_0000761 | 3300046501 | Bacteria | 30878 |
| 504 | Ga0495607_0002170 | 3300046501 | Bacteria | 16331 |
| 505 | Ga0495607_0028022 | 3300046501 | Bacteria | 3478 |
| 506 | Ga0495607_0043480 | 3300046501 | Bacteria | 2656 |
| 507 | Ga0495583_0000264 | 3300046506 | Bacteria | 86123 |
| 508 | Ga0495583_0003019 | 3300046506 | Bacteria | 13420 |
| 509 | Ga0495583_0008798 | 3300046506 | Bacteria | 6118 |
| 510 | Ga0495606_0017721 | 3300046507 | Bacteria | 5371 |
| 511 | Ga0495608_0001973 | 3300046511 | Bacteria | 14703 |
| 512 | Ga0495608_0007653 | 3300046511 | Bacteria | 7615 |
| 513 | Ga0495608_0055888 | 3300046511 | Bacteria | 2608 |
| 514 | Ga0495616_0006765 | 3300046513 | Bacteria | 6912 |
| 515 | Ga0495616_0015488 | 3300046513 | Bacteria | 4240 |
| 516 | Ga0495616_0019091 | 3300046513 | Bacteria | 3747 |
| 517 | Ga0495616_0083987 | 3300046513 | Bacteria | 1518 |
| 518 | Ga0495618_0001212 | 3300046514 | Bacteria | 17489 |
| 519 | Ga0495628_0047704 | 3300046516 | Bacteria | 3396 |
| 520 | Ga0495628_0172213 | 3300046516 | Bacteria | 1641 |
| 521 | Ga0495630_0002019 | 3300046517 | Bacteria | 14105 |
| 522 | Ga0495632_0001724 | 3300046519 | Bacteria | 17773 |
| 523 | Ga0495632_0019098 | 3300046519 | Bacteria | 3741 |
| 524 | Ga0495643_0000983 | 3300046522 | Bacteria | 29263 |
| 525 | Ga0495643_0001243 | 3300046522 | Bacteria | 24444 |
| 526 | Ga0495643_0009267 | 3300046522 | Bacteria | 6134 |
| 527 | Ga0495643_0018628 | 3300046522 | Bacteria | 4030 |
| 528 | Ga0495643_0021644 | 3300046522 | Bacteria | 3684 |
| 529 | Ga0495643_0022208 | 3300046522 | Bacteria | 3623 |
| 530 | Ga0495644_0013780 | 3300046523 | Bacteria | 3099 |
| 531 | Ga0495648_0002408 | 3300046524 | Bacteria | 17360 |
| 532 | Ga0495648_0005013 | 3300046524 | Bacteria | 11126 |
| 533 | Ga0495648_0006066 | 3300046524 | Bacteria | 9919 |
| 534 | Ga0495648_0006655 | 3300046524 | Bacteria | 9357 |
| 535 | Ga0495648_0038696 | 3300046524 | Bacteria | 3045 |
| 536 | Ga0495663_0006301 | 3300046525 | Bacteria | 3277 |
| 537 | Ga0495663_0008721 | 3300046525 | Bacteria | 2812 |
| 538 | Ga0495666_0000669 | 3300046526 | Bacteria | 15496 |
| 539 | Ga0495666_0007649 | 3300046526 | Bacteria | 5406 |
| 540 | Ga0495666_0013879 | 3300046526 | Bacteria | 4017 |
| 541 | Ga0495666_0017260 | 3300046526 | Bacteria | 3595 |
| 542 | Ga0495642_0002646 | 3300046528 | Bacteria | 7214 |
| 543 | Ga0495642_0004046 | 3300046528 | Bacteria | 5722 |
| 544 | Ga0495642_0007481 | 3300046528 | Bacteria | 4184 |
| 545 | Ga0495642_0012289 | 3300046528 | Bacteria | 3300 |
| 546 | Ga0495642_0016098 | 3300046528 | Bacteria | 2911 |
| 547 | Ga0495642_0018068 | 3300046528 | Bacteria | 2758 |
| 548 | Ga0495642_0024464 | 3300046528 | Bacteria | 2389 |
| 549 | Ga0495642_0061247 | 3300046528 | Bacteria | 1561 |
| 550 | Ga0495652_0035177 | 3300046529 | Bacteria | 4360 |
| 551 | Ga0495652_0124737 | 3300046529 | Bacteria | 2048 |
| 552 | Ga0495654_0021325 | 3300046530 | Bacteria | 3371 |
| 553 | Ga0495665_0000807 | 3300046531 | Bacteria | 16422 |
| 554 | Ga0495665_0011811 | 3300046531 | Bacteria | 4731 |
| 555 | Ga0495665_0046020 | 3300046531 | Bacteria | 2317 |
| 556 | Ga0495665_0120167 | 3300046531 | Bacteria | 1376 |
| 557 | Ga0495640_0010739 | 3300046533 | Bacteria | 7064 |
| 558 | Ga0495586_0032578 | 3300046535 | Bacteria | 2794 |
| 559 | Ga0495586_0044065 | 3300046535 | Bacteria | 2402 |
| 560 | Ga0495609_0000028 | 3300046538 | Bacteria | 219908 |
| 561 | Ga0495609_0002870 | 3300046538 | Bacteria | 10296 |
| 562 | Ga0495609_0005090 | 3300046538 | Bacteria | 7007 |
| 563 | Ga0495609_0029527 | 3300046538 | Bacteria | 2496 |
| 564 | Ga0495621_0009386 | 3300046539 | Bacteria | 2969 |
| 565 | Ga0495597_0007716 | 3300046542 | Bacteria | 5440 |
| 566 | Ga0495645_0000143 | 3300046543 | Bacteria | 48856 |
| 567 | Ga0495622_0000183 | 3300046557 | Bacteria | 50803 |
| 568 | Ga0495622_0038105 | 3300046557 | Bacteria | 2238 |
| 569 | Ga0495633_0025626 | 3300046558 | Bacteria | 2902 |
| 570 | Ga0495633_0026080 | 3300046558 | Bacteria | 2870 |
| 571 | Ga0495656_0000057 | 3300046615 | Bacteria | 53197 |
| 572 | Ga0495656_0001209 | 3300046615 | Bacteria | 8415 |
| 573 | Ga0495668_0093555 | 3300046616 | Bacteria | 1646 |
| 574 | Ga0495668_0119107 | 3300046616 | Bacteria | 1444 |
| 575 | Ga0495634_0000991 | 3300046642 | Bacteria | 26768 |
| 576 | Ga0495634_0010313 | 3300046642 | Bacteria | 6848 |
| 577 | Ga0495611_0043745 | 3300046648 | Bacteria | 2002 |
| 578 | Ga0495625_0055874 | 3300046660 | Bacteria | 2813 |
| 579 | Ga0495635_0000843 | 3300046663 | Bacteria | 20064 |
| 580 | Ga0495635_0012858 | 3300046663 | Bacteria | 5861 |
| 581 | Ga0495659_0008002 | 3300046664 | Bacteria | 3355 |
| 582 | Ga0495661_0000157 | 3300046665 | Bacteria | 80637 |
| 583 | Ga0495661_0002008 | 3300046665 | Bacteria | 16041 |
| 584 | Ga0495661_0004573 | 3300046665 | Bacteria | 9964 |
| 585 | Ga0495661_0014826 | 3300046665 | Bacteria | 5213 |
| 586 | Ga0495661_0018779 | 3300046665 | Bacteria | 4540 |
| 587 | Ga0495661_0028910 | 3300046665 | Bacteria | 3542 |
| 588 | Ga0495661_0031969 | 3300046665 | Bacteria | 3331 |
| 589 | Ga0495661_0044035 | 3300046665 | Bacteria | 2738 |
| 590 | Ga0495661_0046669 | 3300046665 | Bacteria | 2643 |
| 591 | Ga0495661_0060555 | 3300046665 | Bacteria | 2248 |
| 592 | Ga0495661_0084247 | 3300046665 | Bacteria | 1825 |
| 593 | Ga0495588_0000113 | 3300046674 | Bacteria | 137279 |
| 594 | Ga0495588_0051641 | 3300046674 | Bacteria | 2118 |
| 595 | Ga0495657_0012314 | 3300046675 | Bacteria | 6356 |
| 596 | Ga0495623_0034581 | 3300046679 | Bacteria | 3240 |
| 597 | Ga0495623_0062332 | 3300046679 | Bacteria | 2337 |
| 598 | Ga0495623_0097081 | 3300046679 | Bacteria | 1800 |
| 599 | Ga0495646_0001966 | 3300046680 | Bacteria | 12392 |
| 600 | Ga0495646_0004589 | 3300046680 | Bacteria | 8706 |
| 601 | Ga0495646_0051483 | 3300046680 | Bacteria | 2492 |
| 602 | Ga0495669_0048026 | 3300046684 | Bacteria | 1909 |
| 603 | Ga0495613_0138629 | 3300046689 | Bacteria | 1739 |
| 604 | Ga0495624_0053356 | 3300046690 | Bacteria | 2552 |
| 605 | Ga0495670_0012681 | 3300046691 | Bacteria | 4146 |
| 606 | Ga0495671_0059450 | 3300046692 | Bacteria | 1889 |
| 607 | Ga0495649_0002811 | 3300046694 | Bacteria | 12115 |
| 608 | Ga0495649_0052867 | 3300046694 | Bacteria | 2200 |
| 609 | Ga0495589_0000098 | 3300046794 | Bacteria | 83860 |
| 610 | Ga0495589_0000117 | 3300046794 | Bacteria | 75549 |
| 611 | Ga0495589_0013980 | 3300046794 | Bacteria | 4138 |
| 612 | Ga0495589_0022855 | 3300046794 | Bacteria | 3188 |
| 613 | Ga0495589_0025125 | 3300046794 | Bacteria | 3024 |
| 614 | Ga0495589_0071017 | 3300046794 | Bacteria | 1702 |
| 615 | Ga0495600_0000917 | 3300046809 | Bacteria | 15795 |
| 616 | Ga0495600_0002998 | 3300046809 | Bacteria | 9861 |
| 617 | Ga0495600_0089423 | 3300046809 | Bacteria | 2009 |
| 618 | Ga0495660_0005424 | 3300046810 | Bacteria | 7634 |
| 619 | Ga0495581_0000660 | 3300047315 | Bacteria | 18106 |
| 620 | Ga0495581_0002997 | 3300047315 | Bacteria | 9677 |
| 621 | Ga0495581_0006255 | 3300047315 | Bacteria | 6902 |
| 622 | Ga0495604_0013071 | 3300047317 | Bacteria | 6614 |
| 623 | Ga0495604_0097389 | 3300047317 | Bacteria | 2169 |
| 624 | Ga0495636_0009716 | 3300047318 | Bacteria | 3788 |
| 625 | Ga0495674_0002283 | 3300047319 | Bacteria | 18822 |
| 626 | Ga0495674_0074943 | 3300047319 | Bacteria | 2912 |
| 627 | Ga0495674_0126150 | 3300047319 | Bacteria | 2159 |
| 628 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 629 | Ga0495672_0000464 | 3300047320 | Bacteria | 47929 |
| 630 | Ga0495672_0004632 | 3300047320 | Bacteria | 11164 |
| 631 | Ga0495676_0071183 | 3300047321 | Bacteria | 2674 |
| 632 | Ga0495676_0071692 | 3300047321 | Bacteria | 2662 |
| 633 | Ga0495676_0109873 | 3300047321 | Bacteria | 2025 |
| 634 | Ga0495680_0022759 | 3300047322 | Bacteria | 5219 |
| 635 | Ga0495680_0132106 | 3300047322 | Bacteria | 1833 |
| 636 | Ga0495683_0000112 | 3300047323 | Bacteria | 82903 |
| 637 | Ga0495683_0000990 | 3300047323 | Bacteria | 19873 |
| 638 | Ga0495683_0004557 | 3300047323 | Bacteria | 7837 |
| 639 | Ga0495683_0009188 | 3300047323 | Bacteria | 5268 |
| 640 | Ga0495683_0018937 | 3300047323 | Bacteria | 3554 |
| 641 | Ga0495683_0032215 | 3300047323 | Bacteria | 2670 |
| 642 | Ga0495687_000054 | 3300047443 | Bacteria | 194607 |
| 643 | Ga0495687_000430 | 3300047443 | Bacteria | 51814 |
| 644 | Ga0495687_005372 | 3300047443 | Bacteria | 8188 |
| 645 | Ga0495687_006707 | 3300047443 | Bacteria | 6981 |
| 646 | Ga0495675_0000641 | 3300047444 | Bacteria | 22216 |
| 647 | Ga0495675_0002207 | 3300047444 | Bacteria | 11610 |
| 648 | Ga0495677_0000012 | 3300047445 | Bacteria | 146763 |
| 649 | Ga0495677_0000154 | 3300047445 | Bacteria | 32847 |
| 650 | Ga0495677_0001386 | 3300047445 | Bacteria | 9697 |
| 651 | Ga0495677_0003569 | 3300047445 | Bacteria | 6034 |
| 652 | Ga0495677_0004324 | 3300047445 | Bacteria | 5459 |
| 653 | Ga0495679_000344 | 3300047446 | Bacteria | 36397 |
| 654 | Ga0495685_009832 | 3300047447 | Bacteria | 3202 |
| 655 | Ga0495673_0016670 | 3300047469 | Bacteria | 3751 |
| 656 | Ga0495681_0042084 | 3300047470 | Bacteria | 2213 |
| 657 | Ga0495686_0000219 | 3300047472 | Bacteria | 105435 |
| 658 | Ga0495686_0046279 | 3300047472 | Bacteria | 2751 |
| 659 | Ga0495686_0098852 | 3300047472 | Bacteria | 1762 |
| 660 | Ga0495593_0006738 | 3300047673 | Bacteria | 6724 |
| 661 | Ga0495593_0034519 | 3300047673 | Bacteria | 2751 |
| 662 | Ga0495602_0002022 | 3300048088 | Bacteria | 20408 |
| 663 | Ga0495602_0017269 | 3300048088 | Bacteria | 7235 |
| 664 | Ga0495614_0015846 | 3300048089 | Bacteria | 3283 |
| 665 | Ga0495615_0007699 | 3300048090 | Bacteria | 2055 |
| 666 | Ga0495626_0000036 | 3300048091 | Bacteria | 180464 |
| 667 | Ga0495626_0000603 | 3300048091 | Bacteria | 35071 |
| 668 | Ga0495626_0001290 | 3300048091 | Bacteria | 20449 |
| 669 | Ga0495626_0006446 | 3300048091 | Bacteria | 6683 |
| 670 | Ga0495626_0007753 | 3300048091 | Bacteria | 5948 |
| 671 | Ga0495626_0016949 | 3300048091 | Bacteria | 3690 |
| 672 | Ga0495626_0043954 | 3300048091 | Bacteria | 2094 |
| 673 | Ga0495626_0058503 | 3300048091 | Bacteria | 1761 |
| 674 | Ga0496100_0000252 | 3300048903 | Bacteria | 27499 |
| 675 | Ga0496100_0034654 | 3300048903 | Bacteria | 3169 |
| 676 | Ga0496101_0001430 | 3300048904 | Bacteria | 14246 |
| 677 | Ga0496101_0108358 | 3300048904 | Bacteria | 2088 |
| 678 | Ga0496101_0152460 | 3300048904 | Bacteria | 1768 |
| 679 | Ga0496102_0000279 | 3300048905 | Bacteria | 65185 |
| 680 | Ga0496102_0000504 | 3300048905 | Bacteria | 42821 |
| 681 | Ga0496102_0043738 | 3300048905 | Bacteria | 4062 |
| 682 | Ga0496102_0169740 | 3300048905 | Bacteria | 2054 |
| 683 | Ga0496102_0337121 | 3300048905 | Bacteria | 1420 |
| 684 | Ga0496103_0001452 | 3300048906 | Bacteria | 15864 |
| 685 | Ga0496103_0049118 | 3300048906 | Bacteria | 2609 |
| 686 | Ga0496103_0049140 | 3300048906 | Bacteria | 2608 |
| 687 | Ga0496104_0024837 | 3300048907 | Bacteria | 5517 |
| 688 | Ga0496104_0139919 | 3300048907 | Bacteria | 2325 |
| 689 | Ga0496105_0006505 | 3300048908 | Bacteria | 8984 |
| 690 | Ga0496105_0018232 | 3300048908 | Bacteria | 5636 |
| 691 | Ga0496105_0024936 | 3300048908 | Bacteria | 4861 |
| 692 | Ga0496105_0037535 | 3300048908 | Bacteria | 3989 |
| 693 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 694 | Ga0496106_0009466 | 3300048909 | Bacteria | 7202 |
| 695 | Ga0496108_0015356 | 3300048911 | Bacteria | 6246 |
| 696 | Ga0496108_0095376 | 3300048911 | Bacteria | 2533 |
| 697 | Ga0496109_0087066 | 3300048912 | Bacteria | 2885 |
| 698 | Ga0496110_0018524 | 3300048913 | Bacteria | 5837 |
| 699 | Ga0496110_0025062 | 3300048913 | Bacteria | 5092 |
| 700 | Ga0496110_0175493 | 3300048913 | Bacteria | 1945 |
| 701 | Ga0496110_0193534 | 3300048913 | Bacteria | 1846 |
| 702 | Ga0496111_0025762 | 3300048914 | Bacteria | 4151 |
| 703 | Ga0496112_0008206 | 3300048915 | Bacteria | 9339 |
| 704 | Ga0496112_0058178 | 3300048915 | Bacteria | 3807 |
| 705 | Ga0496113_0002606 | 3300048916 | Bacteria | 10546 |
| 706 | Ga0496113_0048072 | 3300048916 | Bacteria | 3173 |
| 707 | Ga0496113_0145983 | 3300048916 | Bacteria | 1864 |
| 708 | Ga0496114_0002318 | 3300048917 | Bacteria | 14508 |
| 709 | Ga0496114_0031518 | 3300048917 | Bacteria | 4362 |
| 710 | Ga0496114_0101885 | 3300048917 | Bacteria | 2452 |
| 711 | Ga0496117_0001263 | 3300048920 | Bacteria | 37577 |
| 712 | Ga0496117_0009273 | 3300048920 | Bacteria | 9196 |
| 713 | Ga0496118_0002573 | 3300048921 | Bacteria | 24223 |
| 714 | Ga0496118_0005723 | 3300048921 | Bacteria | 13985 |
| 715 | Ga0496118_0099662 | 3300048921 | Bacteria | 1968 |
| 716 | Ga0496119_0033822 | 3300048922 | Bacteria | 3381 |
| 717 | Ga0496119_0099962 | 3300048922 | Bacteria | 1630 |
| 718 | Ga0496121_0001612 | 3300048924 | Bacteria | 37459 |
| 719 | Ga0496121_0014246 | 3300048924 | Bacteria | 8457 |
| 720 | Ga0496121_0017114 | 3300048924 | Bacteria | 7431 |
| 721 | Ga0496121_0026646 | 3300048924 | Bacteria | 5436 |
| 722 | Ga0496121_0104928 | 3300048924 | Bacteria | 2170 |
| 723 | Ga0496122_0000039 | 3300048925 | Bacteria | 295352 |
| 724 | Ga0496122_0004995 | 3300048925 | Bacteria | 16054 |
| 725 | Ga0496122_0013715 | 3300048925 | Bacteria | 7907 |
| 726 | Ga0496123_0000026 | 3300048926 | Bacteria | 318040 |
| 727 | Ga0496123_0004595 | 3300048926 | Bacteria | 14373 |
| 728 | Ga0496124_0124526 | 3300048927 | Bacteria | 2055 |
| 729 | Ga0496125_0002380 | 3300048928 | Bacteria | 24528 |
| 730 | Ga0496125_0005683 | 3300048928 | Bacteria | 13751 |
| 731 | Ga0496125_0085740 | 3300048928 | Bacteria | 2385 |
| 732 | Ga0496126_0000065 | 3300048929 | Bacteria | 252549 |
| 733 | Ga0496126_0056411 | 3300048929 | Bacteria | 3551 |
| 734 | Ga0495678_002126 | 3300049459 | Bacteria | 14046 |
| 735 | Ga0495678_010341 | 3300049459 | Bacteria | 4543 |
| 736 | Ga0501303_001395 | 3300049526 | Bacteria | 1808 |
| 737 | Ga0501046_0041180 | 3300049580 | Bacteria | 3687 |
| 738 | Ga0501075_0103726 | 3300049591 | Bacteria | 2161 |
| 739 | Ga0501076_0047631 | 3300049592 | Bacteria | 3390 |
| 740 | Ga0501035_0000816 | 3300049822 | Bacteria | 33256 |
| 741 | Ga0501035_0084945 | 3300049822 | Bacteria | 2791 |
| 742 | nmdc:mga03683_30774_c1 | 3300050489 | Bacteria | 2149 |
| 743 | nmdc:mga03n38_73780_c1 | 3300050490 | Bacteria | 1585 |
| 744 | nmdc:mga0k408_717_c1 | 3300050493 | Bacteria | 18151 |
| 745 | nmdc:mga07m45_111_c1 | 3300050496 | Bacteria | 32728 |
| 746 | nmdc:mga07m45_80278_c1 | 3300050496 | Bacteria | 1863 |
| 747 | nmdc:mga05p37_90979_c1 | 3300050507 | Bacteria | 3760 |
| 748 | nmdc:mga09592_182821_c1 | 3300050508 | Bacteria | 1814 |
| 749 | nmdc:mga09592_2480_c1 | 3300050508 | Bacteria | 14905 |
| 750 | nmdc:mga08y16_5490_c1 | 3300050511 | Bacteria | 13255 |
| 751 | nmdc:mga08x19_91616_c1 | 3300050514 | Bacteria | 2007 |
| 752 | nmdc:mga0sz30_9719_c1 | 3300050516 | Bacteria | 3667 |
| 753 | Ga0500607_011616 | 3300053121 | Bacteria | 5201 |
| 754 | Ga0500559_0011246 | 3300053136 | Bacteria | 3825 |
| 755 | Ga0500573_0016722 | 3300053140 | Bacteria | 4168 |
| 756 | Ga0500590_016027 | 3300053148 | Bacteria | 3872 |
| 757 | Ga0501082_0078329 | 3300060353 | Bacteria | 2851 |
| 758 | Ga0466962_0026080 | 3300061719 | Bacteria | 2806 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_100073389 | Ga0070683_1000733893 | 389 |
| 2 | 3300005344 | Ga0070661_100020175 | Ga0070661_1000201752 | 389 |
| 3 | 3300005435 | Ga0070714_100017632 | Ga0070714_1000176325 | 389 |
| 4 | 3300005563 | Ga0068855_100020707 | Ga0068855_1000207075 | 389 |
| 5 | 3300005564 | Ga0070664_100009052 | Ga0070664_1000090523 | 389 |
| 6 | 3300005577 | Ga0068857_100001323 | Ga0068857_10000132318 | 389 |
| 7 | 3300005578 | Ga0068854_100008729 | Ga0068854_1000087293 | 389 |
| 8 | 3300005614 | Ga0068856_100002037 | Ga0068856_1000020373 | 389 |
| 9 | 3300005834 | Ga0068851_10016048 | Ga0068851_100160483 | 389 |
| 10 | 3300009093 | Ga0105240_10002223 | Ga0105240_1000222311 | 389 |
| 11 | 3300009174 | Ga0105241_10021547 | Ga0105241_100215472 | 389 |
| 12 | 3300009545 | Ga0105237_10067780 | Ga0105237_100677803 | 389 |
| 13 | 3300009551 | Ga0105238_10010414 | Ga0105238_100104147 | 389 |
| 14 | 3300013104 | Ga0157370_10199081 | Ga0157370_101990812 | 389 |
| 15 | 3300013105 | Ga0157369_10043206 | Ga0157369_100432064 | 389 |
| 16 | 3300013307 | Ga0157372_10008220 | Ga0157372_100082205 | 389 |
| 17 | 3300025321 | Ga0207656_10055245 | Ga0207656_100552451 | 390 |
| 18 | 3300025920 | Ga0207649_10010572 | Ga0207649_100105723 | 390 |
| 19 | 3300025929 | Ga0207664_10009160 | Ga0207664_100091605 | 390 |
| 20 | 3300025945 | Ga0207679_10009197 | Ga0207679_100091972 | 390 |
| 21 | 3300025949 | Ga0207667_10038166 | Ga0207667_100381664 | 390 |
| 22 | 3300026078 | Ga0207702_10019314 | Ga0207702_100193143 | 390 |
| 23 | 3300026116 | Ga0207674_10000040 | Ga0207674_10000040108 | 390 |
| 24 | 3300046692 | Ga0495671_0059450 | Ga0495671_0059450_158_1435 | 390 |
| 25 | 3300046794 | Ga0495589_0022855 | Ga0495589_0022855_1336_2613 | 390 |
| 26 | 3300047443 | Ga0495687_005372 | Ga0495687_005372_3788_5065 | 390 |
| 27 | 3300048916 | Ga0496113_0002606 | Ga0496113_0002606_10_1272 | 390 |
| 28 | 3300003320 | rootH2_10027177 | rootH2_100271772 | 391 |
| 29 | 3300003322 | rootL2_10050965 | rootL2_100509654 | 391 |
| 30 | 3300003354 | JGI25160J50197_1000284 | JGI25160J50197_100028428 | 391 |
| 31 | 3300005262 | Ga0065165_1002073 | Ga0065165_100207310 | 391 |
| 32 | 3300006353 | Ga0075370_10000078 | Ga0075370_1000007814 | 391 |
| 33 | 3300013102 | Ga0157371_10062249 | Ga0157371_100622493 | 391 |
| 34 | 3300025284 | Ga0209130_1015288 | Ga0209130_10152881 | 391 |
| 35 | 3300025295 | Ga0209564_1002345 | Ga0209564_10023455 | 391 |
| 36 | 3300025302 | Ga0207426_1000737 | Ga0207426_100073711 | 391 |
| 37 | 3300037471 | Ga0395905_0000076 | Ga0395905_0000076_135297_136559 | 391 |
| 38 | 3300038443 | Ga0395901_0002180 | Ga0395901_0002180_3713_4984 | 391 |
| 39 | 3300046457 | Ga0495590_0009293 | Ga0495590_0009293_2423_3685 | 391 |
| 40 | 3300046472 | Ga0495580_0067042 | Ga0495580_0067042_844_2106 | 391 |
| 41 | 3300046528 | Ga0495642_0024464 | Ga0495642_0024464_978_2240 | 391 |
| 42 | 3300046794 | Ga0495589_0071017 | Ga0495589_0071017_123_1385 | 391 |
| 43 | 3300047319 | Ga0495674_0002283 | Ga0495674_0002283_7892_9154 | 391 |
| 44 | 3300047323 | Ga0495683_0018937 | Ga0495683_0018937_1978_3240 | 391 |
| 45 | 3300047469 | Ga0495673_0016670 | Ga0495673_0016670_236_1498 | 391 |
| 46 | 3300048903 | Ga0496100_0000252 | Ga0496100_0000252_16267_17529 | 391 |
| 47 | 3300048903 | Ga0496100_0034654 | Ga0496100_0034654_1487_2749 | 391 |
| 48 | 3300048904 | Ga0496101_0001430 | Ga0496101_0001430_9679_10941 | 391 |
| 49 | 3300048904 | Ga0496101_0108358 | Ga0496101_0108358_101_1363 | 391 |
| 50 | 3300048905 | Ga0496102_0000504 | Ga0496102_0000504_25262_26524 | 391 |
| 51 | 3300048906 | Ga0496103_0001452 | Ga0496103_0001452_6799_8061 | 391 |
| 52 | 3300048907 | Ga0496104_0139919 | Ga0496104_0139919_901_2163 | 391 |
| 53 | 3300048908 | Ga0496105_0024936 | Ga0496105_0024936_421_1683 | 391 |
| 54 | 3300048915 | Ga0496112_0058178 | Ga0496112_0058178_1914_3176 | 391 |
| 55 | 3300048920 | Ga0496117_0001263 | Ga0496117_0001263_20117_21379 | 391 |
| 56 | 3300048921 | Ga0496118_0002573 | Ga0496118_0002573_6397_7659 | 391 |
| 57 | 3300048922 | Ga0496119_0033822 | Ga0496119_0033822_330_1592 | 391 |
| 58 | 3300048922 | Ga0496119_0099962 | Ga0496119_0099962_134_1396 | 391 |
| 59 | 3300048924 | Ga0496121_0001612 | Ga0496121_0001612_28543_29805 | 391 |
| 60 | 3300048924 | Ga0496121_0017114 | Ga0496121_0017114_6007_7269 | 391 |
| 61 | 3300050493 | nmdc:mga0k408_717_c1 | nmdc:mga0k408_717_c1_15732_17012 | 391 |
| 62 | 3300050496 | nmdc:mga07m45_111_c1 | nmdc:mga07m45_111_c1_19168_20448 | 391 |
| 63 | 3300046471 | Ga0495650_0007897 | Ga0495650_0007897_1770_3032 | 392 |
| 64 | 3300046557 | Ga0495622_0000183 | Ga0495622_0000183_5443_6705 | 392 |
| 65 | 3300005327 | Ga0070658_10196924 | Ga0070658_101969241 | 393 |
| 66 | 3300016635 | Ga0183361_10006 | Ga0183361_1000617 | 393 |
| 67 | 3300025909 | Ga0207705_10179559 | Ga0207705_101795592 | 393 |
| 68 | 3300042876 | Ga0451577_0026810 | Ga0451577_0026810_1607_2872 | 393 |
| 69 | 3300046616 | Ga0495668_0119107 | Ga0495668_0119107_91_1362 | 393 |
| 70 | 3300047472 | Ga0495686_0098852 | Ga0495686_0098852_313_1584 | 393 |
| 71 | 3300048909 | Ga0496106_0000001 | Ga0496106_0000001_278256_279527 | 393 |
| 72 | 3300048924 | Ga0496121_0014246 | Ga0496121_0014246_3830_5101 | 393 |
| 73 | 3300045836 | Ga0466958_0076424 | Ga0466958_0076424_11_1222 | 394 |
| 74 | 3300048921 | Ga0496118_0099662 | Ga0496118_0099662_652_1923 | 394 |
| 75 | 3300048929 | Ga0496126_0000065 | Ga0496126_0000065_190794_192065 | 394 |
| 76 | 3300002705 | JGI25156J39149_1000817 | JGI25156J39149_10008174 | 396 |
| 77 | 3300025256 | Ga0209759_1000014 | Ga0209759_100001484 | 396 |
| 78 | 3300046459 | Ga0495629_0028547 | Ga0495629_0028547_548_1819 | 396 |
| 79 | 3300046462 | Ga0495651_0069077 | Ga0495651_0069077_45_1316 | 396 |
| 80 | 3300046471 | Ga0495650_0025527 | Ga0495650_0025527_42_1313 | 396 |
| 81 | 3300046477 | Ga0495664_0008135 | Ga0495664_0008135_3479_4750 | 396 |
| 82 | 3300046500 | Ga0495596_0006576 | Ga0495596_0006576_3024_4295 | 396 |
| 83 | 3300046511 | Ga0495608_0001973 | Ga0495608_0001973_13055_14326 | 396 |
| 84 | 3300046526 | Ga0495666_0017260 | Ga0495666_0017260_180_1451 | 396 |
| 85 | 3300046533 | Ga0495640_0010739 | Ga0495640_0010739_2044_3315 | 396 |
| 86 | 3300046535 | Ga0495586_0032578 | Ga0495586_0032578_537_1808 | 396 |
| 87 | 3300046642 | Ga0495634_0010313 | Ga0495634_0010313_5402_6673 | 396 |
| 88 | 3300046663 | Ga0495635_0000843 | Ga0495635_0000843_13949_15220 | 396 |
| 89 | 3300046675 | Ga0495657_0012314 | Ga0495657_0012314_1249_2520 | 396 |
| 90 | 3300046679 | Ga0495623_0062332 | Ga0495623_0062332_688_1959 | 396 |
| 91 | 3300046680 | Ga0495646_0004589 | Ga0495646_0004589_3686_4957 | 396 |
| 92 | 3300046694 | Ga0495649_0002811 | Ga0495649_0002811_242_1513 | 396 |
| 93 | 3300046809 | Ga0495600_0002998 | Ga0495600_0002998_2687_3958 | 396 |
| 94 | 3300047315 | Ga0495581_0000660 | Ga0495581_0000660_11236_12507 | 396 |
| 95 | 3300047319 | Ga0495674_0126150 | Ga0495674_0126150_510_1781 | 396 |
| 96 | 3300047321 | Ga0495676_0071692 | Ga0495676_0071692_882_2153 | 396 |
| 97 | 3300047323 | Ga0495683_0000990 | Ga0495683_0000990_8146_9417 | 396 |
| 98 | 3300048091 | Ga0495626_0043954 | Ga0495626_0043954_274_1545 | 396 |
| 99 | 3300046492 | Ga0495585_0046655 | Ga0495585_0046655_481_1680 | 399 |
| 100 | 3300046528 | Ga0495642_0061247 | Ga0495642_0061247_12_1211 | 399 |
| 101 | 3300005616 | Ga0068852_100010271 | Ga0068852_1000102712 | 401 |
| 102 | 3300025972 | Ga0207668_10023525 | Ga0207668_100235254 | 403 |
| 103 | 3300046809 | Ga0495600_0000917 | Ga0495600_0000917_8771_10006 | 403 |
| 104 | 3300046506 | Ga0495583_0000264 | Ga0495583_0000264_25764_26978 | 404 |
| 105 | 3300046473 | Ga0495582_0014926 | Ga0495582_0014926_1877_3097 | 406 |
| 106 | 3300046524 | Ga0495648_0005013 | Ga0495648_0005013_1356_2618 | 406 |
| 107 | 3300048916 | Ga0496113_0048072 | Ga0496113_0048072_574_1833 | 406 |
| 108 | 3300048924 | Ga0496121_0026646 | Ga0496121_0026646_2502_3803 | 406 |
| 109 | 3300048925 | Ga0496122_0013715 | Ga0496122_0013715_6272_7531 | 406 |
| 110 | 3300048928 | Ga0496125_0002380 | Ga0496125_0002380_19092_20393 | 406 |
| 111 | 3300048928 | Ga0496125_0085740 | Ga0496125_0085740_223_1482 | 406 |
| 112 | 3300005293 | Ga0065715_10027957 | Ga0065715_100279572 | 407 |
| 113 | 3300006186 | Ga0075369_10011318 | Ga0075369_100113182 | 407 |
| 114 | 3300006880 | Ga0075429_100105785 | Ga0075429_1001057852 | 407 |
| 115 | 3300009098 | Ga0105245_10075167 | Ga0105245_100751672 | 407 |
| 116 | 3300045976 | Ga0466967_0022557 | Ga0466967_0022557_2482_3741 | 407 |
| 117 | 3300046506 | Ga0495583_0008798 | Ga0495583_0008798_650_1912 | 407 |
| 118 | 3300048924 | Ga0496121_0104928 | Ga0496121_0104928_864_2123 | 407 |
| 119 | 3300049591 | Ga0501075_0103726 | Ga0501075_0103726_657_1922 | 407 |
| 120 | 3300049592 | Ga0501076_0047631 | Ga0501076_0047631_313_1578 | 407 |
| 121 | 3300050508 | nmdc:mga09592_182821_c1 | nmdc:mga09592_182821_c1_344_1636 | 407 |
| 122 | 3300060353 | Ga0501082_0078329 | Ga0501082_0078329_611_1876 | 407 |
| 123 | iso_pu_bacteria | 642555113 | 642615563 | 408 |
| 124 | 3300003756 | Ga0055533_1000104 | Ga0055533_100010484 | 409 |
| 125 | 3300003758 | Ga0055532_1000003 | Ga0055532_1000003372 | 409 |
| 126 | 3300003760 | Ga0055527_1000006 | Ga0055527_100000685 | 409 |
| 127 | 3300003761 | Ga0055535_1000003 | Ga0055535_1000003372 | 409 |
| 128 | 3300003762 | Ga0055542_1000007 | Ga0055542_1000007372 | 409 |
| 129 | 3300003763 | Ga0055529_1000003 | Ga0055529_100000385 | 409 |
| 130 | 3300005347 | Ga0070668_100000690 | Ga0070668_1000006903 | 409 |
| 131 | 3300005844 | Ga0068862_100028911 | Ga0068862_1000289112 | 409 |
| 132 | 3300014326 | Ga0157380_10030503 | Ga0157380_100305033 | 409 |
| 133 | 3300025226 | Ga0209674_100025 | Ga0209674_100025371 | 409 |
| 134 | 3300025228 | Ga0209672_100002 | Ga0209672_1000021263 | 409 |
| 135 | 3300025229 | Ga0209147_100003 | Ga0209147_1000031263 | 409 |
| 136 | 3300025230 | Ga0209563_101042 | Ga0209563_1010425 | 409 |
| 137 | 3300025231 | Ga0207427_101164 | Ga0207427_1011647 | 409 |
| 138 | 3300025242 | Ga0209258_100005 | Ga0209258_100005904 | 409 |
| 139 | 3300025254 | Ga0209148_1000006 | Ga0209148_10000061263 | 409 |
| 140 | 3300025261 | Ga0209233_1000018 | Ga0209233_100001883 | 409 |
| 141 | 3300025272 | Ga0209455_1000003 | Ga0209455_10000031263 | 409 |
| 142 | 3300025972 | Ga0207668_10010104 | Ga0207668_100101043 | 409 |
| 143 | 3300028380 | Ga0268265_10042827 | Ga0268265_100428272 | 409 |
| 144 | 3300046471 | Ga0495650_0001137 | Ga0495650_0001137_14202_15479 | 409 |
| 145 | 3300046471 | Ga0495650_0005666 | Ga0495650_0005666_1845_3107 | 409 |
| 146 | 3300046472 | Ga0495580_0001751 | Ga0495580_0001751_14204_15481 | 409 |
| 147 | 3300046492 | Ga0495585_0094558 | Ga0495585_0094558_221_1498 | 409 |
| 148 | 3300046511 | Ga0495608_0055888 | Ga0495608_0055888_818_2095 | 409 |
| 149 | 3300046528 | Ga0495642_0007481 | Ga0495642_0007481_749_2026 | 409 |
| 150 | 3300046530 | Ga0495654_0021325 | Ga0495654_0021325_186_1463 | 409 |
| 151 | 3300046531 | Ga0495665_0120167 | Ga0495665_0120167_73_1350 | 409 |
| 152 | 3300046543 | Ga0495645_0000143 | Ga0495645_0000143_14681_15958 | 409 |
| 153 | 3300046674 | Ga0495588_0051641 | Ga0495588_0051641_330_1607 | 409 |
| 154 | 3300046679 | Ga0495623_0097081 | Ga0495623_0097081_276_1553 | 409 |
| 155 | 3300046680 | Ga0495646_0051483 | Ga0495646_0051483_582_1859 | 409 |
| 156 | 3300046689 | Ga0495613_0138629 | Ga0495613_0138629_62_1339 | 409 |
| 157 | 3300046809 | Ga0495600_0089423 | Ga0495600_0089423_138_1415 | 409 |
| 158 | 3300047315 | Ga0495581_0002997 | Ga0495581_0002997_3305_4582 | 409 |
| 159 | 3300047673 | Ga0495593_0034519 | Ga0495593_0034519_1155_2432 | 409 |
| 160 | 3300048908 | Ga0496105_0018232 | Ga0496105_0018232_2516_3793 | 409 |
| 161 | 3300048917 | Ga0496114_0002318 | Ga0496114_0002318_3651_4928 | 409 |
| 162 | 3300017792 | Ga0163161_10004592 | Ga0163161_100045922 | 410 |
| 163 | 3300005985 | Ga0081539_10003666 | Ga0081539_100036665 | 411 |
| 164 | 3300046526 | Ga0495666_0013879 | Ga0495666_0013879_96_1331 | 411 |
| 165 | 3300046557 | Ga0495622_0038105 | Ga0495622_0038105_870_2105 | 411 |
| 166 | 3300048929 | Ga0496126_0056411 | Ga0496126_0056411_1945_3279 | 411 |
| 167 | 3300005617 | Ga0068859_100175348 | Ga0068859_1001753483 | 412 |
| 168 | 3300006931 | Ga0097620_100175345 | Ga0097620_1001753453 | 412 |
| 169 | 3300009177 | Ga0105248_10067706 | Ga0105248_100677063 | 412 |
| 170 | 3300013105 | Ga0157369_10015394 | Ga0157369_100153943 | 412 |
| 171 | 3300025254 | Ga0209148_1000413 | Ga0209148_100041340 | 412 |
| 172 | 3300046455 | Ga0495603_0051244 | Ga0495603_0051244_1013_2275 | 412 |
| 173 | 3300046458 | Ga0495591_004761 | Ga0495591_004761_3682_4944 | 412 |
| 174 | 3300046459 | Ga0495629_0004887 | Ga0495629_0004887_5920_7182 | 412 |
| 175 | 3300046462 | Ga0495651_0022359 | Ga0495651_0022359_2429_3691 | 412 |
| 176 | 3300046463 | Ga0495653_0031825 | Ga0495653_0031825_1864_3126 | 412 |
| 177 | 3300046471 | Ga0495650_0013987 | Ga0495650_0013987_159_1421 | 412 |
| 178 | 3300046472 | Ga0495580_0032788 | Ga0495580_0032788_289_1551 | 412 |
| 179 | 3300046473 | Ga0495582_0024795 | Ga0495582_0024795_134_1396 | 412 |
| 180 | 3300046500 | Ga0495596_0000815 | Ga0495596_0000815_9278_10516 | 412 |
| 181 | 3300046500 | Ga0495596_0008577 | Ga0495596_0008577_256_1518 | 412 |
| 182 | 3300046511 | Ga0495608_0007653 | Ga0495608_0007653_2400_3662 | 412 |
| 183 | 3300046514 | Ga0495618_0001212 | Ga0495618_0001212_7585_8847 | 412 |
| 184 | 3300046516 | Ga0495628_0047704 | Ga0495628_0047704_1846_3108 | 412 |
| 185 | 3300046516 | Ga0495628_0172213 | Ga0495628_0172213_305_1567 | 412 |
| 186 | 3300046517 | Ga0495630_0002019 | Ga0495630_0002019_2429_3691 | 412 |
| 187 | 3300046524 | Ga0495648_0038696 | Ga0495648_0038696_1718_2980 | 412 |
| 188 | 3300046526 | Ga0495666_0000669 | Ga0495666_0000669_1426_2688 | 412 |
| 189 | 3300046529 | Ga0495652_0035177 | Ga0495652_0035177_670_1932 | 412 |
| 190 | 3300046531 | Ga0495665_0000807 | Ga0495665_0000807_9990_11252 | 412 |
| 191 | 3300046663 | Ga0495635_0012858 | Ga0495635_0012858_4437_5699 | 412 |
| 192 | 3300046665 | Ga0495661_0014826 | Ga0495661_0014826_1758_3020 | 412 |
| 193 | 3300046680 | Ga0495646_0001966 | Ga0495646_0001966_7418_8680 | 412 |
| 194 | 3300046690 | Ga0495624_0053356 | Ga0495624_0053356_1194_2456 | 412 |
| 195 | 3300046794 | Ga0495589_0013980 | Ga0495589_0013980_1811_3073 | 412 |
| 196 | 3300047315 | Ga0495581_0006255 | Ga0495581_0006255_1193_2455 | 412 |
| 197 | 3300047317 | Ga0495604_0013071 | Ga0495604_0013071_4683_5945 | 412 |
| 198 | 3300047319 | Ga0495674_0074943 | Ga0495674_0074943_97_1359 | 412 |
| 199 | 3300047321 | Ga0495676_0109873 | Ga0495676_0109873_439_1701 | 412 |
| 200 | 3300047322 | Ga0495680_0022759 | Ga0495680_0022759_2419_3681 | 412 |
| 201 | 3300047322 | Ga0495680_0132106 | Ga0495680_0132106_475_1737 | 412 |
| 202 | 3300047323 | Ga0495683_0004557 | Ga0495683_0004557_6383_7621 | 412 |
| 203 | 3300047444 | Ga0495675_0002207 | Ga0495675_0002207_10188_11450 | 412 |
| 204 | 3300047446 | Ga0495679_000344 | Ga0495679_000344_10670_11932 | 412 |
| 205 | 3300047673 | Ga0495593_0006738 | Ga0495593_0006738_1097_2359 | 412 |
| 206 | 3300048088 | Ga0495602_0017269 | Ga0495602_0017269_3545_4807 | 412 |
| 207 | 3300048089 | Ga0495614_0015846 | Ga0495614_0015846_225_1487 | 412 |
| 208 | 3300053148 | Ga0500590_016027 | Ga0500590_016027_2082_3359 | 412 |
| 209 | iso_pu_bacteria | 2513237166 | 2514051563 | 412 |
| 210 | iso_pu_bacteria | 2711768613 | 2713476778 | 412 |
| 211 | iso_pu_bacteria | 2904615490 | 2904621455 | 412 |
| 212 | iso_pu_bacteria | 2921643360 | 2921651221 | 412 |
| 213 | iso_pu_bacteria | 642555112 | 642592995 | 412 |
| 214 | 3300009094 | Ga0111539_10037225 | Ga0111539_100372254 | 413 |
| 215 | 3300013307 | Ga0157372_10220896 | Ga0157372_102208962 | 413 |
| 216 | 3300025927 | Ga0207687_10102355 | Ga0207687_101023552 | 413 |
| 217 | 3300026089 | Ga0207648_10097865 | Ga0207648_100978653 | 413 |
| 218 | 3300037312 | Ga0395899_0003672 | Ga0395899_0003672_4893_6170 | 413 |
| 219 | 3300037418 | Ga0395900_0000532 | Ga0395900_0000532_1407_2684 | 413 |
| 220 | 3300037466 | Ga0395898_0133661 | Ga0395898_0133661_60_1337 | 413 |
| 221 | 3300037466 | Ga0395898_0198431 | Ga0395898_0198431_177_1454 | 413 |
| 222 | 3300037466 | Ga0395898_0258587 | Ga0395898_0258587_302_1579 | 413 |
| 223 | 3300037471 | Ga0395905_0132695 | Ga0395905_0132695_359_1636 | 413 |
| 224 | 3300038443 | Ga0395901_0000765 | Ga0395901_0000765_13080_14357 | 413 |
| 225 | 3300038443 | Ga0395901_0212631 | Ga0395901_0212631_412_1689 | 413 |
| 226 | 3300044684 | Ga0466966_0009150 | Ga0466966_0009150_5117_6394 | 413 |
| 227 | 3300044693 | Ga0466961_0026881 | Ga0466961_0026881_503_1780 | 413 |
| 228 | 3300044719 | Ga0466971_0031803 | Ga0466971_0031803_887_2164 | 413 |
| 229 | 3300046522 | Ga0495643_0022208 | Ga0495643_0022208_1352_2647 | 413 |
| 230 | 3300046528 | Ga0495642_0012289 | Ga0495642_0012289_863_2158 | 413 |
| 231 | 3300046665 | Ga0495661_0028910 | Ga0495661_0028910_1214_2509 | 413 |
| 232 | 3300048925 | Ga0496122_0004995 | Ga0496122_0004995_13623_14900 | 413 |
| 233 | 3300048926 | Ga0496123_0004595 | Ga0496123_0004595_12725_14002 | 413 |
| 234 | 3300049822 | Ga0501035_0000816 | Ga0501035_0000816_25308_26585 | 413 |
| 235 | 3300005719 | Ga0068861_100084734 | Ga0068861_1000847344 | 414 |
| 236 | 3300026118 | Ga0207675_100019900 | Ga0207675_1000199007 | 414 |
| 237 | 3300026142 | Ga0207698_10032211 | Ga0207698_100322112 | 414 |
| 238 | 3300042531 | Ga0450918_000020 | Ga0450918_000020_28424_29701 | 414 |
| 239 | 3300048913 | Ga0496110_0025062 | Ga0496110_0025062_3159_4454 | 414 |
| 240 | 3300003759 | Ga0055525_1000081 | Ga0055525_10000817 | 415 |
| 241 | 3300005355 | Ga0070671_100006234 | Ga0070671_1000062345 | 415 |
| 242 | 3300005563 | Ga0068855_100023836 | Ga0068855_1000238366 | 415 |
| 243 | 3300009148 | Ga0105243_10020229 | Ga0105243_100202293 | 415 |
| 244 | 3300009174 | Ga0105241_10024317 | Ga0105241_100243173 | 415 |
| 245 | 3300025230 | Ga0209563_100015 | Ga0209563_100015781 | 415 |
| 246 | 3300025911 | Ga0207654_10004080 | Ga0207654_100040803 | 415 |
| 247 | 3300025931 | Ga0207644_10003508 | Ga0207644_100035084 | 415 |
| 248 | 3300025949 | Ga0207667_10015769 | Ga0207667_100157693 | 415 |
| 249 | iso_pu_bacteria | 2643221556 | 2643800417 | 415 |
| 250 | iso_pu_bacteria | 2643221684 | 2644470326 | 415 |
| 251 | 3300044683 | Ga0466965_0004074 | Ga0466965_0004074_4831_6108 | 416 |
| 252 | 3300044706 | Ga0466964_0001291 | Ga0466964_0001291_4307_5584 | 416 |
| 253 | 3300044735 | Ga0466968_0000336 | Ga0466968_0000336_12733_14010 | 416 |
| 254 | 3300046531 | Ga0495665_0046020 | Ga0495665_0046020_90_1340 | 416 |
| 255 | 3300005354 | Ga0070675_100100919 | Ga0070675_1001009193 | 417 |
| 256 | 3300005617 | Ga0068859_100033940 | Ga0068859_1000339403 | 417 |
| 257 | 3300006931 | Ga0097620_100033938 | Ga0097620_1000339383 | 417 |
| 258 | 3300025926 | Ga0207659_10083917 | Ga0207659_100839173 | 417 |
| 259 | 3300025936 | Ga0207670_10180804 | Ga0207670_101808042 | 417 |
| 260 | 3300025937 | Ga0207669_10009370 | Ga0207669_100093704 | 417 |
| 261 | 3300031995 | Ga0307409_100015210 | Ga0307409_1000152106 | 417 |
| 262 | 3300032005 | Ga0307411_10007310 | Ga0307411_100073103 | 417 |
| 263 | 3300049580 | Ga0501046_0041180 | Ga0501046_0041180_715_1983 | 417 |
| 264 | 3300049822 | Ga0501035_0084945 | Ga0501035_0084945_1306_2574 | 417 |
| 265 | 3300013307 | Ga0157372_10147093 | Ga0157372_101470931 | 418 |
| 266 | 3300005328 | Ga0070676_10003180 | Ga0070676_100031802 | 419 |
| 267 | 3300005331 | Ga0070670_100008481 | Ga0070670_1000084817 | 419 |
| 268 | 3300005334 | Ga0068869_100047125 | Ga0068869_1000471253 | 419 |
| 269 | 3300005335 | Ga0070666_10081654 | Ga0070666_100816542 | 419 |
| 270 | 3300005338 | Ga0068868_100036751 | Ga0068868_1000367513 | 419 |
| 271 | 3300005354 | Ga0070675_100008750 | Ga0070675_1000087507 | 419 |
| 272 | 3300005355 | Ga0070671_100062343 | Ga0070671_1000623431 | 419 |
| 273 | 3300005364 | Ga0070673_100045968 | Ga0070673_1000459681 | 419 |
| 274 | 3300005459 | Ga0068867_100002311 | Ga0068867_10000231111 | 419 |
| 275 | 3300005543 | Ga0070672_100011658 | Ga0070672_1000116584 | 419 |
| 276 | 3300005577 | Ga0068857_100156892 | Ga0068857_1001568921 | 419 |
| 277 | 3300005841 | Ga0068863_100139114 | Ga0068863_1001391142 | 419 |
| 278 | 3300026089 | Ga0207648_10004518 | Ga0207648_1000451810 | 419 |
| 279 | 3300026116 | Ga0207674_10028584 | Ga0207674_100285842 | 419 |
| 280 | 3300031507 | Ga0307509_10000362 | Ga0307509_1000036225 | 419 |
| 281 | 3300031911 | Ga0307412_10099696 | Ga0307412_100996963 | 419 |
| 282 | 3300031995 | Ga0307409_100102200 | Ga0307409_1001022002 | 419 |
| 283 | 3300032002 | Ga0307416_100003413 | Ga0307416_1000034133 | 419 |
| 284 | 3300032126 | Ga0307415_100070129 | Ga0307415_1000701293 | 419 |
| 285 | iso_pu_bacteria | 2513237083 | 2513560375 | 419 |
| 286 | iso_pu_bacteria | 2842324504 | 2842326943 | 419 |
| 287 | iso_pu_bacteria | 2842348783 | 2842350548 | 419 |
| 288 | iso_pu_bacteria | 2842454564 | 2842456688 | 419 |
| 289 | iso_pu_bacteria | 2856287931 | 2856288963 | 419 |
| 290 | iso_pu_bacteria | 2857357740 | 2857363758 | 419 |
| 291 | iso_pu_bacteria | 2883087390 | 2883092546 | 419 |
| 292 | iso_pu_bacteria | 2904483920 | 2904487046 | 419 |
| 293 | iso_pu_bacteria | 2919527303 | 2919528358 | 419 |
| 294 | iso_pu_bacteria | 8003955200 | 8003958000 | 419 |
| 295 | 3300005456 | Ga0070678_100213830 | Ga0070678_1002138301 | 420 |
| 296 | 3300009094 | Ga0111539_10022189 | Ga0111539_100221892 | 420 |
| 297 | 3300015262 | Ga0182007_10027555 | Ga0182007_100275551 | 420 |
| 298 | 3300026121 | Ga0207683_10232189 | Ga0207683_102321892 | 420 |
| 299 | 3300027876 | Ga0209974_10003857 | Ga0209974_100038577 | 420 |
| 300 | 3300037471 | Ga0395905_0052012 | Ga0395905_0052012_441_1703 | 420 |
| 301 | 3300046525 | Ga0495663_0008721 | Ga0495663_0008721_698_1960 | 420 |
| 302 | 3300046528 | Ga0495642_0004046 | Ga0495642_0004046_2377_3639 | 420 |
| 303 | 3300047447 | Ga0495685_009832 | Ga0495685_009832_881_2143 | 420 |
| 304 | 3300048905 | Ga0496102_0000279 | Ga0496102_0000279_3685_4947 | 420 |
| 305 | 3300048905 | Ga0496102_0337121 | Ga0496102_0337121_136_1398 | 420 |
| 306 | 3300050507 | nmdc:mga05p37_90979_c1 | nmdc:mga05p37_90979_c1_1439_2713 | 420 |
| 307 | 3300005547 | Ga0070693_100003577 | Ga0070693_1000035774 | 421 |
| 308 | 3300009094 | Ga0111539_10425792 | Ga0111539_104257922 | 421 |
| 309 | 3300025925 | Ga0207650_10182815 | Ga0207650_101828152 | 421 |
| 310 | 3300025940 | Ga0207691_10268096 | Ga0207691_102680961 | 421 |
| 311 | 3300026095 | Ga0207676_10016097 | Ga0207676_100160974 | 421 |
| 312 | 3300046460 | Ga0495638_0025106 | Ga0495638_0025106_1473_2762 | 421 |
| 313 | 3300048905 | Ga0496102_0169740 | Ga0496102_0169740_490_1776 | 421 |
| 314 | 3300048913 | Ga0496110_0193534 | Ga0496110_0193534_371_1657 | 421 |
| 315 | 3300048917 | Ga0496114_0101885 | Ga0496114_0101885_926_2212 | 421 |
| 316 | iso_pu_bacteria | 8047673197 | 8047678716 | 421 |
| 317 | 3300006058 | Ga0075432_10016023 | Ga0075432_100160233 | 422 |
| 318 | 3300006353 | Ga0075370_10016805 | Ga0075370_100168053 | 422 |
| 319 | 3300027907 | Ga0207428_10048780 | Ga0207428_100487804 | 422 |
| 320 | 3300032004 | Ga0307414_10040091 | Ga0307414_100400912 | 422 |
| 321 | 3300032005 | Ga0307411_10028997 | Ga0307411_100289973 | 422 |
| 322 | iso_pu_bacteria | 2738541307 | 2738882111 | 422 |
| 323 | iso_pu_bacteria | 2818991446 | 2819598044 | 422 |
| 324 | iso_pu_bacteria | 2831265667 | 2831269034 | 422 |
| 325 | iso_pu_bacteria | 2899924645 | 2899929463 | 422 |
| 326 | iso_pu_bacteria | 2928037797 | 2928040093 | 422 |
| 327 | iso_pu_bacteria | 2928044640 | 2928047158 | 422 |
| 328 | iso_pu_bacteria | 2928051484 | 2928057639 | 422 |
| 329 | iso_pu_bacteria | 2928064002 | 2928067979 | 422 |
| 330 | iso_pu_bacteria | 2945909444 | 2945912086 | 422 |
| 331 | iso_pu_bacteria | 2945984333 | 2945985629 | 422 |
| 332 | 3300005295 | Ga0065707_10102580 | Ga0065707_101025802 | 423 |
| 333 | 3300005617 | Ga0068859_100036035 | Ga0068859_1000360352 | 423 |
| 334 | 3300006844 | Ga0075428_100005190 | Ga0075428_1000051907 | 423 |
| 335 | 3300006931 | Ga0097620_100036036 | Ga0097620_1000360362 | 423 |
| 336 | 3300009094 | Ga0111539_10004782 | Ga0111539_1000478210 | 423 |
| 337 | 3300009148 | Ga0105243_10008685 | Ga0105243_100086857 | 423 |
| 338 | 3300011119 | Ga0105246_10005667 | Ga0105246_100056674 | 423 |
| 339 | 3300013308 | Ga0157375_10009659 | Ga0157375_100096592 | 423 |
| 340 | 3300025931 | Ga0207644_10137580 | Ga0207644_101375802 | 423 |
| 341 | 3300025933 | Ga0207706_10030537 | Ga0207706_100305373 | 423 |
| 342 | 3300025938 | Ga0207704_10130213 | Ga0207704_101302131 | 423 |
| 343 | 3300025940 | Ga0207691_10007030 | Ga0207691_100070307 | 423 |
| 344 | 3300026023 | Ga0207677_10256746 | Ga0207677_102567461 | 423 |
| 345 | 3300028786 | Ga0307517_10022697 | Ga0307517_100226978 | 423 |
| 346 | 3300050508 | nmdc:mga09592_2480_c1 | nmdc:mga09592_2480_c1_10160_11461 | 423 |
| 347 | 3300050511 | nmdc:mga08y16_5490_c1 | nmdc:mga08y16_5490_c1_932_2233 | 423 |
| 348 | iso_pu_bacteria | 2885192300 | 2885194908 | 423 |
| 349 | iso_pu_bacteria | 2919704043 | 2919706133 | 423 |
| 350 | 3300003322 | rootL2_10229093 | rootL2_102290933 | 424 |
| 351 | 3300003771 | Ga0055526_1004027 | Ga0055526_10040278 | 424 |
| 352 | 3300003781 | Ga0055536_1000311 | Ga0055536_100031124 | 424 |
| 353 | 3300003784 | Ga0055534_1000122 | Ga0055534_100012227 | 424 |
| 354 | 3300005288 | Ga0065714_10084178 | Ga0065714_100841781 | 424 |
| 355 | 3300005330 | Ga0070690_100016783 | Ga0070690_1000167834 | 424 |
| 356 | 3300005365 | Ga0070688_100005610 | Ga0070688_1000056104 | 424 |
| 357 | 3300005367 | Ga0070667_100027282 | Ga0070667_1000272823 | 424 |
| 358 | 3300005547 | Ga0070693_100111353 | Ga0070693_1001113532 | 424 |
| 359 | 3300005549 | Ga0070704_100167852 | Ga0070704_1001678522 | 424 |
| 360 | 3300005617 | Ga0068859_100121205 | Ga0068859_1001212054 | 424 |
| 361 | 3300005842 | Ga0068858_100023855 | Ga0068858_1000238553 | 424 |
| 362 | 3300006931 | Ga0097620_100121207 | Ga0097620_1001212074 | 424 |
| 363 | 3300009093 | Ga0105240_10324486 | Ga0105240_103244861 | 424 |
| 364 | 3300009098 | Ga0105245_10025899 | Ga0105245_100258994 | 424 |
| 365 | 3300009148 | Ga0105243_10073832 | Ga0105243_100738322 | 424 |
| 366 | 3300009148 | Ga0105243_10156934 | Ga0105243_101569342 | 424 |
| 367 | 3300009176 | Ga0105242_10014279 | Ga0105242_100142795 | 424 |
| 368 | 3300009176 | Ga0105242_10251145 | Ga0105242_102511452 | 424 |
| 369 | 3300009177 | Ga0105248_10060209 | Ga0105248_100602092 | 424 |
| 370 | 3300011119 | Ga0105246_10216083 | Ga0105246_102160831 | 424 |
| 371 | 3300013297 | Ga0157378_10037143 | Ga0157378_100371434 | 424 |
| 372 | 3300013306 | Ga0163162_10028692 | Ga0163162_100286923 | 424 |
| 373 | 3300014497 | Ga0182008_10002058 | Ga0182008_100020583 | 424 |
| 374 | 3300015262 | Ga0182007_10001253 | Ga0182007_100012533 | 424 |
| 375 | 3300025291 | Ga0209675_1000120 | Ga0209675_100012081 | 424 |
| 376 | 3300025292 | Ga0209676_1000918 | Ga0209676_100091816 | 424 |
| 377 | 3300025294 | Ga0209025_1001195 | Ga0209025_100119516 | 424 |
| 378 | 3300025295 | Ga0209564_1000982 | Ga0209564_100098217 | 424 |
| 379 | 3300025934 | Ga0207686_10008036 | Ga0207686_100080365 | 424 |
| 380 | 3300025960 | Ga0207651_10293909 | Ga0207651_102939091 | 424 |
| 381 | 3300025986 | Ga0207658_10012437 | Ga0207658_100124372 | 424 |
| 382 | 3300026035 | Ga0207703_10053603 | Ga0207703_100536033 | 424 |
| 383 | 3300026078 | Ga0207702_10096428 | Ga0207702_100964282 | 424 |
| 384 | 3300026118 | Ga0207675_100233694 | Ga0207675_1002336941 | 424 |
| 385 | 3300026121 | Ga0207683_10059246 | Ga0207683_100592463 | 424 |
| 386 | 3300028577 | Ga0265318_10010305 | Ga0265318_100103054 | 424 |
| 387 | 3300028666 | Ga0265336_10001755 | Ga0265336_100017553 | 424 |
| 388 | 3300028800 | Ga0265338_10004084 | Ga0265338_100040845 | 424 |
| 389 | 3300029957 | Ga0265324_10008934 | Ga0265324_100089344 | 424 |
| 390 | 3300031240 | Ga0265320_10012959 | Ga0265320_100129594 | 424 |
| 391 | 3300031251 | Ga0265327_10005921 | Ga0265327_100059212 | 424 |
| 392 | 3300031344 | Ga0265316_10014355 | Ga0265316_100143552 | 424 |
| 393 | 3300031711 | Ga0265314_10003034 | Ga0265314_100030341 | 424 |
| 394 | 3300031731 | Ga0307405_10016521 | Ga0307405_100165212 | 424 |
| 395 | 3300031852 | Ga0307410_10008845 | Ga0307410_100088452 | 424 |
| 396 | 3300031901 | Ga0307406_10013812 | Ga0307406_100138122 | 424 |
| 397 | 3300032005 | Ga0307411_10074613 | Ga0307411_100746132 | 424 |
| 398 | 3300032126 | Ga0307415_100043205 | Ga0307415_1000432052 | 424 |
| 399 | 3300035695 | Ga0373927_0070937 | Ga0373927_0070937_18_1295 | 424 |
| 400 | 3300037068 | Ga0373925_0053742 | Ga0373925_0053742_134_1411 | 424 |
| 401 | 3300046459 | Ga0495629_0092876 | Ga0495629_0092876_205_1479 | 424 |
| 402 | 3300046475 | Ga0495639_0009692 | Ga0495639_0009692_1569_2843 | 424 |
| 403 | 3300048905 | Ga0496102_0043738 | Ga0496102_0043738_1266_2540 | 424 |
| 404 | 3300048906 | Ga0496103_0049140 | Ga0496103_0049140_971_2245 | 424 |
| 405 | 3300048907 | Ga0496104_0024837 | Ga0496104_0024837_1478_2752 | 424 |
| 406 | 3300048908 | Ga0496105_0037535 | Ga0496105_0037535_1183_2457 | 424 |
| 407 | 3300048913 | Ga0496110_0018524 | Ga0496110_0018524_1232_2506 | 424 |
| 408 | 3300048913 | Ga0496110_0175493 | Ga0496110_0175493_92_1366 | 424 |
| 409 | 3300048914 | Ga0496111_0025762 | Ga0496111_0025762_1527_2801 | 424 |
| 410 | 3300053136 | Ga0500559_0011246 | Ga0500559_0011246_761_2086 | 424 |
| 411 | 3300053140 | Ga0500573_0016722 | Ga0500573_0016722_1666_2991 | 424 |
| 412 | iso_pu_bacteria | 2643221644 | 2644248681 | 424 |
| 413 | iso_pu_bacteria | 2842747753 | 2842748978 | 424 |
| 414 | 3300003322 | rootL2_10003812 | rootL2_100038127 | 425 |
| 415 | 3300005329 | Ga0070683_100016319 | Ga0070683_1000163192 | 425 |
| 416 | 3300005330 | Ga0070690_100114862 | Ga0070690_1001148621 | 425 |
| 417 | 3300005331 | Ga0070670_100027500 | Ga0070670_1000275001 | 425 |
| 418 | 3300005331 | Ga0070670_100141349 | Ga0070670_1001413492 | 425 |
| 419 | 3300005333 | Ga0070677_10002361 | Ga0070677_100023612 | 425 |
| 420 | 3300005334 | Ga0068869_100071431 | Ga0068869_1000714312 | 425 |
| 421 | 3300005335 | Ga0070666_10022166 | Ga0070666_100221662 | 425 |
| 422 | 3300005338 | Ga0068868_100006737 | Ga0068868_1000067377 | 425 |
| 423 | 3300005344 | Ga0070661_100005733 | Ga0070661_1000057333 | 425 |
| 424 | 3300005344 | Ga0070661_100114766 | Ga0070661_1001147661 | 425 |
| 425 | 3300005354 | Ga0070675_100003131 | Ga0070675_1000031319 | 425 |
| 426 | 3300005354 | Ga0070675_100067216 | Ga0070675_1000672162 | 425 |
| 427 | 3300005354 | Ga0070675_100201977 | Ga0070675_1002019772 | 425 |
| 428 | 3300005355 | Ga0070671_100013088 | Ga0070671_1000130883 | 425 |
| 429 | 3300005356 | Ga0070674_100058263 | Ga0070674_1000582632 | 425 |
| 430 | 3300005364 | Ga0070673_100076727 | Ga0070673_1000767272 | 425 |
| 431 | 3300005364 | Ga0070673_100241587 | Ga0070673_1002415871 | 425 |
| 432 | 3300005367 | Ga0070667_100046717 | Ga0070667_1000467172 | 425 |
| 433 | 3300005455 | Ga0070663_100044327 | Ga0070663_1000443273 | 425 |
| 434 | 3300005457 | Ga0070662_100143323 | Ga0070662_1001433232 | 425 |
| 435 | 3300005459 | Ga0068867_100175642 | Ga0068867_1001756421 | 425 |
| 436 | 3300005459 | Ga0068867_100185725 | Ga0068867_1001857252 | 425 |
| 437 | 3300005459 | Ga0068867_100201238 | Ga0068867_1002012381 | 425 |
| 438 | 3300005471 | Ga0070698_100011813 | Ga0070698_1000118134 | 425 |
| 439 | 3300005539 | Ga0068853_100145314 | Ga0068853_1001453142 | 425 |
| 440 | 3300005543 | Ga0070672_100045038 | Ga0070672_1000450382 | 425 |
| 441 | 3300005548 | Ga0070665_100114259 | Ga0070665_1001142592 | 425 |
| 442 | 3300005549 | Ga0070704_100003754 | Ga0070704_1000037542 | 425 |
| 443 | 3300005564 | Ga0070664_100019005 | Ga0070664_1000190053 | 425 |
| 444 | 3300005577 | Ga0068857_100039610 | Ga0068857_1000396106 | 425 |
| 445 | 3300005616 | Ga0068852_100001203 | Ga0068852_10000120312 | 425 |
| 446 | 3300005617 | Ga0068859_100001157 | Ga0068859_10000115711 | 425 |
| 447 | 3300005618 | Ga0068864_100000432 | Ga0068864_10000043228 | 425 |
| 448 | 3300005618 | Ga0068864_100011633 | Ga0068864_1000116338 | 425 |
| 449 | 3300005618 | Ga0068864_100195970 | Ga0068864_1001959702 | 425 |
| 450 | 3300005718 | Ga0068866_10077396 | Ga0068866_100773962 | 425 |
| 451 | 3300005834 | Ga0068851_10009554 | Ga0068851_100095545 | 425 |
| 452 | 3300005840 | Ga0068870_10054364 | Ga0068870_100543642 | 425 |
| 453 | 3300005840 | Ga0068870_10077819 | Ga0068870_100778192 | 425 |
| 454 | 3300005841 | Ga0068863_100003841 | Ga0068863_10000384112 | 425 |
| 455 | 3300005841 | Ga0068863_100021826 | Ga0068863_1000218267 | 425 |
| 456 | 3300005841 | Ga0068863_100051848 | Ga0068863_1000518483 | 425 |
| 457 | 3300005842 | Ga0068858_100027380 | Ga0068858_1000273802 | 425 |
| 458 | 3300005844 | Ga0068862_100255010 | Ga0068862_1002550102 | 425 |
| 459 | 3300006048 | Ga0075363_100091824 | Ga0075363_1000918241 | 425 |
| 460 | 3300006177 | Ga0075362_10015066 | Ga0075362_100150663 | 425 |
| 461 | 3300006237 | Ga0097621_100199374 | Ga0097621_1001993742 | 425 |
| 462 | 3300006358 | Ga0068871_100036096 | Ga0068871_1000360962 | 425 |
| 463 | 3300006846 | Ga0075430_100015096 | Ga0075430_1000150967 | 425 |
| 464 | 3300006931 | Ga0097620_100001157 | Ga0097620_10000115711 | 425 |
| 465 | 3300009147 | Ga0114129_10339812 | Ga0114129_103398122 | 425 |
| 466 | 3300009147 | Ga0114129_10478489 | Ga0114129_104784892 | 425 |
| 467 | 3300009148 | Ga0105243_10158812 | Ga0105243_101588122 | 425 |
| 468 | 3300009176 | Ga0105242_10002231 | Ga0105242_100022318 | 425 |
| 469 | 3300009176 | Ga0105242_10181326 | Ga0105242_101813262 | 425 |
| 470 | 3300009177 | Ga0105248_10020065 | Ga0105248_100200655 | 425 |
| 471 | 3300009177 | Ga0105248_10249680 | Ga0105248_102496802 | 425 |
| 472 | 3300013105 | Ga0157369_10115690 | Ga0157369_101156902 | 425 |
| 473 | 3300013297 | Ga0157378_10052405 | Ga0157378_100524053 | 425 |
| 474 | 3300013308 | Ga0157375_10026803 | Ga0157375_100268032 | 425 |
| 475 | 3300013308 | Ga0157375_10060881 | Ga0157375_100608812 | 425 |
| 476 | 3300014325 | Ga0163163_10007305 | Ga0163163_100073058 | 425 |
| 477 | 3300014968 | Ga0157379_10006277 | Ga0157379_100062779 | 425 |
| 478 | 3300017792 | Ga0163161_10037759 | Ga0163161_100377592 | 425 |
| 479 | 3300017792 | Ga0163161_10102846 | Ga0163161_101028462 | 425 |
| 480 | 3300025893 | Ga0207682_10000677 | Ga0207682_1000067714 | 425 |
| 481 | 3300025901 | Ga0207688_10029342 | Ga0207688_100293423 | 425 |
| 482 | 3300025903 | Ga0207680_10004782 | Ga0207680_100047823 | 425 |
| 483 | 3300025907 | Ga0207645_10137757 | Ga0207645_101377572 | 425 |
| 484 | 3300025908 | Ga0207643_10035712 | Ga0207643_100357122 | 425 |
| 485 | 3300025919 | Ga0207657_10004403 | Ga0207657_100044036 | 425 |
| 486 | 3300025920 | Ga0207649_10012209 | Ga0207649_100122093 | 425 |
| 487 | 3300025925 | Ga0207650_10005355 | Ga0207650_100053553 | 425 |
| 488 | 3300025925 | Ga0207650_10021295 | Ga0207650_100212952 | 425 |
| 489 | 3300025925 | Ga0207650_10052406 | Ga0207650_100524062 | 425 |
| 490 | 3300025926 | Ga0207659_10001257 | Ga0207659_1000125712 | 425 |
| 491 | 3300025926 | Ga0207659_10038396 | Ga0207659_100383962 | 425 |
| 492 | 3300025926 | Ga0207659_10212884 | Ga0207659_102128842 | 425 |
| 493 | 3300025931 | Ga0207644_10026722 | Ga0207644_100267222 | 425 |
| 494 | 3300025932 | Ga0207690_10014969 | Ga0207690_100149692 | 425 |
| 495 | 3300025933 | Ga0207706_10036810 | Ga0207706_100368104 | 425 |
| 496 | 3300025933 | Ga0207706_10049363 | Ga0207706_100493633 | 425 |
| 497 | 3300025933 | Ga0207706_10061044 | Ga0207706_100610442 | 425 |
| 498 | 3300025934 | Ga0207686_10004796 | Ga0207686_100047962 | 425 |
| 499 | 3300025935 | Ga0207709_10064594 | Ga0207709_100645942 | 425 |
| 500 | 3300025935 | Ga0207709_10095786 | Ga0207709_100957862 | 425 |
| 501 | 3300025937 | Ga0207669_10015234 | Ga0207669_100152342 | 425 |
| 502 | 3300025938 | Ga0207704_10085452 | Ga0207704_100854522 | 425 |
| 503 | 3300025941 | Ga0207711_10022297 | Ga0207711_100222972 | 425 |
| 504 | 3300025941 | Ga0207711_10023504 | Ga0207711_100235043 | 425 |
| 505 | 3300025941 | Ga0207711_10235859 | Ga0207711_102358592 | 425 |
| 506 | 3300025942 | Ga0207689_10036416 | Ga0207689_100364163 | 425 |
| 507 | 3300025942 | Ga0207689_10069755 | Ga0207689_100697552 | 425 |
| 508 | 3300025942 | Ga0207689_10121572 | Ga0207689_101215722 | 425 |
| 509 | 3300025944 | Ga0207661_10023282 | Ga0207661_100232826 | 425 |
| 510 | 3300025960 | Ga0207651_10216223 | Ga0207651_102162232 | 425 |
| 511 | 3300025986 | Ga0207658_10012117 | Ga0207658_100121172 | 425 |
| 512 | 3300026023 | Ga0207677_10003447 | Ga0207677_100034474 | 425 |
| 513 | 3300026035 | Ga0207703_10010387 | Ga0207703_100103876 | 425 |
| 514 | 3300026035 | Ga0207703_10044045 | Ga0207703_100440452 | 425 |
| 515 | 3300026067 | Ga0207678_10068085 | Ga0207678_100680851 | 425 |
| 516 | 3300026088 | Ga0207641_10006864 | Ga0207641_100068643 | 425 |
| 517 | 3300026088 | Ga0207641_10045855 | Ga0207641_100458553 | 425 |
| 518 | 3300026089 | Ga0207648_10010427 | Ga0207648_100104278 | 425 |
| 519 | 3300026089 | Ga0207648_10223160 | Ga0207648_102231602 | 425 |
| 520 | 3300026095 | Ga0207676_10000825 | Ga0207676_100008258 | 425 |
| 521 | 3300026095 | Ga0207676_10031805 | Ga0207676_100318053 | 425 |
| 522 | 3300026116 | Ga0207674_10008453 | Ga0207674_1000845314 | 425 |
| 523 | 3300026118 | Ga0207675_100049298 | Ga0207675_1000492982 | 425 |
| 524 | 3300026118 | Ga0207675_100071972 | Ga0207675_1000719722 | 425 |
| 525 | 3300026121 | Ga0207683_10014465 | Ga0207683_100144652 | 425 |
| 526 | 3300026121 | Ga0207683_10038409 | Ga0207683_100384094 | 425 |
| 527 | 3300026121 | Ga0207683_10051858 | Ga0207683_100518582 | 425 |
| 528 | 3300026142 | Ga0207698_10009113 | Ga0207698_100091134 | 425 |
| 529 | 3300026142 | Ga0207698_10016948 | Ga0207698_100169484 | 425 |
| 530 | 3300028380 | Ga0268265_10106495 | Ga0268265_101064952 | 425 |
| 531 | 3300037312 | Ga0395899_0057041 | Ga0395899_0057041_282_1559 | 425 |
| 532 | 3300037418 | Ga0395900_0011395 | Ga0395900_0011395_7198_8475 | 425 |
| 533 | 3300037471 | Ga0395905_0169701 | Ga0395905_0169701_237_1514 | 425 |
| 534 | 3300038443 | Ga0395901_0010811 | Ga0395901_0010811_2786_4063 | 425 |
| 535 | 3300038443 | Ga0395901_0150421 | Ga0395901_0150421_59_1336 | 425 |
| 536 | 3300042439 | Ga0439464_0005012 | Ga0439464_0005012_697_2001 | 425 |
| 537 | 3300044683 | Ga0466965_0010097 | Ga0466965_0010097_1670_2947 | 425 |
| 538 | 3300044684 | Ga0466966_0037902 | Ga0466966_0037902_709_1986 | 425 |
| 539 | 3300044684 | Ga0466966_0047195 | Ga0466966_0047195_390_1667 | 425 |
| 540 | 3300044842 | Ga0466957_0003305 | Ga0466957_0003305_5595_6872 | 425 |
| 541 | 3300045049 | Ga0466959_0090080 | Ga0466959_0090080_823_2100 | 425 |
| 542 | 3300046453 | Ga0495627_011509 | Ga0495627_011509_604_1881 | 425 |
| 543 | 3300046457 | Ga0495590_0000194 | Ga0495590_0000194_32781_34058 | 425 |
| 544 | 3300046471 | Ga0495650_0000173 | Ga0495650_0000173_77864_79144 | 425 |
| 545 | 3300046471 | Ga0495650_0001016 | Ga0495650_0001016_14179_15456 | 425 |
| 546 | 3300046473 | Ga0495582_0005030 | Ga0495582_0005030_4190_5467 | 425 |
| 547 | 3300046474 | Ga0495605_0000166 | Ga0495605_0000166_7605_8882 | 425 |
| 548 | 3300046474 | Ga0495605_0016349 | Ga0495605_0016349_1797_3074 | 425 |
| 549 | 3300046491 | Ga0495584_0000755 | Ga0495584_0000755_7055_8332 | 425 |
| 550 | 3300046491 | Ga0495584_0001114 | Ga0495584_0001114_4266_5543 | 425 |
| 551 | 3300046491 | Ga0495584_0021488 | Ga0495584_0021488_1619_2896 | 425 |
| 552 | 3300046492 | Ga0495585_0000742 | Ga0495585_0000742_25266_26543 | 425 |
| 553 | 3300046492 | Ga0495585_0008221 | Ga0495585_0008221_770_2047 | 425 |
| 554 | 3300046492 | Ga0495585_0017784 | Ga0495585_0017784_1852_3129 | 425 |
| 555 | 3300046492 | Ga0495585_0065816 | Ga0495585_0065816_174_1451 | 425 |
| 556 | 3300046499 | Ga0495594_0009364 | Ga0495594_0009364_1571_2848 | 425 |
| 557 | 3300046500 | Ga0495596_0000282 | Ga0495596_0000282_1744_3021 | 425 |
| 558 | 3300046500 | Ga0495596_0001341 | Ga0495596_0001341_11125_12402 | 425 |
| 559 | 3300046500 | Ga0495596_0017959 | Ga0495596_0017959_43_1320 | 425 |
| 560 | 3300046501 | Ga0495607_0000569 | Ga0495607_0000569_2548_3825 | 425 |
| 561 | 3300046501 | Ga0495607_0000761 | Ga0495607_0000761_6760_8037 | 425 |
| 562 | 3300046501 | Ga0495607_0002170 | Ga0495607_0002170_14750_16027 | 425 |
| 563 | 3300046501 | Ga0495607_0028022 | Ga0495607_0028022_1301_2578 | 425 |
| 564 | 3300046501 | Ga0495607_0043480 | Ga0495607_0043480_324_1601 | 425 |
| 565 | 3300046506 | Ga0495583_0003019 | Ga0495583_0003019_7361_8638 | 425 |
| 566 | 3300046507 | Ga0495606_0017721 | Ga0495606_0017721_1274_2551 | 425 |
| 567 | 3300046513 | Ga0495616_0006765 | Ga0495616_0006765_751_2028 | 425 |
| 568 | 3300046513 | Ga0495616_0015488 | Ga0495616_0015488_632_1909 | 425 |
| 569 | 3300046513 | Ga0495616_0019091 | Ga0495616_0019091_2018_3295 | 425 |
| 570 | 3300046513 | Ga0495616_0083987 | Ga0495616_0083987_46_1323 | 425 |
| 571 | 3300046519 | Ga0495632_0001724 | Ga0495632_0001724_7198_8475 | 425 |
| 572 | 3300046519 | Ga0495632_0019098 | Ga0495632_0019098_1852_3129 | 425 |
| 573 | 3300046522 | Ga0495643_0000983 | Ga0495643_0000983_4228_5505 | 425 |
| 574 | 3300046522 | Ga0495643_0001243 | Ga0495643_0001243_2710_3987 | 425 |
| 575 | 3300046522 | Ga0495643_0009267 | Ga0495643_0009267_2560_3837 | 425 |
| 576 | 3300046522 | Ga0495643_0018628 | Ga0495643_0018628_1704_2981 | 425 |
| 577 | 3300046522 | Ga0495643_0021644 | Ga0495643_0021644_1995_3272 | 425 |
| 578 | 3300046523 | Ga0495644_0013780 | Ga0495644_0013780_746_2023 | 425 |
| 579 | 3300046524 | Ga0495648_0002408 | Ga0495648_0002408_1732_3009 | 425 |
| 580 | 3300046524 | Ga0495648_0006066 | Ga0495648_0006066_7259_8536 | 425 |
| 581 | 3300046524 | Ga0495648_0006655 | Ga0495648_0006655_1203_2480 | 425 |
| 582 | 3300046525 | Ga0495663_0006301 | Ga0495663_0006301_1364_2641 | 425 |
| 583 | 3300046526 | Ga0495666_0007649 | Ga0495666_0007649_1632_2909 | 425 |
| 584 | 3300046528 | Ga0495642_0002646 | Ga0495642_0002646_3261_4538 | 425 |
| 585 | 3300046528 | Ga0495642_0016098 | Ga0495642_0016098_914_2191 | 425 |
| 586 | 3300046529 | Ga0495652_0124737 | Ga0495652_0124737_398_1681 | 425 |
| 587 | 3300046531 | Ga0495665_0011811 | Ga0495665_0011811_78_1355 | 425 |
| 588 | 3300046535 | Ga0495586_0044065 | Ga0495586_0044065_154_1431 | 425 |
| 589 | 3300046538 | Ga0495609_0000028 | Ga0495609_0000028_49518_50795 | 425 |
| 590 | 3300046538 | Ga0495609_0002870 | Ga0495609_0002870_6614_7891 | 425 |
| 591 | 3300046538 | Ga0495609_0005090 | Ga0495609_0005090_2136_3413 | 425 |
| 592 | 3300046538 | Ga0495609_0029527 | Ga0495609_0029527_501_1778 | 425 |
| 593 | 3300046542 | Ga0495597_0007716 | Ga0495597_0007716_1986_3263 | 425 |
| 594 | 3300046558 | Ga0495633_0025626 | Ga0495633_0025626_1350_2627 | 425 |
| 595 | 3300046558 | Ga0495633_0026080 | Ga0495633_0026080_230_1534 | 425 |
| 596 | 3300046615 | Ga0495656_0001209 | Ga0495656_0001209_2468_3745 | 425 |
| 597 | 3300046616 | Ga0495668_0093555 | Ga0495668_0093555_332_1615 | 425 |
| 598 | 3300046642 | Ga0495634_0000991 | Ga0495634_0000991_5511_6788 | 425 |
| 599 | 3300046648 | Ga0495611_0043745 | Ga0495611_0043745_695_1972 | 425 |
| 600 | 3300046660 | Ga0495625_0055874 | Ga0495625_0055874_1397_2674 | 425 |
| 601 | 3300046664 | Ga0495659_0008002 | Ga0495659_0008002_1376_2653 | 425 |
| 602 | 3300046665 | Ga0495661_0000157 | Ga0495661_0000157_18106_19383 | 425 |
| 603 | 3300046665 | Ga0495661_0002008 | Ga0495661_0002008_14460_15737 | 425 |
| 604 | 3300046665 | Ga0495661_0004573 | Ga0495661_0004573_8404_9681 | 425 |
| 605 | 3300046665 | Ga0495661_0018779 | Ga0495661_0018779_2347_3624 | 425 |
| 606 | 3300046665 | Ga0495661_0031969 | Ga0495661_0031969_776_2080 | 425 |
| 607 | 3300046665 | Ga0495661_0044035 | Ga0495661_0044035_333_1610 | 425 |
| 608 | 3300046665 | Ga0495661_0046669 | Ga0495661_0046669_350_1627 | 425 |
| 609 | 3300046665 | Ga0495661_0060555 | Ga0495661_0060555_719_1996 | 425 |
| 610 | 3300046665 | Ga0495661_0084247 | Ga0495661_0084247_459_1736 | 425 |
| 611 | 3300046674 | Ga0495588_0000113 | Ga0495588_0000113_62090_63367 | 425 |
| 612 | 3300046679 | Ga0495623_0034581 | Ga0495623_0034581_1480_2763 | 425 |
| 613 | 3300046684 | Ga0495669_0048026 | Ga0495669_0048026_262_1539 | 425 |
| 614 | 3300046691 | Ga0495670_0012681 | Ga0495670_0012681_820_2124 | 425 |
| 615 | 3300046694 | Ga0495649_0052867 | Ga0495649_0052867_889_2166 | 425 |
| 616 | 3300046794 | Ga0495589_0000098 | Ga0495589_0000098_33209_34486 | 425 |
| 617 | 3300046794 | Ga0495589_0000117 | Ga0495589_0000117_14878_16155 | 425 |
| 618 | 3300046794 | Ga0495589_0025125 | Ga0495589_0025125_990_2267 | 425 |
| 619 | 3300046810 | Ga0495660_0005424 | Ga0495660_0005424_2887_4164 | 425 |
| 620 | 3300047317 | Ga0495604_0097389 | Ga0495604_0097389_740_2017 | 425 |
| 621 | 3300047318 | Ga0495636_0009716 | Ga0495636_0009716_254_1531 | 425 |
| 622 | 3300047320 | Ga0495672_0000014 | Ga0495672_0000014_95752_97140 | 425 |
| 623 | 3300047320 | Ga0495672_0000464 | Ga0495672_0000464_13559_14836 | 425 |
| 624 | 3300047320 | Ga0495672_0004632 | Ga0495672_0004632_7682_8959 | 425 |
| 625 | 3300047321 | Ga0495676_0071183 | Ga0495676_0071183_379_1656 | 425 |
| 626 | 3300047323 | Ga0495683_0000112 | Ga0495683_0000112_7159_8436 | 425 |
| 627 | 3300047323 | Ga0495683_0009188 | Ga0495683_0009188_3630_4907 | 425 |
| 628 | 3300047323 | Ga0495683_0032215 | Ga0495683_0032215_323_1600 | 425 |
| 629 | 3300047443 | Ga0495687_000054 | Ga0495687_000054_83561_84838 | 425 |
| 630 | 3300047443 | Ga0495687_000430 | Ga0495687_000430_43626_44903 | 425 |
| 631 | 3300047443 | Ga0495687_006707 | Ga0495687_006707_3084_4361 | 425 |
| 632 | 3300047444 | Ga0495675_0000641 | Ga0495675_0000641_1062_2339 | 425 |
| 633 | 3300047445 | Ga0495677_0000012 | Ga0495677_0000012_83418_84695 | 425 |
| 634 | 3300047445 | Ga0495677_0000154 | Ga0495677_0000154_22784_24061 | 425 |
| 635 | 3300047445 | Ga0495677_0001386 | Ga0495677_0001386_8348_9625 | 425 |
| 636 | 3300047445 | Ga0495677_0003569 | Ga0495677_0003569_528_1805 | 425 |
| 637 | 3300047445 | Ga0495677_0004324 | Ga0495677_0004324_3827_5131 | 425 |
| 638 | 3300047470 | Ga0495681_0042084 | Ga0495681_0042084_22_1299 | 425 |
| 639 | 3300047472 | Ga0495686_0000219 | Ga0495686_0000219_45579_46856 | 425 |
| 640 | 3300047472 | Ga0495686_0046279 | Ga0495686_0046279_639_1979 | 425 |
| 641 | 3300048088 | Ga0495602_0002022 | Ga0495602_0002022_12810_14087 | 425 |
| 642 | 3300048091 | Ga0495626_0000036 | Ga0495626_0000036_107121_108398 | 425 |
| 643 | 3300048091 | Ga0495626_0000603 | Ga0495626_0000603_7458_8735 | 425 |
| 644 | 3300048091 | Ga0495626_0001290 | Ga0495626_0001290_16030_17307 | 425 |
| 645 | 3300048091 | Ga0495626_0006446 | Ga0495626_0006446_4399_5676 | 425 |
| 646 | 3300048091 | Ga0495626_0007753 | Ga0495626_0007753_98_1375 | 425 |
| 647 | 3300048091 | Ga0495626_0016949 | Ga0495626_0016949_984_2261 | 425 |
| 648 | 3300048091 | Ga0495626_0058503 | Ga0495626_0058503_247_1551 | 425 |
| 649 | 3300048906 | Ga0496103_0049118 | Ga0496103_0049118_1058_2335 | 425 |
| 650 | 3300048908 | Ga0496105_0006505 | Ga0496105_0006505_7013_8308 | 425 |
| 651 | 3300048909 | Ga0496106_0009466 | Ga0496106_0009466_1180_2457 | 425 |
| 652 | 3300048917 | Ga0496114_0031518 | Ga0496114_0031518_741_2036 | 425 |
| 653 | 3300048927 | Ga0496124_0124526 | Ga0496124_0124526_587_1864 | 425 |
| 654 | 3300049459 | Ga0495678_002126 | Ga0495678_002126_4002_5282 | 425 |
| 655 | 3300049459 | Ga0495678_010341 | Ga0495678_010341_2735_4015 | 425 |
| 656 | 3300049526 | Ga0501303_001395 | Ga0501303_001395_311_1588 | 425 |
| 657 | 3300050496 | nmdc:mga07m45_80278_c1 | nmdc:mga07m45_80278_c1_451_1728 | 425 |
| 658 | 3300050516 | nmdc:mga0sz30_9719_c1 | nmdc:mga0sz30_9719_c1_2015_3310 | 425 |
| 659 | 3300061719 | Ga0466962_0026080 | Ga0466962_0026080_548_1825 | 425 |
| 660 | iso_pu_bacteria | 2842733646 | 2842738904 | 425 |
| 661 | iso_pu_bacteria | 2904541872 | 2904545458 | 425 |
| 662 | iso_pu_bacteria | 2929160207 | 2929168097 | 425 |
| 663 | 3300001979 | JGI24740J21852_10014361 | JGI24740J21852_100143613 | 426 |
| 664 | 3300002987 | JGI25159J45721_1011057 | JGI25159J45721_10110572 | 426 |
| 665 | 3300003187 | JGI25151J46595_10000695 | JGI25151J46595_1000069512 | 426 |
| 666 | 3300003320 | rootH2_10072399 | rootH2_100723992 | 426 |
| 667 | 3300003578 | Ga0006562J51391_1083712 | Ga0006562J51391_10837123 | 426 |
| 668 | 3300003761 | Ga0055535_1005347 | Ga0055535_10053473 | 426 |
| 669 | 3300003762 | Ga0055542_1000003 | Ga0055542_100000332 | 426 |
| 670 | 3300005262 | Ga0065165_1021691 | Ga0065165_10216912 | 426 |
| 671 | 3300005289 | Ga0065704_10154625 | Ga0065704_101546251 | 426 |
| 672 | 3300005327 | Ga0070658_10102832 | Ga0070658_101028322 | 426 |
| 673 | 3300005334 | Ga0068869_100041629 | Ga0068869_1000416294 | 426 |
| 674 | 3300005335 | Ga0070666_10142253 | Ga0070666_101422532 | 426 |
| 675 | 3300005340 | Ga0070689_100052468 | Ga0070689_1000524683 | 426 |
| 676 | 3300005353 | Ga0070669_100007962 | Ga0070669_1000079626 | 426 |
| 677 | 3300005354 | Ga0070675_100033538 | Ga0070675_1000335384 | 426 |
| 678 | 3300005441 | Ga0070700_100013454 | Ga0070700_1000134544 | 426 |
| 679 | 3300005563 | Ga0068855_100065592 | Ga0068855_1000655922 | 426 |
| 680 | 3300005564 | Ga0070664_100022410 | Ga0070664_1000224103 | 426 |
| 681 | 3300005616 | Ga0068852_100037047 | Ga0068852_1000370473 | 426 |
| 682 | 3300005617 | Ga0068859_100042745 | Ga0068859_1000427455 | 426 |
| 683 | 3300005834 | Ga0068851_10001660 | Ga0068851_100016605 | 426 |
| 684 | 3300005842 | Ga0068858_100045414 | Ga0068858_1000454143 | 426 |
| 685 | 3300005843 | Ga0068860_100106666 | Ga0068860_1001066664 | 426 |
| 686 | 3300005844 | Ga0068862_100014905 | Ga0068862_1000149055 | 426 |
| 687 | 3300006177 | Ga0075362_10043920 | Ga0075362_100439202 | 426 |
| 688 | 3300006237 | Ga0097621_100104451 | Ga0097621_1001044512 | 426 |
| 689 | 3300006353 | Ga0075370_10001330 | Ga0075370_100013305 | 426 |
| 690 | 3300006358 | Ga0068871_100039244 | Ga0068871_1000392442 | 426 |
| 691 | 3300006881 | Ga0068865_100034173 | Ga0068865_1000341733 | 426 |
| 692 | 3300006931 | Ga0097620_100042744 | Ga0097620_1000427444 | 426 |
| 693 | 3300009093 | Ga0105240_10013577 | Ga0105240_100135775 | 426 |
| 694 | 3300009093 | Ga0105240_10034345 | Ga0105240_100343452 | 426 |
| 695 | 3300009147 | Ga0114129_10037773 | Ga0114129_100377736 | 426 |
| 696 | 3300009176 | Ga0105242_10003323 | Ga0105242_100033232 | 426 |
| 697 | 3300009545 | Ga0105237_10000373 | Ga0105237_1000037357 | 426 |
| 698 | 3300009551 | Ga0105238_10007050 | Ga0105238_100070504 | 426 |
| 699 | 3300010375 | Ga0105239_10007855 | Ga0105239_100078554 | 426 |
| 700 | 3300010375 | Ga0105239_10027359 | Ga0105239_100273595 | 426 |
| 701 | 3300013100 | Ga0157373_10025982 | Ga0157373_100259825 | 426 |
| 702 | 3300013102 | Ga0157371_10023628 | Ga0157371_100236284 | 426 |
| 703 | 3300013104 | Ga0157370_10145322 | Ga0157370_101453222 | 426 |
| 704 | 3300013105 | Ga0157369_10011382 | Ga0157369_100113824 | 426 |
| 705 | 3300014325 | Ga0163163_10006631 | Ga0163163_100066319 | 426 |
| 706 | 3300014497 | Ga0182008_10000669 | Ga0182008_100006694 | 426 |
| 707 | 3300014497 | Ga0182008_10004332 | Ga0182008_100043326 | 426 |
| 708 | 3300014968 | Ga0157379_10232763 | Ga0157379_102327632 | 426 |
| 709 | 3300017792 | Ga0163161_10000117 | Ga0163161_1000011720 | 426 |
| 710 | 3300017792 | Ga0163161_10078831 | Ga0163161_100788312 | 426 |
| 711 | 3300017792 | Ga0163161_10100253 | Ga0163161_101002532 | 426 |
| 712 | 3300021384 | Ga0213876_10029348 | Ga0213876_100293482 | 426 |
| 713 | 3300025228 | Ga0209672_100709 | Ga0209672_1007095 | 426 |
| 714 | 3300025229 | Ga0209147_100791 | Ga0209147_1007918 | 426 |
| 715 | 3300025242 | Ga0209258_100015 | Ga0209258_100015150 | 426 |
| 716 | 3300025245 | Ga0207425_1000635 | Ga0207425_10006354 | 426 |
| 717 | 3300025254 | Ga0209148_1000028 | Ga0209148_1000028518 | 426 |
| 718 | 3300025284 | Ga0209130_1004806 | Ga0209130_10048062 | 426 |
| 719 | 3300025294 | Ga0209025_1000029 | Ga0209025_1000029293 | 426 |
| 720 | 3300025294 | Ga0209025_1000102 | Ga0209025_1000102138 | 426 |
| 721 | 3300025297 | Ga0209758_1008239 | Ga0209758_10082393 | 426 |
| 722 | 3300025298 | Ga0209050_1008771 | Ga0209050_10087711 | 426 |
| 723 | 3300025302 | Ga0207426_1010023 | Ga0207426_10100233 | 426 |
| 724 | 3300025321 | Ga0207656_10013430 | Ga0207656_100134303 | 426 |
| 725 | 3300025899 | Ga0207642_10015711 | Ga0207642_100157112 | 426 |
| 726 | 3300025909 | Ga0207705_10046473 | Ga0207705_100464733 | 426 |
| 727 | 3300025913 | Ga0207695_10018467 | Ga0207695_100184675 | 426 |
| 728 | 3300025914 | Ga0207671_10006670 | Ga0207671_100066708 | 426 |
| 729 | 3300025917 | Ga0207660_10084349 | Ga0207660_100843493 | 426 |
| 730 | 3300025918 | Ga0207662_10066090 | Ga0207662_100660903 | 426 |
| 731 | 3300025927 | Ga0207687_10039884 | Ga0207687_100398844 | 426 |
| 732 | 3300025934 | Ga0207686_10030105 | Ga0207686_100301054 | 426 |
| 733 | 3300025936 | Ga0207670_10051788 | Ga0207670_100517883 | 426 |
| 734 | 3300025938 | Ga0207704_10029962 | Ga0207704_100299622 | 426 |
| 735 | 3300025942 | Ga0207689_10008236 | Ga0207689_100082364 | 426 |
| 736 | 3300025942 | Ga0207689_10067944 | Ga0207689_100679442 | 426 |
| 737 | 3300025949 | Ga0207667_10179760 | Ga0207667_101797601 | 426 |
| 738 | 3300026035 | Ga0207703_10021334 | Ga0207703_100213343 | 426 |
| 739 | 3300026035 | Ga0207703_10205623 | Ga0207703_102056232 | 426 |
| 740 | 3300026041 | Ga0207639_10051558 | Ga0207639_100515582 | 426 |
| 741 | 3300026075 | Ga0207708_10002375 | Ga0207708_1000237510 | 426 |
| 742 | 3300026089 | Ga0207648_10006030 | Ga0207648_100060307 | 426 |
| 743 | 3300026118 | Ga0207675_100031263 | Ga0207675_1000312632 | 426 |
| 744 | 3300028379 | Ga0268266_10151459 | Ga0268266_101514592 | 426 |
| 745 | 3300028380 | Ga0268265_10186240 | Ga0268265_101862402 | 426 |
| 746 | 3300028794 | Ga0307515_10000873 | Ga0307515_1000087324 | 426 |
| 747 | 3300037471 | Ga0395905_0026610 | Ga0395905_0026610_3507_4814 | 426 |
| 748 | 3300037471 | Ga0395905_0047612 | Ga0395905_0047612_637_1932 | 426 |
| 749 | 3300037471 | Ga0395905_0091400 | Ga0395905_0091400_868_2181 | 426 |
| 750 | 3300037471 | Ga0395905_0238178 | Ga0395905_0238178_169_1449 | 426 |
| 751 | 3300039437 | Ga0436365_1875695 | Ga0436365_1875695_2890_4173 | 426 |
| 752 | 3300041404 | Ga0439436_0002503 | Ga0439436_0002503_2335_3618 | 426 |
| 753 | 3300041410 | Ga0439461_0002679 | Ga0439461_0002679_840_2123 | 426 |
| 754 | 3300041411 | Ga0439466_0004282 | Ga0439466_0004282_2033_3316 | 426 |
| 755 | 3300041413 | Ga0439465_0001337 | Ga0439465_0001337_792_2075 | 426 |
| 756 | 3300041997 | Ga0439431_0002212 | Ga0439431_0002212_1648_2931 | 426 |
| 757 | 3300041999 | Ga0439433_0000393 | Ga0439433_0000393_1190_2473 | 426 |
| 758 | 3300042004 | Ga0439445_0001138 | Ga0439445_0001138_4356_5639 | 426 |
| 759 | 3300042006 | Ga0439432_002995 | Ga0439432_002995_44_1354 | 426 |
| 760 | 3300042006 | Ga0439432_015490 | Ga0439432_015490_120_1403 | 426 |
| 761 | 3300042007 | Ga0439449_0000440 | Ga0439449_0000440_631_1914 | 426 |
| 762 | 3300042007 | Ga0439449_0002955 | Ga0439449_0002955_671_1981 | 426 |
| 763 | 3300042010 | Ga0439452_002568 | Ga0439452_002568_2226_3536 | 426 |
| 764 | 3300042010 | Ga0439452_004053 | Ga0439452_004053_2871_4154 | 426 |
| 765 | 3300042014 | Ga0439457_002668 | Ga0439457_002668_3555_4838 | 426 |
| 766 | 3300042015 | Ga0439462_0016150 | Ga0439462_0016150_263_1573 | 426 |
| 767 | 3300042115 | Ga0450911_000229 | Ga0450911_000229_18106_19407 | 426 |
| 768 | 3300042131 | Ga0450894_004420 | Ga0450894_004420_154_1491 | 426 |
| 769 | 3300042134 | Ga0450898_008797 | Ga0450898_008797_202_1491 | 426 |
| 770 | 3300042145 | Ga0450906_008648 | Ga0450906_008648_138_1448 | 426 |
| 771 | 3300042156 | Ga0439446_0001674 | Ga0439446_0001674_2569_3852 | 426 |
| 772 | 3300042435 | Ga0439434_0013114 | Ga0439434_0013114_910_2220 | 426 |
| 773 | 3300042435 | Ga0439434_0016440 | Ga0439434_0016440_58_1341 | 426 |
| 774 | 3300042532 | Ga0450893_0007321 | Ga0450893_0007321_208_1497 | 426 |
| 775 | 3300046471 | Ga0495650_0003845 | Ga0495650_0003845_527_1807 | 426 |
| 776 | 3300046528 | Ga0495642_0018068 | Ga0495642_0018068_1252_2535 | 426 |
| 777 | 3300046539 | Ga0495621_0009386 | Ga0495621_0009386_316_1758 | 426 |
| 778 | 3300046615 | Ga0495656_0000057 | Ga0495656_0000057_50770_52212 | 426 |
| 779 | 3300048090 | Ga0495615_0007699 | Ga0495615_0007699_607_1890 | 426 |
| 780 | 3300048904 | Ga0496101_0152460 | Ga0496101_0152460_238_1533 | 426 |
| 781 | 3300048911 | Ga0496108_0015356 | Ga0496108_0015356_1112_2395 | 426 |
| 782 | 3300048911 | Ga0496108_0095376 | Ga0496108_0095376_979_2271 | 426 |
| 783 | 3300048912 | Ga0496109_0087066 | Ga0496109_0087066_161_1444 | 426 |
| 784 | 3300048915 | Ga0496112_0008206 | Ga0496112_0008206_4933_6225 | 426 |
| 785 | 3300048916 | Ga0496113_0145983 | Ga0496113_0145983_483_1775 | 426 |
| 786 | 3300048920 | Ga0496117_0009273 | Ga0496117_0009273_3056_4375 | 426 |
| 787 | 3300048921 | Ga0496118_0005723 | Ga0496118_0005723_3204_4484 | 426 |
| 788 | 3300048925 | Ga0496122_0000039 | Ga0496122_0000039_165920_167254 | 426 |
| 789 | 3300048926 | Ga0496123_0000026 | Ga0496123_0000026_166016_167350 | 426 |
| 790 | 3300048928 | Ga0496125_0005683 | Ga0496125_0005683_1556_2839 | 426 |
| 791 | 3300050489 | nmdc:mga03683_30774_c1 | nmdc:mga03683_30774_c1_756_2045 | 426 |
| 792 | 3300050490 | nmdc:mga03n38_73780_c1 | nmdc:mga03n38_73780_c1_86_1375 | 426 |
| 793 | 3300050514 | nmdc:mga08x19_91616_c1 | nmdc:mga08x19_91616_c1_89_1378 | 426 |
| 794 | 3300053121 | Ga0500607_011616 | Ga0500607_011616_3260_4540 | 426 |
| 795 | iso_pu_bacteria | 2643221654 | 2644301903 | 426 |
| 796 | iso_pu_bacteria | 2738541277 | 2738721944 | 426 |
| 797 | iso_pu_bacteria | 2738543019 | 2739282308 | 426 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1byr-assembly1.cif.gz_A | crystal structure of a phospholipase d family member, nuc from salmonella typhimurium | 0.8577 | 244 | 401 |
| 1byr-assembly1.cif.gz_A | crystal structure of a phospholipase d family member, nuc from salmonella typhimurium | 0.8473 | 244 | 401 |
| 6ohr-assembly1.cif.gz_A | structure of compound 5 bound human phospholipase d1 catalytic domain | 0.8101 | 60 | 379 |
| 4gem-assembly1.cif.gz_B | crystal structure of zucchini (k171a) | 0.8047 | 247 | 400 |
| 6ohm-assembly1.cif.gz_A | structure of tungstate bound human phospholipase d2 catalytic domain | 0.801 | 60 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A6H8_316_458_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.9602 | 261 | 398 | 3.30.870.10 |
| af_Q2FWG8_323_468_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.9518 | 261 | 400 | 3.30.870.10 |
| af_P0AA84_201_339_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.9496 | 261 | 392 | 3.30.870.10 |
| af_Q54P99_397_594_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.9486 | 247 | 417 | 3.30.870.10 |
| af_Q2FYW4_304_492_3.30.870.10 | Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A | 0.9403 | 241 | 424 | 3.30.870.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527ZF64-F1-model_v4 | Phospholipase D (Choline phosphatase) | 0.9799 | 257 | 355 |
GO:0005576
GO:0008808 GO:0016020 GO:0032049 |
| AF-A0A519HAL0-F1-model_v4 | deleted | 0.9796 | 191 | 426 |
|
| AF-A0A519HAL0-F1-model_v4 | deleted | 0.9755 | 191 | 426 |
|
| AF-A0A536WF28-F1-model_v4 | Cardiolipin synthase B | 0.9749 | 256 | 426 |
GO:0030572
GO:0032049 |
| AF-A0A3S3RFX2-F1-model_v4 | Phospholipase D (Choline phosphatase) | 0.9747 | 180 | 426 |
GO:0005576
GO:0008808 GO:0016020 GO:0032049 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar