F481233

General Info

Members Datasets Scaffolds Average Seq Length
797 412 758 422

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10142253|Ga0070666_101422532
Length 474
Sequence MSRPMLQCSIMNLSRRRPTDIGDCRLPRADIQGANSVGRRSSQDTPPMIPPRSRTKAIFWTLVLSVVATVLVLAFTGGEKKLDEQVTREYALHDAQYQRSLGVMLGPPITEGNRFEALHNGDRIFPPMLAAIRSARQSITFETYIYWSGDIGRAFADALSERSRAGVKVHVLLDWVGSAKVDEEFVKEMEDAGVQIRKFHKPNWYDITRMNNRTHRKLLVVDGRIGFTGGVGIAPAWTGDAQDAEHWRDSHFKVEGPVVAQMQAVFMDNWIKVSGDVLHGERYFPPIARIGSGRAQMFSSSPSGGSESMHLMYLLSIAAATKSIDLSSAYFVPDDLTVGALVAARQRGVRVRIITPGPIIDSQTVRGASRAAWGPLLEAGAEISEYQPTMFHCKVFTVDGLLVSVGSTNFDNRSFRLNDEANLNIYDEAFAALQTVQFEADLKQSRRITLEGWRERPLTEKALEHLASLLSAQL

Samples

Sample ID Description Type Environment
1 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
8 2738541277 Variovorax sp. GV051 Isolate Unclassified
9 2738541307 Variovorax sp. GV008 Isolate Unclassified
10 2738543019 Variovorax sp. GV040 Isolate Unclassified
11 2818991446 Variovorax sp. 1180 Isolate Unclassified
12 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
13 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
14 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
15 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
16 2842733646 Variovorax sp. R-72446 Isolate Unclassified
17 2842747753 Variovorax sp. R-72060 Isolate Unclassified
18 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
19 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
20 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2899924645 Variovorax sp. 369 Isolate Unclassified
23 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
24 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
25 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
26 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
27 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
28 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
29 2928037797 Variovorax sp. 1126 Isolate Unclassified
30 2928044640 Variovorax sp. 1128 Isolate Unclassified
31 2928051484 Variovorax sp. 1133 Isolate Unclassified
32 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
35 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
38 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
41 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
44 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
61 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
79 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
222 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
223 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
224 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
225 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
234 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
235 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
236 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
247 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
248 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
249 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
253 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
254 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
255 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
256 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
257 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
258 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
259 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
260 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
261 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
262 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
263 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
264 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
265 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
266 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
267 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
268 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
282 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
294 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
299 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
308 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
309 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
313 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
320 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
321 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
324 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
325 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
326 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
327 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
336 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
341 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
342 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
343 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
347 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
348 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
349 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
350 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
351 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
352 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
353 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
354 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
355 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
356 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
357 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
358 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
363 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
364 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
365 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
380 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
381 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
382 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
383 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
384 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
385 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
386 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
387 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
388 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
389 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
390 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
401 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
404 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
405 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
406 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
407 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
408 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
409 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
410 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
411 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
412 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.98
Metatranscriptomes 0.13
Isolates 4.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.9
Nodule 1
Rhizoplane 4.64
Rhizosphere 79.3
Stem 0
Stem Tuber 0
Unclassified 7.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10014361 3300001979 Bacteria 2923
2 JGI25156J39149_1000817 3300002705 Bacteria 15862
3 JGI25159J45721_1011057 3300002987 Bacteria 2242
4 JGI25151J46595_10000695 3300003187 Bacteria 28309
5 rootH2_10027177 3300003320 Bacteria 3574
6 rootH2_10072399 3300003320 Bacteria 1755
7 rootL2_10003812 3300003322 Bacteria 12708
8 rootL2_10050965 3300003322 Bacteria 9047
9 rootL2_10229093 3300003322 Bacteria 3950
10 JGI25160J50197_1000284 3300003354 Bacteria 36681
11 Ga0006562J51391_1083712 3300003578 Bacteria 3760
12 Ga0055533_1000104 3300003756 Bacteria 106505
13 Ga0055532_1000003 3300003758 Bacteria 494004
14 Ga0055525_1000081 3300003759 Bacteria 161329
15 Ga0055527_1000006 3300003760 Bacteria 494004
16 Ga0055535_1000003 3300003761 Bacteria 494004
17 Ga0055535_1005347 3300003761 Bacteria 2841
18 Ga0055542_1000003 3300003762 Bacteria 582721
19 Ga0055542_1000007 3300003762 Bacteria 494004
20 Ga0055529_1000003 3300003763 Bacteria 494004
21 Ga0055526_1004027 3300003771 Bacteria 9030
22 Ga0055536_1000311 3300003781 Bacteria 36625
23 Ga0055534_1000122 3300003784 Bacteria 57847
24 Ga0065165_1002073 3300005262 Bacteria 18437
25 Ga0065165_1021691 3300005262 Bacteria 2223
26 Ga0065714_10084178 3300005288 Bacteria 2212
27 Ga0065704_10154625 3300005289 Bacteria 1401
28 Ga0065715_10027957 3300005293 Bacteria 1551
29 Ga0065707_10102580 3300005295 Bacteria 2797
30 Ga0070658_10102832 3300005327 Bacteria 2363
31 Ga0070658_10196924 3300005327 Bacteria 1699
32 Ga0070676_10003180 3300005328 Bacteria 8509
33 Ga0070683_100016319 3300005329 Bacteria 6548
34 Ga0070683_100073389 3300005329 Bacteria 3195
35 Ga0070690_100016783 3300005330 Bacteria 4394
36 Ga0070690_100114862 3300005330 Bacteria 1801
37 Ga0070670_100008481 3300005331 Bacteria 8765
38 Ga0070670_100027500 3300005331 Bacteria 4892
39 Ga0070670_100141349 3300005331 Bacteria 2082
40 Ga0070677_10002361 3300005333 Bacteria 6032
41 Ga0068869_100041629 3300005334 Bacteria 3291
42 Ga0068869_100047125 3300005334 Bacteria 3112
43 Ga0068869_100071431 3300005334 Bacteria 2570
44 Ga0070666_10022166 3300005335 Bacteria 4123
45 Ga0070666_10081654 3300005335 Bacteria 2210
46 Ga0070666_10142253 3300005335 Bacteria 1671
47 Ga0068868_100006737 3300005338 Bacteria 8157
48 Ga0068868_100036751 3300005338 Bacteria 3794
49 Ga0070689_100052468 3300005340 Bacteria 3154
50 Ga0070661_100005733 3300005344 Bacteria 8559
51 Ga0070661_100020175 3300005344 Bacteria 4752
52 Ga0070661_100114766 3300005344 Bacteria 2014
53 Ga0070668_100000690 3300005347 Bacteria 23000
54 Ga0070669_100007962 3300005353 Bacteria 7568
55 Ga0070675_100003131 3300005354 Bacteria 12512
56 Ga0070675_100008750 3300005354 Bacteria 7864
57 Ga0070675_100033538 3300005354 Bacteria 4163
58 Ga0070675_100067216 3300005354 Bacteria 2966
59 Ga0070675_100100919 3300005354 Bacteria 2430
60 Ga0070675_100201977 3300005354 Bacteria 1725
61 Ga0070671_100006234 3300005355 Bacteria 9501
62 Ga0070671_100013088 3300005355 Bacteria 6685
63 Ga0070671_100062343 3300005355 Bacteria 3105
64 Ga0070674_100058263 3300005356 Bacteria 2684
65 Ga0070673_100045968 3300005364 Bacteria 3389
66 Ga0070673_100076727 3300005364 Bacteria 2699
67 Ga0070673_100241587 3300005364 Bacteria 1570
68 Ga0070688_100005610 3300005365 Bacteria 6622
69 Ga0070667_100027282 3300005367 Bacteria 4752
70 Ga0070667_100046717 3300005367 Bacteria 3643
71 Ga0070714_100017632 3300005435 Bacteria 5787
72 Ga0070700_100013454 3300005441 Bacteria 4596
73 Ga0070663_100044327 3300005455 Bacteria 3135
74 Ga0070678_100213830 3300005456 Bacteria 1599
75 Ga0070662_100143323 3300005457 Bacteria 1854
76 Ga0068867_100002311 3300005459 Bacteria 13412
77 Ga0068867_100175642 3300005459 Bacteria 1699
78 Ga0068867_100185725 3300005459 Bacteria 1656
79 Ga0068867_100201238 3300005459 Bacteria 1594
80 Ga0070698_100011813 3300005471 Bacteria 9267
81 Ga0068853_100145314 3300005539 Bacteria 2131
82 Ga0070672_100011658 3300005543 Bacteria 6137
83 Ga0070672_100045038 3300005543 Bacteria 3410
84 Ga0070693_100003577 3300005547 Bacteria 7252
85 Ga0070693_100111353 3300005547 Bacteria 1684
86 Ga0070665_100114259 3300005548 Bacteria 2702
87 Ga0070704_100003754 3300005549 Bacteria 8745
88 Ga0070704_100167852 3300005549 Bacteria 1742
89 Ga0068855_100020707 3300005563 Bacteria 7887
90 Ga0068855_100023836 3300005563 Bacteria 7331
91 Ga0068855_100065592 3300005563 Bacteria 4233
92 Ga0070664_100009052 3300005564 Bacteria 8078
93 Ga0070664_100019005 3300005564 Bacteria 5650
94 Ga0070664_100022410 3300005564 Bacteria 5207
95 Ga0068857_100001323 3300005577 Bacteria 19468
96 Ga0068857_100039610 3300005577 Bacteria 4175
97 Ga0068857_100156892 3300005577 Bacteria 2064
98 Ga0068854_100008729 3300005578 Bacteria 6523
99 Ga0068856_100002037 3300005614 Bacteria 20987
100 Ga0068852_100001203 3300005616 Bacteria 17184
101 Ga0068852_100010271 3300005616 Bacteria 6985
102 Ga0068852_100037047 3300005616 Bacteria 4088
103 Ga0068859_100001157 3300005617 Bacteria 26939
104 Ga0068859_100033940 3300005617 Bacteria 5123
105 Ga0068859_100036035 3300005617 Bacteria 4965
106 Ga0068859_100042745 3300005617 Bacteria 4552
107 Ga0068859_100121205 3300005617 Bacteria 2682
108 Ga0068859_100175348 3300005617 Bacteria 2226
109 Ga0068864_100000432 3300005618 Bacteria 36300
110 Ga0068864_100011633 3300005618 Bacteria 7267
111 Ga0068864_100195970 3300005618 Bacteria 1853
112 Ga0068866_10077396 3300005718 Bacteria 1776
113 Ga0068861_100084734 3300005719 Bacteria 2489
114 Ga0068851_10001660 3300005834 Bacteria 9750
115 Ga0068851_10009554 3300005834 Bacteria 4514
116 Ga0068851_10016048 3300005834 Bacteria 3578
117 Ga0068870_10054364 3300005840 Bacteria 2129
118 Ga0068870_10077819 3300005840 Bacteria 1825
119 Ga0068863_100003841 3300005841 Bacteria 14856
120 Ga0068863_100021826 3300005841 Bacteria 6109
121 Ga0068863_100051848 3300005841 Bacteria 3888
122 Ga0068863_100139114 3300005841 Bacteria 2320
123 Ga0068858_100023855 3300005842 Bacteria 5699
124 Ga0068858_100027380 3300005842 Bacteria 5296
125 Ga0068858_100045414 3300005842 Bacteria 4071
126 Ga0068860_100106666 3300005843 Bacteria 2676
127 Ga0068862_100014905 3300005844 Bacteria 6457
128 Ga0068862_100028911 3300005844 Bacteria 4669
129 Ga0068862_100255010 3300005844 Bacteria 1600
130 Ga0081539_10003666 3300005985 Bacteria 18444
131 Ga0075363_100091824 3300006048 Bacteria 1672
132 Ga0075432_10016023 3300006058 Bacteria 2559
133 Ga0075362_10015066 3300006177 Bacteria 3137
134 Ga0075362_10043920 3300006177 Bacteria 1980
135 Ga0075369_10011318 3300006186 Bacteria 3509
136 Ga0097621_100104451 3300006237 Bacteria 2387
137 Ga0097621_100199374 3300006237 Bacteria 1737
138 Ga0075370_10000078 3300006353 Bacteria 29531
139 Ga0075370_10001330 3300006353 Bacteria 10606
140 Ga0075370_10016805 3300006353 Bacteria 3942
141 Ga0068871_100036096 3300006358 Bacteria 3933
142 Ga0068871_100039244 3300006358 Bacteria 3787
143 Ga0075428_100005190 3300006844 Bacteria 14466
144 Ga0075430_100015096 3300006846 Bacteria 6574
145 Ga0075429_100105785 3300006880 Bacteria 2458
146 Ga0068865_100034173 3300006881 Bacteria 3410
147 Ga0097620_100001157 3300006931 Bacteria 26939
148 Ga0097620_100033938 3300006931 Bacteria 5123
149 Ga0097620_100036036 3300006931 Bacteria 4965
150 Ga0097620_100042744 3300006931 Bacteria 4552
151 Ga0097620_100121207 3300006931 Bacteria 2682
152 Ga0097620_100175345 3300006931 Bacteria 2226
153 Ga0105240_10002223 3300009093 Bacteria 31573
154 Ga0105240_10013577 3300009093 Bacteria 11179
155 Ga0105240_10034345 3300009093 Bacteria 6542
156 Ga0105240_10324486 3300009093 Bacteria 1754
157 Ga0111539_10004782 3300009094 Bacteria 17670
158 Ga0111539_10022189 3300009094 Bacteria 7804
159 Ga0111539_10037225 3300009094 Bacteria 5878
160 Ga0111539_10425792 3300009094 Bacteria 1546
161 Ga0105245_10025899 3300009098 Bacteria 5159
162 Ga0105245_10075167 3300009098 Bacteria 3076
163 Ga0114129_10037773 3300009147 Bacteria 6815
164 Ga0114129_10339812 3300009147 Bacteria 1992
165 Ga0114129_10478489 3300009147 Bacteria 1630
166 Ga0105243_10008685 3300009148 Bacteria 7789
167 Ga0105243_10020229 3300009148 Bacteria 5047
168 Ga0105243_10073832 3300009148 Bacteria 2765
169 Ga0105243_10156934 3300009148 Bacteria 1958
170 Ga0105243_10158812 3300009148 Bacteria 1947
171 Ga0105241_10021547 3300009174 Bacteria 4766
172 Ga0105241_10024317 3300009174 Bacteria 4498
173 Ga0105242_10002231 3300009176 Bacteria 15286
174 Ga0105242_10003323 3300009176 Bacteria 12514
175 Ga0105242_10014279 3300009176 Bacteria 6152
176 Ga0105242_10181326 3300009176 Bacteria 1858
177 Ga0105242_10251145 3300009176 Bacteria 1594
178 Ga0105248_10020065 3300009177 Bacteria 7402
179 Ga0105248_10060209 3300009177 Bacteria 4263
180 Ga0105248_10067706 3300009177 Bacteria 4009
181 Ga0105248_10249680 3300009177 Bacteria 1997
182 Ga0105237_10000373 3300009545 Bacteria 63672
183 Ga0105237_10067780 3300009545 Bacteria 3562
184 Ga0105238_10007050 3300009551 Bacteria 11239
185 Ga0105238_10010414 3300009551 Bacteria 9334
186 Ga0105239_10007855 3300010375 Bacteria 12196
187 Ga0105239_10027359 3300010375 Bacteria 6277
188 Ga0105246_10005667 3300011119 Bacteria 7620
189 Ga0105246_10216083 3300011119 Bacteria 1500
190 Ga0157373_10025982 3300013100 Bacteria 4231
191 Ga0157371_10023628 3300013102 Bacteria 4496
192 Ga0157371_10062249 3300013102 Bacteria 2645
193 Ga0157370_10145322 3300013104 Bacteria 2209
194 Ga0157370_10199081 3300013104 Bacteria 1858
195 Ga0157369_10011382 3300013105 Bacteria 10102
196 Ga0157369_10015394 3300013105 Bacteria 8623
197 Ga0157369_10043206 3300013105 Bacteria 4913
198 Ga0157369_10115690 3300013105 Bacteria 2848
199 Ga0157378_10037143 3300013297 Bacteria 4314
200 Ga0157378_10052405 3300013297 Bacteria 3631
201 Ga0163162_10028692 3300013306 Bacteria 5508
202 Ga0157372_10008220 3300013307 Bacteria 11089
203 Ga0157372_10147093 3300013307 Unclassified 2717
204 Ga0157372_10220896 3300013307 Bacteria 2196
205 Ga0157375_10009659 3300013308 Bacteria 8481
206 Ga0157375_10026803 3300013308 Bacteria 5378
207 Ga0157375_10060881 3300013308 Bacteria 3746
208 Ga0163163_10006631 3300014325 Bacteria 10141
209 Ga0163163_10007305 3300014325 Bacteria 9743
210 Ga0157380_10030503 3300014326 Bacteria 4130
211 Ga0182008_10000669 3300014497 Bacteria 24850
212 Ga0182008_10002058 3300014497 Bacteria 12882
213 Ga0182008_10004332 3300014497 Bacteria 8303
214 Ga0157379_10006277 3300014968 Bacteria 10237
215 Ga0157379_10232763 3300014968 Bacteria 1670
216 Ga0182007_10001253 3300015262 Bacteria 13797
217 Ga0182007_10027555 3300015262 Bacteria 1958
218 Ga0183361_10006 3300016635 Bacteria 368532
219 Ga0163161_10000117 3300017792 Bacteria 75699
220 Ga0163161_10004592 3300017792 Bacteria 9610
221 Ga0163161_10037759 3300017792 Bacteria 3463
222 Ga0163161_10078831 3300017792 Bacteria 2421
223 Ga0163161_10100253 3300017792 Bacteria 2155
224 Ga0163161_10102846 3300017792 Bacteria 2128
225 Ga0213876_10029348 3300021384 Bacteria 2898
226 Ga0209674_100025 3300025226 Bacteria 515942
227 Ga0209672_100002 3300025228 Bacteria 1733325
228 Ga0209672_100709 3300025228 Bacteria 16591
229 Ga0209147_100003 3300025229 Bacteria 1733325
230 Ga0209147_100791 3300025229 Bacteria 15333
231 Ga0209563_100015 3300025230 Bacteria 879901
232 Ga0209563_101042 3300025230 Bacteria 8019
233 Ga0207427_101164 3300025231 Bacteria 10275
234 Ga0209258_100005 3300025242 Bacteria 1087938
235 Ga0209258_100015 3300025242 Bacteria 706310
236 Ga0207425_1000635 3300025245 Bacteria 19836
237 Ga0209148_1000006 3300025254 Bacteria 1733325
238 Ga0209148_1000028 3300025254 Bacteria 582773
239 Ga0209148_1000413 3300025254 Bacteria 48939
240 Ga0209759_1000014 3300025256 Bacteria 396291
241 Ga0209233_1000018 3300025261 Bacteria 886857
242 Ga0209455_1000003 3300025272 Bacteria 1471893
243 Ga0209130_1004806 3300025284 Bacteria 4960
244 Ga0209130_1015288 3300025284 Bacteria 1896
245 Ga0209675_1000120 3300025291 Bacteria 108551
246 Ga0209676_1000918 3300025292 Bacteria 36677
247 Ga0209025_1000029 3300025294 Bacteria 488571
248 Ga0209025_1000102 3300025294 Bacteria 228393
249 Ga0209025_1001195 3300025294 Bacteria 36677
250 Ga0209564_1000982 3300025295 Bacteria 35839
251 Ga0209564_1002345 3300025295 Bacteria 15292
252 Ga0209758_1008239 3300025297 Bacteria 6824
253 Ga0209050_1008771 3300025298 Bacteria 5315
254 Ga0207426_1000737 3300025302 Bacteria 37388
255 Ga0207426_1010023 3300025302 Bacteria 3707
256 Ga0207656_10013430 3300025321 Bacteria 3131
257 Ga0207656_10055245 3300025321 Bacteria 1728
258 Ga0207682_10000677 3300025893 Bacteria 15860
259 Ga0207642_10015711 3300025899 Bacteria 2830
260 Ga0207688_10029342 3300025901 Bacteria 3028
261 Ga0207680_10004782 3300025903 Bacteria 6448
262 Ga0207645_10137757 3300025907 Bacteria 1590
263 Ga0207643_10035712 3300025908 Bacteria 2788
264 Ga0207705_10046473 3300025909 Bacteria 3120
265 Ga0207705_10179559 3300025909 Bacteria 1597
266 Ga0207654_10004080 3300025911 Bacteria 7358
267 Ga0207695_10018467 3300025913 Bacteria 8064
268 Ga0207671_10006670 3300025914 Bacteria 10228
269 Ga0207660_10084349 3300025917 Bacteria 2342
270 Ga0207662_10066090 3300025918 Bacteria 2179
271 Ga0207657_10004403 3300025919 Bacteria 14895
272 Ga0207649_10010572 3300025920 Bacteria 5076
273 Ga0207649_10012209 3300025920 Bacteria 4757
274 Ga0207650_10005355 3300025925 Bacteria 8752
275 Ga0207650_10021295 3300025925 Bacteria 4582
276 Ga0207650_10052406 3300025925 Bacteria 3022
277 Ga0207650_10182815 3300025925 Bacteria 1672
278 Ga0207659_10001257 3300025926 Bacteria 15167
279 Ga0207659_10038396 3300025926 Bacteria 3331
280 Ga0207659_10083917 3300025926 Bacteria 2363
281 Ga0207659_10212884 3300025926 Bacteria 1550
282 Ga0207687_10039884 3300025927 Bacteria 3217
283 Ga0207687_10102355 3300025927 Bacteria 2110
284 Ga0207664_10009160 3300025929 Bacteria 6938
285 Ga0207644_10003508 3300025931 Bacteria 10153
286 Ga0207644_10026722 3300025931 Bacteria 3981
287 Ga0207644_10137580 3300025931 Bacteria 1877
288 Ga0207690_10014969 3300025932 Bacteria 4697
289 Ga0207706_10030537 3300025933 Bacteria 4807
290 Ga0207706_10036810 3300025933 Bacteria 4347
291 Ga0207706_10049363 3300025933 Bacteria 3719
292 Ga0207706_10061044 3300025933 Bacteria 3320
293 Ga0207686_10004796 3300025934 Bacteria 7259
294 Ga0207686_10008036 3300025934 Bacteria 5692
295 Ga0207686_10030105 3300025934 Bacteria 3210
296 Ga0207709_10064594 3300025935 Bacteria 2299
297 Ga0207709_10095786 3300025935 Bacteria 1951
298 Ga0207670_10051788 3300025936 Bacteria 2759
299 Ga0207670_10180804 3300025936 Bacteria 1588
300 Ga0207669_10009370 3300025937 Bacteria 4659
301 Ga0207669_10015234 3300025937 Bacteria 3873
302 Ga0207704_10029962 3300025938 Bacteria 3044
303 Ga0207704_10085452 3300025938 Bacteria 2054
304 Ga0207704_10130213 3300025938 Bacteria 1741
305 Ga0207691_10007030 3300025940 Bacteria 10858
306 Ga0207691_10268096 3300025940 Bacteria 1471
307 Ga0207711_10022297 3300025941 Bacteria 5294
308 Ga0207711_10023504 3300025941 Bacteria 5159
309 Ga0207711_10235859 3300025941 Bacteria 1676
310 Ga0207689_10008236 3300025942 Bacteria 9082
311 Ga0207689_10036416 3300025942 Bacteria 4086
312 Ga0207689_10067944 3300025942 Bacteria 2929
313 Ga0207689_10069755 3300025942 Bacteria 2888
314 Ga0207689_10121572 3300025942 Bacteria 2147
315 Ga0207661_10023282 3300025944 Bacteria 4678
316 Ga0207679_10009197 3300025945 Bacteria 6317
317 Ga0207667_10015769 3300025949 Bacteria 8568
318 Ga0207667_10038166 3300025949 Bacteria 5131
319 Ga0207667_10179760 3300025949 Bacteria 2173
320 Ga0207651_10216223 3300025960 Bacteria 1546
321 Ga0207651_10293909 3300025960 Bacteria 1348
322 Ga0207668_10010104 3300025972 Bacteria 5688
323 Ga0207668_10023525 3300025972 Bacteria 3962
324 Ga0207658_10012117 3300025986 Bacteria 5880
325 Ga0207658_10012437 3300025986 Bacteria 5815
326 Ga0207677_10003447 3300026023 Bacteria 8382
327 Ga0207677_10256746 3300026023 Bacteria 1422
328 Ga0207703_10010387 3300026035 Bacteria 7283
329 Ga0207703_10021334 3300026035 Bacteria 5071
330 Ga0207703_10044045 3300026035 Bacteria 3584
331 Ga0207703_10053603 3300026035 Bacteria 3278
332 Ga0207703_10205623 3300026035 Bacteria 1752
333 Ga0207639_10051558 3300026041 Bacteria 3130
334 Ga0207678_10068085 3300026067 Bacteria 3055
335 Ga0207708_10002375 3300026075 Bacteria 13829
336 Ga0207702_10019314 3300026078 Bacteria 5638
337 Ga0207702_10096428 3300026078 Bacteria 2601
338 Ga0207641_10006864 3300026088 Bacteria 9527
339 Ga0207641_10045855 3300026088 Bacteria 3683
340 Ga0207648_10004518 3300026089 Bacteria 14261
341 Ga0207648_10006030 3300026089 Bacteria 12086
342 Ga0207648_10010427 3300026089 Bacteria 8806
343 Ga0207648_10097865 3300026089 Bacteria 2568
344 Ga0207648_10223160 3300026089 Bacteria 1675
345 Ga0207676_10000825 3300026095 Bacteria 24199
346 Ga0207676_10016097 3300026095 Bacteria 5409
347 Ga0207676_10031805 3300026095 Bacteria 3970
348 Ga0207674_10000040 3300026116 Bacteria 130571
349 Ga0207674_10008453 3300026116 Bacteria 11889
350 Ga0207674_10028584 3300026116 Bacteria 5882
351 Ga0207675_100019900 3300026118 Bacteria 6265
352 Ga0207675_100031263 3300026118 Bacteria 4959
353 Ga0207675_100049298 3300026118 Bacteria 3931
354 Ga0207675_100071972 3300026118 Bacteria 3233
355 Ga0207675_100233694 3300026118 Bacteria 1774
356 Ga0207683_10014465 3300026121 Bacteria 6718
357 Ga0207683_10038409 3300026121 Bacteria 4173
358 Ga0207683_10051858 3300026121 Bacteria 3594
359 Ga0207683_10059246 3300026121 Bacteria 3364
360 Ga0207683_10232189 3300026121 Bacteria 1683
361 Ga0207698_10009113 3300026142 Bacteria 6306
362 Ga0207698_10016948 3300026142 Bacteria 4929
363 Ga0207698_10032211 3300026142 Bacteria 3794
364 Ga0209974_10003857 3300027876 Bacteria 5372
365 Ga0207428_10048780 3300027907 Bacteria 3395
366 Ga0268266_10151459 3300028379 Bacteria 2091
367 Ga0268265_10042827 3300028380 Bacteria 3362
368 Ga0268265_10106495 3300028380 Bacteria 2278
369 Ga0268265_10186240 3300028380 Bacteria 1788
370 Ga0265318_10010305 3300028577 Bacteria 4075
371 Ga0265336_10001755 3300028666 Bacteria 9510
372 Ga0307517_10022697 3300028786 Bacteria 7850
373 Ga0307515_10000873 3300028794 Bacteria 69237
374 Ga0265338_10004084 3300028800 Bacteria 19993
375 Ga0265324_10008934 3300029957 Bacteria 3943
376 Ga0265320_10012959 3300031240 Bacteria 4818
377 Ga0265327_10005921 3300031251 Bacteria 9985
378 Ga0265316_10014355 3300031344 Bacteria 6976
379 Ga0307509_10000362 3300031507 Bacteria 76407
380 Ga0265314_10003034 3300031711 Bacteria 16588
381 Ga0307405_10016521 3300031731 Bacteria 4027
382 Ga0307410_10008845 3300031852 Bacteria 5614
383 Ga0307406_10013812 3300031901 Bacteria 4634
384 Ga0307412_10099696 3300031911 Bacteria 2052
385 Ga0307409_100015210 3300031995 Bacteria 5040
386 Ga0307409_100102200 3300031995 Bacteria 2381
387 Ga0307416_100003413 3300032002 Bacteria 9324
388 Ga0307414_10040091 3300032004 Bacteria 3160
389 Ga0307411_10007310 3300032005 Bacteria 5611
390 Ga0307411_10028997 3300032005 Bacteria 3373
391 Ga0307411_10074613 3300032005 Bacteria 2312
392 Ga0307415_100043205 3300032126 Bacteria 3005
393 Ga0307415_100070129 3300032126 Bacteria 2460
394 Ga0373927_0070937 3300035695 Bacteria 2255
395 Ga0373925_0053742 3300037068 Bacteria 3012
396 Ga0395899_0003672 3300037312 Bacteria 12148
397 Ga0395899_0057041 3300037312 Bacteria 2884
398 Ga0395900_0000532 3300037418 Bacteria 53751
399 Ga0395900_0011395 3300037418 Bacteria 9100
400 Ga0395898_0133661 3300037466 Bacteria 2375
401 Ga0395898_0198431 3300037466 Bacteria 1916
402 Ga0395898_0258587 3300037466 Bacteria 1660
403 Ga0395905_0000076 3300037471 Bacteria 164190
404 Ga0395905_0026610 3300037471 Bacteria 5454
405 Ga0395905_0047612 3300037471 Bacteria 4017
406 Ga0395905_0052012 3300037471 Bacteria 3836
407 Ga0395905_0091400 3300037471 Bacteria 2854
408 Ga0395905_0132695 3300037471 Bacteria 2342
409 Ga0395905_0169701 3300037471 Bacteria 2049
410 Ga0395905_0238178 3300037471 Bacteria 1701
411 Ga0395901_0000765 3300038443 Bacteria 36025
412 Ga0395901_0002180 3300038443 Bacteria 19989
413 Ga0395901_0010811 3300038443 Bacteria 9250
414 Ga0395901_0150421 3300038443 Bacteria 2446
415 Ga0395901_0212631 3300038443 Bacteria 2023
416 Ga0436365_1875695 3300039437 Bacteria 4743
417 Ga0439436_0002503 3300041404 Bacteria 5527
418 Ga0439461_0002679 3300041410 Bacteria 2873
419 Ga0439466_0004282 3300041411 Bacteria 5511
420 Ga0439465_0001337 3300041413 Bacteria 7919
421 Ga0439431_0002212 3300041997 Bacteria 4288
422 Ga0439433_0000393 3300041999 Bacteria 7867
423 Ga0439445_0001138 3300042004 Bacteria 5700
424 Ga0439432_002995 3300042006 Bacteria 6290
425 Ga0439432_015490 3300042006 Bacteria 2572
426 Ga0439449_0000440 3300042007 Bacteria 15398
427 Ga0439449_0002955 3300042007 Bacteria 6617
428 Ga0439452_002568 3300042010 Bacteria 6655
429 Ga0439452_004053 3300042010 Bacteria 4982
430 Ga0439457_002668 3300042014 Bacteria 5028
431 Ga0439462_0016150 3300042015 Bacteria 1927
432 Ga0450911_000229 3300042115 Bacteria 21702
433 Ga0450894_004420 3300042131 Bacteria 1826
434 Ga0450898_008797 3300042134 Bacteria 1603
435 Ga0450906_008648 3300042145 Bacteria 1963
436 Ga0439446_0001674 3300042156 Bacteria 5136
437 Ga0439434_0013114 3300042435 Bacteria 2458
438 Ga0439434_0016440 3300042435 Bacteria 2210
439 Ga0439464_0005012 3300042439 Bacteria 3406
440 Ga0450918_000020 3300042531 Bacteria 32421
441 Ga0450893_0007321 3300042532 Bacteria 1793
442 Ga0451577_0026810 3300042876 Bacteria 5217
443 Ga0466965_0004074 3300044683 Bacteria 6484
444 Ga0466965_0010097 3300044683 Bacteria 4396
445 Ga0466966_0009150 3300044684 Bacteria 6558
446 Ga0466966_0037902 3300044684 Bacteria 3106
447 Ga0466966_0047195 3300044684 Bacteria 2747
448 Ga0466961_0026881 3300044693 Bacteria 3700
449 Ga0466964_0001291 3300044706 Bacteria 8539
450 Ga0466971_0031803 3300044719 Bacteria 2363
451 Ga0466968_0000336 3300044735 Bacteria 15168
452 Ga0466957_0003305 3300044842 Bacteria 8825
453 Ga0466959_0090080 3300045049 Bacteria 2203
454 Ga0466958_0076424 3300045836 Bacteria 2055
455 Ga0466967_0022557 3300045976 Bacteria 5140
456 Ga0495627_011509 3300046453 Bacteria 3173
457 Ga0495603_0051244 3300046455 Bacteria 2453
458 Ga0495590_0000194 3300046457 Bacteria 34520
459 Ga0495590_0009293 3300046457 Bacteria 3728
460 Ga0495591_004761 3300046458 Bacteria 6496
461 Ga0495629_0004887 3300046459 Bacteria 10062
462 Ga0495629_0028547 3300046459 Bacteria 3960
463 Ga0495629_0092876 3300046459 Bacteria 2106
464 Ga0495638_0025106 3300046460 Bacteria 3877
465 Ga0495651_0022359 3300046462 Bacteria 4915
466 Ga0495651_0069077 3300046462 Bacteria 2692
467 Ga0495653_0031825 3300046463 Bacteria 4191
468 Ga0495650_0000173 3300046471 Bacteria 142734
469 Ga0495650_0001016 3300046471 Bacteria 31640
470 Ga0495650_0001137 3300046471 Bacteria 28827
471 Ga0495650_0003845 3300046471 Bacteria 10646
472 Ga0495650_0005666 3300046471 Bacteria 8014
473 Ga0495650_0007897 3300046471 Bacteria 6315
474 Ga0495650_0013987 3300046471 Bacteria 4209
475 Ga0495650_0025527 3300046471 Bacteria 2767
476 Ga0495580_0001751 3300046472 Bacteria 19089
477 Ga0495580_0032788 3300046472 Bacteria 3744
478 Ga0495580_0067042 3300046472 Bacteria 2511
479 Ga0495582_0005030 3300046473 Bacteria 7408
480 Ga0495582_0014926 3300046473 Bacteria 4269
481 Ga0495582_0024795 3300046473 Bacteria 3283
482 Ga0495605_0000166 3300046474 Bacteria 83477
483 Ga0495605_0016349 3300046474 Bacteria 4016
484 Ga0495639_0009692 3300046475 Bacteria 4133
485 Ga0495664_0008135 3300046477 Bacteria 5839
486 Ga0495584_0000755 3300046491 Bacteria 21387
487 Ga0495584_0001114 3300046491 Bacteria 16663
488 Ga0495584_0021488 3300046491 Bacteria 3277
489 Ga0495585_0000742 3300046492 Bacteria 29008
490 Ga0495585_0008221 3300046492 Bacteria 6333
491 Ga0495585_0017784 3300046492 Bacteria 4103
492 Ga0495585_0046655 3300046492 Bacteria 2415
493 Ga0495585_0065816 3300046492 Bacteria 1985
494 Ga0495585_0094558 3300046492 Bacteria 1606
495 Ga0495594_0009364 3300046499 Bacteria 5059
496 Ga0495596_0000282 3300046500 Bacteria 33869
497 Ga0495596_0000815 3300046500 Bacteria 18857
498 Ga0495596_0001341 3300046500 Bacteria 14167
499 Ga0495596_0006576 3300046500 Bacteria 5333
500 Ga0495596_0008577 3300046500 Bacteria 4541
501 Ga0495596_0017959 3300046500 Bacteria 2920
502 Ga0495607_0000569 3300046501 Bacteria 36001
503 Ga0495607_0000761 3300046501 Bacteria 30878
504 Ga0495607_0002170 3300046501 Bacteria 16331
505 Ga0495607_0028022 3300046501 Bacteria 3478
506 Ga0495607_0043480 3300046501 Bacteria 2656
507 Ga0495583_0000264 3300046506 Bacteria 86123
508 Ga0495583_0003019 3300046506 Bacteria 13420
509 Ga0495583_0008798 3300046506 Bacteria 6118
510 Ga0495606_0017721 3300046507 Bacteria 5371
511 Ga0495608_0001973 3300046511 Bacteria 14703
512 Ga0495608_0007653 3300046511 Bacteria 7615
513 Ga0495608_0055888 3300046511 Bacteria 2608
514 Ga0495616_0006765 3300046513 Bacteria 6912
515 Ga0495616_0015488 3300046513 Bacteria 4240
516 Ga0495616_0019091 3300046513 Bacteria 3747
517 Ga0495616_0083987 3300046513 Bacteria 1518
518 Ga0495618_0001212 3300046514 Bacteria 17489
519 Ga0495628_0047704 3300046516 Bacteria 3396
520 Ga0495628_0172213 3300046516 Bacteria 1641
521 Ga0495630_0002019 3300046517 Bacteria 14105
522 Ga0495632_0001724 3300046519 Bacteria 17773
523 Ga0495632_0019098 3300046519 Bacteria 3741
524 Ga0495643_0000983 3300046522 Bacteria 29263
525 Ga0495643_0001243 3300046522 Bacteria 24444
526 Ga0495643_0009267 3300046522 Bacteria 6134
527 Ga0495643_0018628 3300046522 Bacteria 4030
528 Ga0495643_0021644 3300046522 Bacteria 3684
529 Ga0495643_0022208 3300046522 Bacteria 3623
530 Ga0495644_0013780 3300046523 Bacteria 3099
531 Ga0495648_0002408 3300046524 Bacteria 17360
532 Ga0495648_0005013 3300046524 Bacteria 11126
533 Ga0495648_0006066 3300046524 Bacteria 9919
534 Ga0495648_0006655 3300046524 Bacteria 9357
535 Ga0495648_0038696 3300046524 Bacteria 3045
536 Ga0495663_0006301 3300046525 Bacteria 3277
537 Ga0495663_0008721 3300046525 Bacteria 2812
538 Ga0495666_0000669 3300046526 Bacteria 15496
539 Ga0495666_0007649 3300046526 Bacteria 5406
540 Ga0495666_0013879 3300046526 Bacteria 4017
541 Ga0495666_0017260 3300046526 Bacteria 3595
542 Ga0495642_0002646 3300046528 Bacteria 7214
543 Ga0495642_0004046 3300046528 Bacteria 5722
544 Ga0495642_0007481 3300046528 Bacteria 4184
545 Ga0495642_0012289 3300046528 Bacteria 3300
546 Ga0495642_0016098 3300046528 Bacteria 2911
547 Ga0495642_0018068 3300046528 Bacteria 2758
548 Ga0495642_0024464 3300046528 Bacteria 2389
549 Ga0495642_0061247 3300046528 Bacteria 1561
550 Ga0495652_0035177 3300046529 Bacteria 4360
551 Ga0495652_0124737 3300046529 Bacteria 2048
552 Ga0495654_0021325 3300046530 Bacteria 3371
553 Ga0495665_0000807 3300046531 Bacteria 16422
554 Ga0495665_0011811 3300046531 Bacteria 4731
555 Ga0495665_0046020 3300046531 Bacteria 2317
556 Ga0495665_0120167 3300046531 Bacteria 1376
557 Ga0495640_0010739 3300046533 Bacteria 7064
558 Ga0495586_0032578 3300046535 Bacteria 2794
559 Ga0495586_0044065 3300046535 Bacteria 2402
560 Ga0495609_0000028 3300046538 Bacteria 219908
561 Ga0495609_0002870 3300046538 Bacteria 10296
562 Ga0495609_0005090 3300046538 Bacteria 7007
563 Ga0495609_0029527 3300046538 Bacteria 2496
564 Ga0495621_0009386 3300046539 Bacteria 2969
565 Ga0495597_0007716 3300046542 Bacteria 5440
566 Ga0495645_0000143 3300046543 Bacteria 48856
567 Ga0495622_0000183 3300046557 Bacteria 50803
568 Ga0495622_0038105 3300046557 Bacteria 2238
569 Ga0495633_0025626 3300046558 Bacteria 2902
570 Ga0495633_0026080 3300046558 Bacteria 2870
571 Ga0495656_0000057 3300046615 Bacteria 53197
572 Ga0495656_0001209 3300046615 Bacteria 8415
573 Ga0495668_0093555 3300046616 Bacteria 1646
574 Ga0495668_0119107 3300046616 Bacteria 1444
575 Ga0495634_0000991 3300046642 Bacteria 26768
576 Ga0495634_0010313 3300046642 Bacteria 6848
577 Ga0495611_0043745 3300046648 Bacteria 2002
578 Ga0495625_0055874 3300046660 Bacteria 2813
579 Ga0495635_0000843 3300046663 Bacteria 20064
580 Ga0495635_0012858 3300046663 Bacteria 5861
581 Ga0495659_0008002 3300046664 Bacteria 3355
582 Ga0495661_0000157 3300046665 Bacteria 80637
583 Ga0495661_0002008 3300046665 Bacteria 16041
584 Ga0495661_0004573 3300046665 Bacteria 9964
585 Ga0495661_0014826 3300046665 Bacteria 5213
586 Ga0495661_0018779 3300046665 Bacteria 4540
587 Ga0495661_0028910 3300046665 Bacteria 3542
588 Ga0495661_0031969 3300046665 Bacteria 3331
589 Ga0495661_0044035 3300046665 Bacteria 2738
590 Ga0495661_0046669 3300046665 Bacteria 2643
591 Ga0495661_0060555 3300046665 Bacteria 2248
592 Ga0495661_0084247 3300046665 Bacteria 1825
593 Ga0495588_0000113 3300046674 Bacteria 137279
594 Ga0495588_0051641 3300046674 Bacteria 2118
595 Ga0495657_0012314 3300046675 Bacteria 6356
596 Ga0495623_0034581 3300046679 Bacteria 3240
597 Ga0495623_0062332 3300046679 Bacteria 2337
598 Ga0495623_0097081 3300046679 Bacteria 1800
599 Ga0495646_0001966 3300046680 Bacteria 12392
600 Ga0495646_0004589 3300046680 Bacteria 8706
601 Ga0495646_0051483 3300046680 Bacteria 2492
602 Ga0495669_0048026 3300046684 Bacteria 1909
603 Ga0495613_0138629 3300046689 Bacteria 1739
604 Ga0495624_0053356 3300046690 Bacteria 2552
605 Ga0495670_0012681 3300046691 Bacteria 4146
606 Ga0495671_0059450 3300046692 Bacteria 1889
607 Ga0495649_0002811 3300046694 Bacteria 12115
608 Ga0495649_0052867 3300046694 Bacteria 2200
609 Ga0495589_0000098 3300046794 Bacteria 83860
610 Ga0495589_0000117 3300046794 Bacteria 75549
611 Ga0495589_0013980 3300046794 Bacteria 4138
612 Ga0495589_0022855 3300046794 Bacteria 3188
613 Ga0495589_0025125 3300046794 Bacteria 3024
614 Ga0495589_0071017 3300046794 Bacteria 1702
615 Ga0495600_0000917 3300046809 Bacteria 15795
616 Ga0495600_0002998 3300046809 Bacteria 9861
617 Ga0495600_0089423 3300046809 Bacteria 2009
618 Ga0495660_0005424 3300046810 Bacteria 7634
619 Ga0495581_0000660 3300047315 Bacteria 18106
620 Ga0495581_0002997 3300047315 Bacteria 9677
621 Ga0495581_0006255 3300047315 Bacteria 6902
622 Ga0495604_0013071 3300047317 Bacteria 6614
623 Ga0495604_0097389 3300047317 Bacteria 2169
624 Ga0495636_0009716 3300047318 Bacteria 3788
625 Ga0495674_0002283 3300047319 Bacteria 18822
626 Ga0495674_0074943 3300047319 Bacteria 2912
627 Ga0495674_0126150 3300047319 Bacteria 2159
628 Ga0495672_0000014 3300047320 Bacteria 505636
629 Ga0495672_0000464 3300047320 Bacteria 47929
630 Ga0495672_0004632 3300047320 Bacteria 11164
631 Ga0495676_0071183 3300047321 Bacteria 2674
632 Ga0495676_0071692 3300047321 Bacteria 2662
633 Ga0495676_0109873 3300047321 Bacteria 2025
634 Ga0495680_0022759 3300047322 Bacteria 5219
635 Ga0495680_0132106 3300047322 Bacteria 1833
636 Ga0495683_0000112 3300047323 Bacteria 82903
637 Ga0495683_0000990 3300047323 Bacteria 19873
638 Ga0495683_0004557 3300047323 Bacteria 7837
639 Ga0495683_0009188 3300047323 Bacteria 5268
640 Ga0495683_0018937 3300047323 Bacteria 3554
641 Ga0495683_0032215 3300047323 Bacteria 2670
642 Ga0495687_000054 3300047443 Bacteria 194607
643 Ga0495687_000430 3300047443 Bacteria 51814
644 Ga0495687_005372 3300047443 Bacteria 8188
645 Ga0495687_006707 3300047443 Bacteria 6981
646 Ga0495675_0000641 3300047444 Bacteria 22216
647 Ga0495675_0002207 3300047444 Bacteria 11610
648 Ga0495677_0000012 3300047445 Bacteria 146763
649 Ga0495677_0000154 3300047445 Bacteria 32847
650 Ga0495677_0001386 3300047445 Bacteria 9697
651 Ga0495677_0003569 3300047445 Bacteria 6034
652 Ga0495677_0004324 3300047445 Bacteria 5459
653 Ga0495679_000344 3300047446 Bacteria 36397
654 Ga0495685_009832 3300047447 Bacteria 3202
655 Ga0495673_0016670 3300047469 Bacteria 3751
656 Ga0495681_0042084 3300047470 Bacteria 2213
657 Ga0495686_0000219 3300047472 Bacteria 105435
658 Ga0495686_0046279 3300047472 Bacteria 2751
659 Ga0495686_0098852 3300047472 Bacteria 1762
660 Ga0495593_0006738 3300047673 Bacteria 6724
661 Ga0495593_0034519 3300047673 Bacteria 2751
662 Ga0495602_0002022 3300048088 Bacteria 20408
663 Ga0495602_0017269 3300048088 Bacteria 7235
664 Ga0495614_0015846 3300048089 Bacteria 3283
665 Ga0495615_0007699 3300048090 Bacteria 2055
666 Ga0495626_0000036 3300048091 Bacteria 180464
667 Ga0495626_0000603 3300048091 Bacteria 35071
668 Ga0495626_0001290 3300048091 Bacteria 20449
669 Ga0495626_0006446 3300048091 Bacteria 6683
670 Ga0495626_0007753 3300048091 Bacteria 5948
671 Ga0495626_0016949 3300048091 Bacteria 3690
672 Ga0495626_0043954 3300048091 Bacteria 2094
673 Ga0495626_0058503 3300048091 Bacteria 1761
674 Ga0496100_0000252 3300048903 Bacteria 27499
675 Ga0496100_0034654 3300048903 Bacteria 3169
676 Ga0496101_0001430 3300048904 Bacteria 14246
677 Ga0496101_0108358 3300048904 Bacteria 2088
678 Ga0496101_0152460 3300048904 Bacteria 1768
679 Ga0496102_0000279 3300048905 Bacteria 65185
680 Ga0496102_0000504 3300048905 Bacteria 42821
681 Ga0496102_0043738 3300048905 Bacteria 4062
682 Ga0496102_0169740 3300048905 Bacteria 2054
683 Ga0496102_0337121 3300048905 Bacteria 1420
684 Ga0496103_0001452 3300048906 Bacteria 15864
685 Ga0496103_0049118 3300048906 Bacteria 2609
686 Ga0496103_0049140 3300048906 Bacteria 2608
687 Ga0496104_0024837 3300048907 Bacteria 5517
688 Ga0496104_0139919 3300048907 Bacteria 2325
689 Ga0496105_0006505 3300048908 Bacteria 8984
690 Ga0496105_0018232 3300048908 Bacteria 5636
691 Ga0496105_0024936 3300048908 Bacteria 4861
692 Ga0496105_0037535 3300048908 Bacteria 3989
693 Ga0496106_0000001 3300048909 Bacteria 497458
694 Ga0496106_0009466 3300048909 Bacteria 7202
695 Ga0496108_0015356 3300048911 Bacteria 6246
696 Ga0496108_0095376 3300048911 Bacteria 2533
697 Ga0496109_0087066 3300048912 Bacteria 2885
698 Ga0496110_0018524 3300048913 Bacteria 5837
699 Ga0496110_0025062 3300048913 Bacteria 5092
700 Ga0496110_0175493 3300048913 Bacteria 1945
701 Ga0496110_0193534 3300048913 Bacteria 1846
702 Ga0496111_0025762 3300048914 Bacteria 4151
703 Ga0496112_0008206 3300048915 Bacteria 9339
704 Ga0496112_0058178 3300048915 Bacteria 3807
705 Ga0496113_0002606 3300048916 Bacteria 10546
706 Ga0496113_0048072 3300048916 Bacteria 3173
707 Ga0496113_0145983 3300048916 Bacteria 1864
708 Ga0496114_0002318 3300048917 Bacteria 14508
709 Ga0496114_0031518 3300048917 Bacteria 4362
710 Ga0496114_0101885 3300048917 Bacteria 2452
711 Ga0496117_0001263 3300048920 Bacteria 37577
712 Ga0496117_0009273 3300048920 Bacteria 9196
713 Ga0496118_0002573 3300048921 Bacteria 24223
714 Ga0496118_0005723 3300048921 Bacteria 13985
715 Ga0496118_0099662 3300048921 Bacteria 1968
716 Ga0496119_0033822 3300048922 Bacteria 3381
717 Ga0496119_0099962 3300048922 Bacteria 1630
718 Ga0496121_0001612 3300048924 Bacteria 37459
719 Ga0496121_0014246 3300048924 Bacteria 8457
720 Ga0496121_0017114 3300048924 Bacteria 7431
721 Ga0496121_0026646 3300048924 Bacteria 5436
722 Ga0496121_0104928 3300048924 Bacteria 2170
723 Ga0496122_0000039 3300048925 Bacteria 295352
724 Ga0496122_0004995 3300048925 Bacteria 16054
725 Ga0496122_0013715 3300048925 Bacteria 7907
726 Ga0496123_0000026 3300048926 Bacteria 318040
727 Ga0496123_0004595 3300048926 Bacteria 14373
728 Ga0496124_0124526 3300048927 Bacteria 2055
729 Ga0496125_0002380 3300048928 Bacteria 24528
730 Ga0496125_0005683 3300048928 Bacteria 13751
731 Ga0496125_0085740 3300048928 Bacteria 2385
732 Ga0496126_0000065 3300048929 Bacteria 252549
733 Ga0496126_0056411 3300048929 Bacteria 3551
734 Ga0495678_002126 3300049459 Bacteria 14046
735 Ga0495678_010341 3300049459 Bacteria 4543
736 Ga0501303_001395 3300049526 Bacteria 1808
737 Ga0501046_0041180 3300049580 Bacteria 3687
738 Ga0501075_0103726 3300049591 Bacteria 2161
739 Ga0501076_0047631 3300049592 Bacteria 3390
740 Ga0501035_0000816 3300049822 Bacteria 33256
741 Ga0501035_0084945 3300049822 Bacteria 2791
742 nmdc:mga03683_30774_c1 3300050489 Bacteria 2149
743 nmdc:mga03n38_73780_c1 3300050490 Bacteria 1585
744 nmdc:mga0k408_717_c1 3300050493 Bacteria 18151
745 nmdc:mga07m45_111_c1 3300050496 Bacteria 32728
746 nmdc:mga07m45_80278_c1 3300050496 Bacteria 1863
747 nmdc:mga05p37_90979_c1 3300050507 Bacteria 3760
748 nmdc:mga09592_182821_c1 3300050508 Bacteria 1814
749 nmdc:mga09592_2480_c1 3300050508 Bacteria 14905
750 nmdc:mga08y16_5490_c1 3300050511 Bacteria 13255
751 nmdc:mga08x19_91616_c1 3300050514 Bacteria 2007
752 nmdc:mga0sz30_9719_c1 3300050516 Bacteria 3667
753 Ga0500607_011616 3300053121 Bacteria 5201
754 Ga0500559_0011246 3300053136 Bacteria 3825
755 Ga0500573_0016722 3300053140 Bacteria 4168
756 Ga0500590_016027 3300053148 Bacteria 3872
757 Ga0501082_0078329 3300060353 Bacteria 2851
758 Ga0466962_0026080 3300061719 Bacteria 2806

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100073389 Ga0070683_1000733893 389
2 3300005344 Ga0070661_100020175 Ga0070661_1000201752 389
3 3300005435 Ga0070714_100017632 Ga0070714_1000176325 389
4 3300005563 Ga0068855_100020707 Ga0068855_1000207075 389
5 3300005564 Ga0070664_100009052 Ga0070664_1000090523 389
6 3300005577 Ga0068857_100001323 Ga0068857_10000132318 389
7 3300005578 Ga0068854_100008729 Ga0068854_1000087293 389
8 3300005614 Ga0068856_100002037 Ga0068856_1000020373 389
9 3300005834 Ga0068851_10016048 Ga0068851_100160483 389
10 3300009093 Ga0105240_10002223 Ga0105240_1000222311 389
11 3300009174 Ga0105241_10021547 Ga0105241_100215472 389
12 3300009545 Ga0105237_10067780 Ga0105237_100677803 389
13 3300009551 Ga0105238_10010414 Ga0105238_100104147 389
14 3300013104 Ga0157370_10199081 Ga0157370_101990812 389
15 3300013105 Ga0157369_10043206 Ga0157369_100432064 389
16 3300013307 Ga0157372_10008220 Ga0157372_100082205 389
17 3300025321 Ga0207656_10055245 Ga0207656_100552451 390
18 3300025920 Ga0207649_10010572 Ga0207649_100105723 390
19 3300025929 Ga0207664_10009160 Ga0207664_100091605 390
20 3300025945 Ga0207679_10009197 Ga0207679_100091972 390
21 3300025949 Ga0207667_10038166 Ga0207667_100381664 390
22 3300026078 Ga0207702_10019314 Ga0207702_100193143 390
23 3300026116 Ga0207674_10000040 Ga0207674_10000040108 390
24 3300046692 Ga0495671_0059450 Ga0495671_0059450_158_1435 390
25 3300046794 Ga0495589_0022855 Ga0495589_0022855_1336_2613 390
26 3300047443 Ga0495687_005372 Ga0495687_005372_3788_5065 390
27 3300048916 Ga0496113_0002606 Ga0496113_0002606_10_1272 390
28 3300003320 rootH2_10027177 rootH2_100271772 391
29 3300003322 rootL2_10050965 rootL2_100509654 391
30 3300003354 JGI25160J50197_1000284 JGI25160J50197_100028428 391
31 3300005262 Ga0065165_1002073 Ga0065165_100207310 391
32 3300006353 Ga0075370_10000078 Ga0075370_1000007814 391
33 3300013102 Ga0157371_10062249 Ga0157371_100622493 391
34 3300025284 Ga0209130_1015288 Ga0209130_10152881 391
35 3300025295 Ga0209564_1002345 Ga0209564_10023455 391
36 3300025302 Ga0207426_1000737 Ga0207426_100073711 391
37 3300037471 Ga0395905_0000076 Ga0395905_0000076_135297_136559 391
38 3300038443 Ga0395901_0002180 Ga0395901_0002180_3713_4984 391
39 3300046457 Ga0495590_0009293 Ga0495590_0009293_2423_3685 391
40 3300046472 Ga0495580_0067042 Ga0495580_0067042_844_2106 391
41 3300046528 Ga0495642_0024464 Ga0495642_0024464_978_2240 391
42 3300046794 Ga0495589_0071017 Ga0495589_0071017_123_1385 391
43 3300047319 Ga0495674_0002283 Ga0495674_0002283_7892_9154 391
44 3300047323 Ga0495683_0018937 Ga0495683_0018937_1978_3240 391
45 3300047469 Ga0495673_0016670 Ga0495673_0016670_236_1498 391
46 3300048903 Ga0496100_0000252 Ga0496100_0000252_16267_17529 391
47 3300048903 Ga0496100_0034654 Ga0496100_0034654_1487_2749 391
48 3300048904 Ga0496101_0001430 Ga0496101_0001430_9679_10941 391
49 3300048904 Ga0496101_0108358 Ga0496101_0108358_101_1363 391
50 3300048905 Ga0496102_0000504 Ga0496102_0000504_25262_26524 391
51 3300048906 Ga0496103_0001452 Ga0496103_0001452_6799_8061 391
52 3300048907 Ga0496104_0139919 Ga0496104_0139919_901_2163 391
53 3300048908 Ga0496105_0024936 Ga0496105_0024936_421_1683 391
54 3300048915 Ga0496112_0058178 Ga0496112_0058178_1914_3176 391
55 3300048920 Ga0496117_0001263 Ga0496117_0001263_20117_21379 391
56 3300048921 Ga0496118_0002573 Ga0496118_0002573_6397_7659 391
57 3300048922 Ga0496119_0033822 Ga0496119_0033822_330_1592 391
58 3300048922 Ga0496119_0099962 Ga0496119_0099962_134_1396 391
59 3300048924 Ga0496121_0001612 Ga0496121_0001612_28543_29805 391
60 3300048924 Ga0496121_0017114 Ga0496121_0017114_6007_7269 391
61 3300050493 nmdc:mga0k408_717_c1 nmdc:mga0k408_717_c1_15732_17012 391
62 3300050496 nmdc:mga07m45_111_c1 nmdc:mga07m45_111_c1_19168_20448 391
63 3300046471 Ga0495650_0007897 Ga0495650_0007897_1770_3032 392
64 3300046557 Ga0495622_0000183 Ga0495622_0000183_5443_6705 392
65 3300005327 Ga0070658_10196924 Ga0070658_101969241 393
66 3300016635 Ga0183361_10006 Ga0183361_1000617 393
67 3300025909 Ga0207705_10179559 Ga0207705_101795592 393
68 3300042876 Ga0451577_0026810 Ga0451577_0026810_1607_2872 393
69 3300046616 Ga0495668_0119107 Ga0495668_0119107_91_1362 393
70 3300047472 Ga0495686_0098852 Ga0495686_0098852_313_1584 393
71 3300048909 Ga0496106_0000001 Ga0496106_0000001_278256_279527 393
72 3300048924 Ga0496121_0014246 Ga0496121_0014246_3830_5101 393
73 3300045836 Ga0466958_0076424 Ga0466958_0076424_11_1222 394
74 3300048921 Ga0496118_0099662 Ga0496118_0099662_652_1923 394
75 3300048929 Ga0496126_0000065 Ga0496126_0000065_190794_192065 394
76 3300002705 JGI25156J39149_1000817 JGI25156J39149_10008174 396
77 3300025256 Ga0209759_1000014 Ga0209759_100001484 396
78 3300046459 Ga0495629_0028547 Ga0495629_0028547_548_1819 396
79 3300046462 Ga0495651_0069077 Ga0495651_0069077_45_1316 396
80 3300046471 Ga0495650_0025527 Ga0495650_0025527_42_1313 396
81 3300046477 Ga0495664_0008135 Ga0495664_0008135_3479_4750 396
82 3300046500 Ga0495596_0006576 Ga0495596_0006576_3024_4295 396
83 3300046511 Ga0495608_0001973 Ga0495608_0001973_13055_14326 396
84 3300046526 Ga0495666_0017260 Ga0495666_0017260_180_1451 396
85 3300046533 Ga0495640_0010739 Ga0495640_0010739_2044_3315 396
86 3300046535 Ga0495586_0032578 Ga0495586_0032578_537_1808 396
87 3300046642 Ga0495634_0010313 Ga0495634_0010313_5402_6673 396
88 3300046663 Ga0495635_0000843 Ga0495635_0000843_13949_15220 396
89 3300046675 Ga0495657_0012314 Ga0495657_0012314_1249_2520 396
90 3300046679 Ga0495623_0062332 Ga0495623_0062332_688_1959 396
91 3300046680 Ga0495646_0004589 Ga0495646_0004589_3686_4957 396
92 3300046694 Ga0495649_0002811 Ga0495649_0002811_242_1513 396
93 3300046809 Ga0495600_0002998 Ga0495600_0002998_2687_3958 396
94 3300047315 Ga0495581_0000660 Ga0495581_0000660_11236_12507 396
95 3300047319 Ga0495674_0126150 Ga0495674_0126150_510_1781 396
96 3300047321 Ga0495676_0071692 Ga0495676_0071692_882_2153 396
97 3300047323 Ga0495683_0000990 Ga0495683_0000990_8146_9417 396
98 3300048091 Ga0495626_0043954 Ga0495626_0043954_274_1545 396
99 3300046492 Ga0495585_0046655 Ga0495585_0046655_481_1680 399
100 3300046528 Ga0495642_0061247 Ga0495642_0061247_12_1211 399
101 3300005616 Ga0068852_100010271 Ga0068852_1000102712 401
102 3300025972 Ga0207668_10023525 Ga0207668_100235254 403
103 3300046809 Ga0495600_0000917 Ga0495600_0000917_8771_10006 403
104 3300046506 Ga0495583_0000264 Ga0495583_0000264_25764_26978 404
105 3300046473 Ga0495582_0014926 Ga0495582_0014926_1877_3097 406
106 3300046524 Ga0495648_0005013 Ga0495648_0005013_1356_2618 406
107 3300048916 Ga0496113_0048072 Ga0496113_0048072_574_1833 406
108 3300048924 Ga0496121_0026646 Ga0496121_0026646_2502_3803 406
109 3300048925 Ga0496122_0013715 Ga0496122_0013715_6272_7531 406
110 3300048928 Ga0496125_0002380 Ga0496125_0002380_19092_20393 406
111 3300048928 Ga0496125_0085740 Ga0496125_0085740_223_1482 406
112 3300005293 Ga0065715_10027957 Ga0065715_100279572 407
113 3300006186 Ga0075369_10011318 Ga0075369_100113182 407
114 3300006880 Ga0075429_100105785 Ga0075429_1001057852 407
115 3300009098 Ga0105245_10075167 Ga0105245_100751672 407
116 3300045976 Ga0466967_0022557 Ga0466967_0022557_2482_3741 407
117 3300046506 Ga0495583_0008798 Ga0495583_0008798_650_1912 407
118 3300048924 Ga0496121_0104928 Ga0496121_0104928_864_2123 407
119 3300049591 Ga0501075_0103726 Ga0501075_0103726_657_1922 407
120 3300049592 Ga0501076_0047631 Ga0501076_0047631_313_1578 407
121 3300050508 nmdc:mga09592_182821_c1 nmdc:mga09592_182821_c1_344_1636 407
122 3300060353 Ga0501082_0078329 Ga0501082_0078329_611_1876 407
123 iso_pu_bacteria 642555113 642615563 408
124 3300003756 Ga0055533_1000104 Ga0055533_100010484 409
125 3300003758 Ga0055532_1000003 Ga0055532_1000003372 409
126 3300003760 Ga0055527_1000006 Ga0055527_100000685 409
127 3300003761 Ga0055535_1000003 Ga0055535_1000003372 409
128 3300003762 Ga0055542_1000007 Ga0055542_1000007372 409
129 3300003763 Ga0055529_1000003 Ga0055529_100000385 409
130 3300005347 Ga0070668_100000690 Ga0070668_1000006903 409
131 3300005844 Ga0068862_100028911 Ga0068862_1000289112 409
132 3300014326 Ga0157380_10030503 Ga0157380_100305033 409
133 3300025226 Ga0209674_100025 Ga0209674_100025371 409
134 3300025228 Ga0209672_100002 Ga0209672_1000021263 409
135 3300025229 Ga0209147_100003 Ga0209147_1000031263 409
136 3300025230 Ga0209563_101042 Ga0209563_1010425 409
137 3300025231 Ga0207427_101164 Ga0207427_1011647 409
138 3300025242 Ga0209258_100005 Ga0209258_100005904 409
139 3300025254 Ga0209148_1000006 Ga0209148_10000061263 409
140 3300025261 Ga0209233_1000018 Ga0209233_100001883 409
141 3300025272 Ga0209455_1000003 Ga0209455_10000031263 409
142 3300025972 Ga0207668_10010104 Ga0207668_100101043 409
143 3300028380 Ga0268265_10042827 Ga0268265_100428272 409
144 3300046471 Ga0495650_0001137 Ga0495650_0001137_14202_15479 409
145 3300046471 Ga0495650_0005666 Ga0495650_0005666_1845_3107 409
146 3300046472 Ga0495580_0001751 Ga0495580_0001751_14204_15481 409
147 3300046492 Ga0495585_0094558 Ga0495585_0094558_221_1498 409
148 3300046511 Ga0495608_0055888 Ga0495608_0055888_818_2095 409
149 3300046528 Ga0495642_0007481 Ga0495642_0007481_749_2026 409
150 3300046530 Ga0495654_0021325 Ga0495654_0021325_186_1463 409
151 3300046531 Ga0495665_0120167 Ga0495665_0120167_73_1350 409
152 3300046543 Ga0495645_0000143 Ga0495645_0000143_14681_15958 409
153 3300046674 Ga0495588_0051641 Ga0495588_0051641_330_1607 409
154 3300046679 Ga0495623_0097081 Ga0495623_0097081_276_1553 409
155 3300046680 Ga0495646_0051483 Ga0495646_0051483_582_1859 409
156 3300046689 Ga0495613_0138629 Ga0495613_0138629_62_1339 409
157 3300046809 Ga0495600_0089423 Ga0495600_0089423_138_1415 409
158 3300047315 Ga0495581_0002997 Ga0495581_0002997_3305_4582 409
159 3300047673 Ga0495593_0034519 Ga0495593_0034519_1155_2432 409
160 3300048908 Ga0496105_0018232 Ga0496105_0018232_2516_3793 409
161 3300048917 Ga0496114_0002318 Ga0496114_0002318_3651_4928 409
162 3300017792 Ga0163161_10004592 Ga0163161_100045922 410
163 3300005985 Ga0081539_10003666 Ga0081539_100036665 411
164 3300046526 Ga0495666_0013879 Ga0495666_0013879_96_1331 411
165 3300046557 Ga0495622_0038105 Ga0495622_0038105_870_2105 411
166 3300048929 Ga0496126_0056411 Ga0496126_0056411_1945_3279 411
167 3300005617 Ga0068859_100175348 Ga0068859_1001753483 412
168 3300006931 Ga0097620_100175345 Ga0097620_1001753453 412
169 3300009177 Ga0105248_10067706 Ga0105248_100677063 412
170 3300013105 Ga0157369_10015394 Ga0157369_100153943 412
171 3300025254 Ga0209148_1000413 Ga0209148_100041340 412
172 3300046455 Ga0495603_0051244 Ga0495603_0051244_1013_2275 412
173 3300046458 Ga0495591_004761 Ga0495591_004761_3682_4944 412
174 3300046459 Ga0495629_0004887 Ga0495629_0004887_5920_7182 412
175 3300046462 Ga0495651_0022359 Ga0495651_0022359_2429_3691 412
176 3300046463 Ga0495653_0031825 Ga0495653_0031825_1864_3126 412
177 3300046471 Ga0495650_0013987 Ga0495650_0013987_159_1421 412
178 3300046472 Ga0495580_0032788 Ga0495580_0032788_289_1551 412
179 3300046473 Ga0495582_0024795 Ga0495582_0024795_134_1396 412
180 3300046500 Ga0495596_0000815 Ga0495596_0000815_9278_10516 412
181 3300046500 Ga0495596_0008577 Ga0495596_0008577_256_1518 412
182 3300046511 Ga0495608_0007653 Ga0495608_0007653_2400_3662 412
183 3300046514 Ga0495618_0001212 Ga0495618_0001212_7585_8847 412
184 3300046516 Ga0495628_0047704 Ga0495628_0047704_1846_3108 412
185 3300046516 Ga0495628_0172213 Ga0495628_0172213_305_1567 412
186 3300046517 Ga0495630_0002019 Ga0495630_0002019_2429_3691 412
187 3300046524 Ga0495648_0038696 Ga0495648_0038696_1718_2980 412
188 3300046526 Ga0495666_0000669 Ga0495666_0000669_1426_2688 412
189 3300046529 Ga0495652_0035177 Ga0495652_0035177_670_1932 412
190 3300046531 Ga0495665_0000807 Ga0495665_0000807_9990_11252 412
191 3300046663 Ga0495635_0012858 Ga0495635_0012858_4437_5699 412
192 3300046665 Ga0495661_0014826 Ga0495661_0014826_1758_3020 412
193 3300046680 Ga0495646_0001966 Ga0495646_0001966_7418_8680 412
194 3300046690 Ga0495624_0053356 Ga0495624_0053356_1194_2456 412
195 3300046794 Ga0495589_0013980 Ga0495589_0013980_1811_3073 412
196 3300047315 Ga0495581_0006255 Ga0495581_0006255_1193_2455 412
197 3300047317 Ga0495604_0013071 Ga0495604_0013071_4683_5945 412
198 3300047319 Ga0495674_0074943 Ga0495674_0074943_97_1359 412
199 3300047321 Ga0495676_0109873 Ga0495676_0109873_439_1701 412
200 3300047322 Ga0495680_0022759 Ga0495680_0022759_2419_3681 412
201 3300047322 Ga0495680_0132106 Ga0495680_0132106_475_1737 412
202 3300047323 Ga0495683_0004557 Ga0495683_0004557_6383_7621 412
203 3300047444 Ga0495675_0002207 Ga0495675_0002207_10188_11450 412
204 3300047446 Ga0495679_000344 Ga0495679_000344_10670_11932 412
205 3300047673 Ga0495593_0006738 Ga0495593_0006738_1097_2359 412
206 3300048088 Ga0495602_0017269 Ga0495602_0017269_3545_4807 412
207 3300048089 Ga0495614_0015846 Ga0495614_0015846_225_1487 412
208 3300053148 Ga0500590_016027 Ga0500590_016027_2082_3359 412
209 iso_pu_bacteria 2513237166 2514051563 412
210 iso_pu_bacteria 2711768613 2713476778 412
211 iso_pu_bacteria 2904615490 2904621455 412
212 iso_pu_bacteria 2921643360 2921651221 412
213 iso_pu_bacteria 642555112 642592995 412
214 3300009094 Ga0111539_10037225 Ga0111539_100372254 413
215 3300013307 Ga0157372_10220896 Ga0157372_102208962 413
216 3300025927 Ga0207687_10102355 Ga0207687_101023552 413
217 3300026089 Ga0207648_10097865 Ga0207648_100978653 413
218 3300037312 Ga0395899_0003672 Ga0395899_0003672_4893_6170 413
219 3300037418 Ga0395900_0000532 Ga0395900_0000532_1407_2684 413
220 3300037466 Ga0395898_0133661 Ga0395898_0133661_60_1337 413
221 3300037466 Ga0395898_0198431 Ga0395898_0198431_177_1454 413
222 3300037466 Ga0395898_0258587 Ga0395898_0258587_302_1579 413
223 3300037471 Ga0395905_0132695 Ga0395905_0132695_359_1636 413
224 3300038443 Ga0395901_0000765 Ga0395901_0000765_13080_14357 413
225 3300038443 Ga0395901_0212631 Ga0395901_0212631_412_1689 413
226 3300044684 Ga0466966_0009150 Ga0466966_0009150_5117_6394 413
227 3300044693 Ga0466961_0026881 Ga0466961_0026881_503_1780 413
228 3300044719 Ga0466971_0031803 Ga0466971_0031803_887_2164 413
229 3300046522 Ga0495643_0022208 Ga0495643_0022208_1352_2647 413
230 3300046528 Ga0495642_0012289 Ga0495642_0012289_863_2158 413
231 3300046665 Ga0495661_0028910 Ga0495661_0028910_1214_2509 413
232 3300048925 Ga0496122_0004995 Ga0496122_0004995_13623_14900 413
233 3300048926 Ga0496123_0004595 Ga0496123_0004595_12725_14002 413
234 3300049822 Ga0501035_0000816 Ga0501035_0000816_25308_26585 413
235 3300005719 Ga0068861_100084734 Ga0068861_1000847344 414
236 3300026118 Ga0207675_100019900 Ga0207675_1000199007 414
237 3300026142 Ga0207698_10032211 Ga0207698_100322112 414
238 3300042531 Ga0450918_000020 Ga0450918_000020_28424_29701 414
239 3300048913 Ga0496110_0025062 Ga0496110_0025062_3159_4454 414
240 3300003759 Ga0055525_1000081 Ga0055525_10000817 415
241 3300005355 Ga0070671_100006234 Ga0070671_1000062345 415
242 3300005563 Ga0068855_100023836 Ga0068855_1000238366 415
243 3300009148 Ga0105243_10020229 Ga0105243_100202293 415
244 3300009174 Ga0105241_10024317 Ga0105241_100243173 415
245 3300025230 Ga0209563_100015 Ga0209563_100015781 415
246 3300025911 Ga0207654_10004080 Ga0207654_100040803 415
247 3300025931 Ga0207644_10003508 Ga0207644_100035084 415
248 3300025949 Ga0207667_10015769 Ga0207667_100157693 415
249 iso_pu_bacteria 2643221556 2643800417 415
250 iso_pu_bacteria 2643221684 2644470326 415
251 3300044683 Ga0466965_0004074 Ga0466965_0004074_4831_6108 416
252 3300044706 Ga0466964_0001291 Ga0466964_0001291_4307_5584 416
253 3300044735 Ga0466968_0000336 Ga0466968_0000336_12733_14010 416
254 3300046531 Ga0495665_0046020 Ga0495665_0046020_90_1340 416
255 3300005354 Ga0070675_100100919 Ga0070675_1001009193 417
256 3300005617 Ga0068859_100033940 Ga0068859_1000339403 417
257 3300006931 Ga0097620_100033938 Ga0097620_1000339383 417
258 3300025926 Ga0207659_10083917 Ga0207659_100839173 417
259 3300025936 Ga0207670_10180804 Ga0207670_101808042 417
260 3300025937 Ga0207669_10009370 Ga0207669_100093704 417
261 3300031995 Ga0307409_100015210 Ga0307409_1000152106 417
262 3300032005 Ga0307411_10007310 Ga0307411_100073103 417
263 3300049580 Ga0501046_0041180 Ga0501046_0041180_715_1983 417
264 3300049822 Ga0501035_0084945 Ga0501035_0084945_1306_2574 417
265 3300013307 Ga0157372_10147093 Ga0157372_101470931 418
266 3300005328 Ga0070676_10003180 Ga0070676_100031802 419
267 3300005331 Ga0070670_100008481 Ga0070670_1000084817 419
268 3300005334 Ga0068869_100047125 Ga0068869_1000471253 419
269 3300005335 Ga0070666_10081654 Ga0070666_100816542 419
270 3300005338 Ga0068868_100036751 Ga0068868_1000367513 419
271 3300005354 Ga0070675_100008750 Ga0070675_1000087507 419
272 3300005355 Ga0070671_100062343 Ga0070671_1000623431 419
273 3300005364 Ga0070673_100045968 Ga0070673_1000459681 419
274 3300005459 Ga0068867_100002311 Ga0068867_10000231111 419
275 3300005543 Ga0070672_100011658 Ga0070672_1000116584 419
276 3300005577 Ga0068857_100156892 Ga0068857_1001568921 419
277 3300005841 Ga0068863_100139114 Ga0068863_1001391142 419
278 3300026089 Ga0207648_10004518 Ga0207648_1000451810 419
279 3300026116 Ga0207674_10028584 Ga0207674_100285842 419
280 3300031507 Ga0307509_10000362 Ga0307509_1000036225 419
281 3300031911 Ga0307412_10099696 Ga0307412_100996963 419
282 3300031995 Ga0307409_100102200 Ga0307409_1001022002 419
283 3300032002 Ga0307416_100003413 Ga0307416_1000034133 419
284 3300032126 Ga0307415_100070129 Ga0307415_1000701293 419
285 iso_pu_bacteria 2513237083 2513560375 419
286 iso_pu_bacteria 2842324504 2842326943 419
287 iso_pu_bacteria 2842348783 2842350548 419
288 iso_pu_bacteria 2842454564 2842456688 419
289 iso_pu_bacteria 2856287931 2856288963 419
290 iso_pu_bacteria 2857357740 2857363758 419
291 iso_pu_bacteria 2883087390 2883092546 419
292 iso_pu_bacteria 2904483920 2904487046 419
293 iso_pu_bacteria 2919527303 2919528358 419
294 iso_pu_bacteria 8003955200 8003958000 419
295 3300005456 Ga0070678_100213830 Ga0070678_1002138301 420
296 3300009094 Ga0111539_10022189 Ga0111539_100221892 420
297 3300015262 Ga0182007_10027555 Ga0182007_100275551 420
298 3300026121 Ga0207683_10232189 Ga0207683_102321892 420
299 3300027876 Ga0209974_10003857 Ga0209974_100038577 420
300 3300037471 Ga0395905_0052012 Ga0395905_0052012_441_1703 420
301 3300046525 Ga0495663_0008721 Ga0495663_0008721_698_1960 420
302 3300046528 Ga0495642_0004046 Ga0495642_0004046_2377_3639 420
303 3300047447 Ga0495685_009832 Ga0495685_009832_881_2143 420
304 3300048905 Ga0496102_0000279 Ga0496102_0000279_3685_4947 420
305 3300048905 Ga0496102_0337121 Ga0496102_0337121_136_1398 420
306 3300050507 nmdc:mga05p37_90979_c1 nmdc:mga05p37_90979_c1_1439_2713 420
307 3300005547 Ga0070693_100003577 Ga0070693_1000035774 421
308 3300009094 Ga0111539_10425792 Ga0111539_104257922 421
309 3300025925 Ga0207650_10182815 Ga0207650_101828152 421
310 3300025940 Ga0207691_10268096 Ga0207691_102680961 421
311 3300026095 Ga0207676_10016097 Ga0207676_100160974 421
312 3300046460 Ga0495638_0025106 Ga0495638_0025106_1473_2762 421
313 3300048905 Ga0496102_0169740 Ga0496102_0169740_490_1776 421
314 3300048913 Ga0496110_0193534 Ga0496110_0193534_371_1657 421
315 3300048917 Ga0496114_0101885 Ga0496114_0101885_926_2212 421
316 iso_pu_bacteria 8047673197 8047678716 421
317 3300006058 Ga0075432_10016023 Ga0075432_100160233 422
318 3300006353 Ga0075370_10016805 Ga0075370_100168053 422
319 3300027907 Ga0207428_10048780 Ga0207428_100487804 422
320 3300032004 Ga0307414_10040091 Ga0307414_100400912 422
321 3300032005 Ga0307411_10028997 Ga0307411_100289973 422
322 iso_pu_bacteria 2738541307 2738882111 422
323 iso_pu_bacteria 2818991446 2819598044 422
324 iso_pu_bacteria 2831265667 2831269034 422
325 iso_pu_bacteria 2899924645 2899929463 422
326 iso_pu_bacteria 2928037797 2928040093 422
327 iso_pu_bacteria 2928044640 2928047158 422
328 iso_pu_bacteria 2928051484 2928057639 422
329 iso_pu_bacteria 2928064002 2928067979 422
330 iso_pu_bacteria 2945909444 2945912086 422
331 iso_pu_bacteria 2945984333 2945985629 422
332 3300005295 Ga0065707_10102580 Ga0065707_101025802 423
333 3300005617 Ga0068859_100036035 Ga0068859_1000360352 423
334 3300006844 Ga0075428_100005190 Ga0075428_1000051907 423
335 3300006931 Ga0097620_100036036 Ga0097620_1000360362 423
336 3300009094 Ga0111539_10004782 Ga0111539_1000478210 423
337 3300009148 Ga0105243_10008685 Ga0105243_100086857 423
338 3300011119 Ga0105246_10005667 Ga0105246_100056674 423
339 3300013308 Ga0157375_10009659 Ga0157375_100096592 423
340 3300025931 Ga0207644_10137580 Ga0207644_101375802 423
341 3300025933 Ga0207706_10030537 Ga0207706_100305373 423
342 3300025938 Ga0207704_10130213 Ga0207704_101302131 423
343 3300025940 Ga0207691_10007030 Ga0207691_100070307 423
344 3300026023 Ga0207677_10256746 Ga0207677_102567461 423
345 3300028786 Ga0307517_10022697 Ga0307517_100226978 423
346 3300050508 nmdc:mga09592_2480_c1 nmdc:mga09592_2480_c1_10160_11461 423
347 3300050511 nmdc:mga08y16_5490_c1 nmdc:mga08y16_5490_c1_932_2233 423
348 iso_pu_bacteria 2885192300 2885194908 423
349 iso_pu_bacteria 2919704043 2919706133 423
350 3300003322 rootL2_10229093 rootL2_102290933 424
351 3300003771 Ga0055526_1004027 Ga0055526_10040278 424
352 3300003781 Ga0055536_1000311 Ga0055536_100031124 424
353 3300003784 Ga0055534_1000122 Ga0055534_100012227 424
354 3300005288 Ga0065714_10084178 Ga0065714_100841781 424
355 3300005330 Ga0070690_100016783 Ga0070690_1000167834 424
356 3300005365 Ga0070688_100005610 Ga0070688_1000056104 424
357 3300005367 Ga0070667_100027282 Ga0070667_1000272823 424
358 3300005547 Ga0070693_100111353 Ga0070693_1001113532 424
359 3300005549 Ga0070704_100167852 Ga0070704_1001678522 424
360 3300005617 Ga0068859_100121205 Ga0068859_1001212054 424
361 3300005842 Ga0068858_100023855 Ga0068858_1000238553 424
362 3300006931 Ga0097620_100121207 Ga0097620_1001212074 424
363 3300009093 Ga0105240_10324486 Ga0105240_103244861 424
364 3300009098 Ga0105245_10025899 Ga0105245_100258994 424
365 3300009148 Ga0105243_10073832 Ga0105243_100738322 424
366 3300009148 Ga0105243_10156934 Ga0105243_101569342 424
367 3300009176 Ga0105242_10014279 Ga0105242_100142795 424
368 3300009176 Ga0105242_10251145 Ga0105242_102511452 424
369 3300009177 Ga0105248_10060209 Ga0105248_100602092 424
370 3300011119 Ga0105246_10216083 Ga0105246_102160831 424
371 3300013297 Ga0157378_10037143 Ga0157378_100371434 424
372 3300013306 Ga0163162_10028692 Ga0163162_100286923 424
373 3300014497 Ga0182008_10002058 Ga0182008_100020583 424
374 3300015262 Ga0182007_10001253 Ga0182007_100012533 424
375 3300025291 Ga0209675_1000120 Ga0209675_100012081 424
376 3300025292 Ga0209676_1000918 Ga0209676_100091816 424
377 3300025294 Ga0209025_1001195 Ga0209025_100119516 424
378 3300025295 Ga0209564_1000982 Ga0209564_100098217 424
379 3300025934 Ga0207686_10008036 Ga0207686_100080365 424
380 3300025960 Ga0207651_10293909 Ga0207651_102939091 424
381 3300025986 Ga0207658_10012437 Ga0207658_100124372 424
382 3300026035 Ga0207703_10053603 Ga0207703_100536033 424
383 3300026078 Ga0207702_10096428 Ga0207702_100964282 424
384 3300026118 Ga0207675_100233694 Ga0207675_1002336941 424
385 3300026121 Ga0207683_10059246 Ga0207683_100592463 424
386 3300028577 Ga0265318_10010305 Ga0265318_100103054 424
387 3300028666 Ga0265336_10001755 Ga0265336_100017553 424
388 3300028800 Ga0265338_10004084 Ga0265338_100040845 424
389 3300029957 Ga0265324_10008934 Ga0265324_100089344 424
390 3300031240 Ga0265320_10012959 Ga0265320_100129594 424
391 3300031251 Ga0265327_10005921 Ga0265327_100059212 424
392 3300031344 Ga0265316_10014355 Ga0265316_100143552 424
393 3300031711 Ga0265314_10003034 Ga0265314_100030341 424
394 3300031731 Ga0307405_10016521 Ga0307405_100165212 424
395 3300031852 Ga0307410_10008845 Ga0307410_100088452 424
396 3300031901 Ga0307406_10013812 Ga0307406_100138122 424
397 3300032005 Ga0307411_10074613 Ga0307411_100746132 424
398 3300032126 Ga0307415_100043205 Ga0307415_1000432052 424
399 3300035695 Ga0373927_0070937 Ga0373927_0070937_18_1295 424
400 3300037068 Ga0373925_0053742 Ga0373925_0053742_134_1411 424
401 3300046459 Ga0495629_0092876 Ga0495629_0092876_205_1479 424
402 3300046475 Ga0495639_0009692 Ga0495639_0009692_1569_2843 424
403 3300048905 Ga0496102_0043738 Ga0496102_0043738_1266_2540 424
404 3300048906 Ga0496103_0049140 Ga0496103_0049140_971_2245 424
405 3300048907 Ga0496104_0024837 Ga0496104_0024837_1478_2752 424
406 3300048908 Ga0496105_0037535 Ga0496105_0037535_1183_2457 424
407 3300048913 Ga0496110_0018524 Ga0496110_0018524_1232_2506 424
408 3300048913 Ga0496110_0175493 Ga0496110_0175493_92_1366 424
409 3300048914 Ga0496111_0025762 Ga0496111_0025762_1527_2801 424
410 3300053136 Ga0500559_0011246 Ga0500559_0011246_761_2086 424
411 3300053140 Ga0500573_0016722 Ga0500573_0016722_1666_2991 424
412 iso_pu_bacteria 2643221644 2644248681 424
413 iso_pu_bacteria 2842747753 2842748978 424
414 3300003322 rootL2_10003812 rootL2_100038127 425
415 3300005329 Ga0070683_100016319 Ga0070683_1000163192 425
416 3300005330 Ga0070690_100114862 Ga0070690_1001148621 425
417 3300005331 Ga0070670_100027500 Ga0070670_1000275001 425
418 3300005331 Ga0070670_100141349 Ga0070670_1001413492 425
419 3300005333 Ga0070677_10002361 Ga0070677_100023612 425
420 3300005334 Ga0068869_100071431 Ga0068869_1000714312 425
421 3300005335 Ga0070666_10022166 Ga0070666_100221662 425
422 3300005338 Ga0068868_100006737 Ga0068868_1000067377 425
423 3300005344 Ga0070661_100005733 Ga0070661_1000057333 425
424 3300005344 Ga0070661_100114766 Ga0070661_1001147661 425
425 3300005354 Ga0070675_100003131 Ga0070675_1000031319 425
426 3300005354 Ga0070675_100067216 Ga0070675_1000672162 425
427 3300005354 Ga0070675_100201977 Ga0070675_1002019772 425
428 3300005355 Ga0070671_100013088 Ga0070671_1000130883 425
429 3300005356 Ga0070674_100058263 Ga0070674_1000582632 425
430 3300005364 Ga0070673_100076727 Ga0070673_1000767272 425
431 3300005364 Ga0070673_100241587 Ga0070673_1002415871 425
432 3300005367 Ga0070667_100046717 Ga0070667_1000467172 425
433 3300005455 Ga0070663_100044327 Ga0070663_1000443273 425
434 3300005457 Ga0070662_100143323 Ga0070662_1001433232 425
435 3300005459 Ga0068867_100175642 Ga0068867_1001756421 425
436 3300005459 Ga0068867_100185725 Ga0068867_1001857252 425
437 3300005459 Ga0068867_100201238 Ga0068867_1002012381 425
438 3300005471 Ga0070698_100011813 Ga0070698_1000118134 425
439 3300005539 Ga0068853_100145314 Ga0068853_1001453142 425
440 3300005543 Ga0070672_100045038 Ga0070672_1000450382 425
441 3300005548 Ga0070665_100114259 Ga0070665_1001142592 425
442 3300005549 Ga0070704_100003754 Ga0070704_1000037542 425
443 3300005564 Ga0070664_100019005 Ga0070664_1000190053 425
444 3300005577 Ga0068857_100039610 Ga0068857_1000396106 425
445 3300005616 Ga0068852_100001203 Ga0068852_10000120312 425
446 3300005617 Ga0068859_100001157 Ga0068859_10000115711 425
447 3300005618 Ga0068864_100000432 Ga0068864_10000043228 425
448 3300005618 Ga0068864_100011633 Ga0068864_1000116338 425
449 3300005618 Ga0068864_100195970 Ga0068864_1001959702 425
450 3300005718 Ga0068866_10077396 Ga0068866_100773962 425
451 3300005834 Ga0068851_10009554 Ga0068851_100095545 425
452 3300005840 Ga0068870_10054364 Ga0068870_100543642 425
453 3300005840 Ga0068870_10077819 Ga0068870_100778192 425
454 3300005841 Ga0068863_100003841 Ga0068863_10000384112 425
455 3300005841 Ga0068863_100021826 Ga0068863_1000218267 425
456 3300005841 Ga0068863_100051848 Ga0068863_1000518483 425
457 3300005842 Ga0068858_100027380 Ga0068858_1000273802 425
458 3300005844 Ga0068862_100255010 Ga0068862_1002550102 425
459 3300006048 Ga0075363_100091824 Ga0075363_1000918241 425
460 3300006177 Ga0075362_10015066 Ga0075362_100150663 425
461 3300006237 Ga0097621_100199374 Ga0097621_1001993742 425
462 3300006358 Ga0068871_100036096 Ga0068871_1000360962 425
463 3300006846 Ga0075430_100015096 Ga0075430_1000150967 425
464 3300006931 Ga0097620_100001157 Ga0097620_10000115711 425
465 3300009147 Ga0114129_10339812 Ga0114129_103398122 425
466 3300009147 Ga0114129_10478489 Ga0114129_104784892 425
467 3300009148 Ga0105243_10158812 Ga0105243_101588122 425
468 3300009176 Ga0105242_10002231 Ga0105242_100022318 425
469 3300009176 Ga0105242_10181326 Ga0105242_101813262 425
470 3300009177 Ga0105248_10020065 Ga0105248_100200655 425
471 3300009177 Ga0105248_10249680 Ga0105248_102496802 425
472 3300013105 Ga0157369_10115690 Ga0157369_101156902 425
473 3300013297 Ga0157378_10052405 Ga0157378_100524053 425
474 3300013308 Ga0157375_10026803 Ga0157375_100268032 425
475 3300013308 Ga0157375_10060881 Ga0157375_100608812 425
476 3300014325 Ga0163163_10007305 Ga0163163_100073058 425
477 3300014968 Ga0157379_10006277 Ga0157379_100062779 425
478 3300017792 Ga0163161_10037759 Ga0163161_100377592 425
479 3300017792 Ga0163161_10102846 Ga0163161_101028462 425
480 3300025893 Ga0207682_10000677 Ga0207682_1000067714 425
481 3300025901 Ga0207688_10029342 Ga0207688_100293423 425
482 3300025903 Ga0207680_10004782 Ga0207680_100047823 425
483 3300025907 Ga0207645_10137757 Ga0207645_101377572 425
484 3300025908 Ga0207643_10035712 Ga0207643_100357122 425
485 3300025919 Ga0207657_10004403 Ga0207657_100044036 425
486 3300025920 Ga0207649_10012209 Ga0207649_100122093 425
487 3300025925 Ga0207650_10005355 Ga0207650_100053553 425
488 3300025925 Ga0207650_10021295 Ga0207650_100212952 425
489 3300025925 Ga0207650_10052406 Ga0207650_100524062 425
490 3300025926 Ga0207659_10001257 Ga0207659_1000125712 425
491 3300025926 Ga0207659_10038396 Ga0207659_100383962 425
492 3300025926 Ga0207659_10212884 Ga0207659_102128842 425
493 3300025931 Ga0207644_10026722 Ga0207644_100267222 425
494 3300025932 Ga0207690_10014969 Ga0207690_100149692 425
495 3300025933 Ga0207706_10036810 Ga0207706_100368104 425
496 3300025933 Ga0207706_10049363 Ga0207706_100493633 425
497 3300025933 Ga0207706_10061044 Ga0207706_100610442 425
498 3300025934 Ga0207686_10004796 Ga0207686_100047962 425
499 3300025935 Ga0207709_10064594 Ga0207709_100645942 425
500 3300025935 Ga0207709_10095786 Ga0207709_100957862 425
501 3300025937 Ga0207669_10015234 Ga0207669_100152342 425
502 3300025938 Ga0207704_10085452 Ga0207704_100854522 425
503 3300025941 Ga0207711_10022297 Ga0207711_100222972 425
504 3300025941 Ga0207711_10023504 Ga0207711_100235043 425
505 3300025941 Ga0207711_10235859 Ga0207711_102358592 425
506 3300025942 Ga0207689_10036416 Ga0207689_100364163 425
507 3300025942 Ga0207689_10069755 Ga0207689_100697552 425
508 3300025942 Ga0207689_10121572 Ga0207689_101215722 425
509 3300025944 Ga0207661_10023282 Ga0207661_100232826 425
510 3300025960 Ga0207651_10216223 Ga0207651_102162232 425
511 3300025986 Ga0207658_10012117 Ga0207658_100121172 425
512 3300026023 Ga0207677_10003447 Ga0207677_100034474 425
513 3300026035 Ga0207703_10010387 Ga0207703_100103876 425
514 3300026035 Ga0207703_10044045 Ga0207703_100440452 425
515 3300026067 Ga0207678_10068085 Ga0207678_100680851 425
516 3300026088 Ga0207641_10006864 Ga0207641_100068643 425
517 3300026088 Ga0207641_10045855 Ga0207641_100458553 425
518 3300026089 Ga0207648_10010427 Ga0207648_100104278 425
519 3300026089 Ga0207648_10223160 Ga0207648_102231602 425
520 3300026095 Ga0207676_10000825 Ga0207676_100008258 425
521 3300026095 Ga0207676_10031805 Ga0207676_100318053 425
522 3300026116 Ga0207674_10008453 Ga0207674_1000845314 425
523 3300026118 Ga0207675_100049298 Ga0207675_1000492982 425
524 3300026118 Ga0207675_100071972 Ga0207675_1000719722 425
525 3300026121 Ga0207683_10014465 Ga0207683_100144652 425
526 3300026121 Ga0207683_10038409 Ga0207683_100384094 425
527 3300026121 Ga0207683_10051858 Ga0207683_100518582 425
528 3300026142 Ga0207698_10009113 Ga0207698_100091134 425
529 3300026142 Ga0207698_10016948 Ga0207698_100169484 425
530 3300028380 Ga0268265_10106495 Ga0268265_101064952 425
531 3300037312 Ga0395899_0057041 Ga0395899_0057041_282_1559 425
532 3300037418 Ga0395900_0011395 Ga0395900_0011395_7198_8475 425
533 3300037471 Ga0395905_0169701 Ga0395905_0169701_237_1514 425
534 3300038443 Ga0395901_0010811 Ga0395901_0010811_2786_4063 425
535 3300038443 Ga0395901_0150421 Ga0395901_0150421_59_1336 425
536 3300042439 Ga0439464_0005012 Ga0439464_0005012_697_2001 425
537 3300044683 Ga0466965_0010097 Ga0466965_0010097_1670_2947 425
538 3300044684 Ga0466966_0037902 Ga0466966_0037902_709_1986 425
539 3300044684 Ga0466966_0047195 Ga0466966_0047195_390_1667 425
540 3300044842 Ga0466957_0003305 Ga0466957_0003305_5595_6872 425
541 3300045049 Ga0466959_0090080 Ga0466959_0090080_823_2100 425
542 3300046453 Ga0495627_011509 Ga0495627_011509_604_1881 425
543 3300046457 Ga0495590_0000194 Ga0495590_0000194_32781_34058 425
544 3300046471 Ga0495650_0000173 Ga0495650_0000173_77864_79144 425
545 3300046471 Ga0495650_0001016 Ga0495650_0001016_14179_15456 425
546 3300046473 Ga0495582_0005030 Ga0495582_0005030_4190_5467 425
547 3300046474 Ga0495605_0000166 Ga0495605_0000166_7605_8882 425
548 3300046474 Ga0495605_0016349 Ga0495605_0016349_1797_3074 425
549 3300046491 Ga0495584_0000755 Ga0495584_0000755_7055_8332 425
550 3300046491 Ga0495584_0001114 Ga0495584_0001114_4266_5543 425
551 3300046491 Ga0495584_0021488 Ga0495584_0021488_1619_2896 425
552 3300046492 Ga0495585_0000742 Ga0495585_0000742_25266_26543 425
553 3300046492 Ga0495585_0008221 Ga0495585_0008221_770_2047 425
554 3300046492 Ga0495585_0017784 Ga0495585_0017784_1852_3129 425
555 3300046492 Ga0495585_0065816 Ga0495585_0065816_174_1451 425
556 3300046499 Ga0495594_0009364 Ga0495594_0009364_1571_2848 425
557 3300046500 Ga0495596_0000282 Ga0495596_0000282_1744_3021 425
558 3300046500 Ga0495596_0001341 Ga0495596_0001341_11125_12402 425
559 3300046500 Ga0495596_0017959 Ga0495596_0017959_43_1320 425
560 3300046501 Ga0495607_0000569 Ga0495607_0000569_2548_3825 425
561 3300046501 Ga0495607_0000761 Ga0495607_0000761_6760_8037 425
562 3300046501 Ga0495607_0002170 Ga0495607_0002170_14750_16027 425
563 3300046501 Ga0495607_0028022 Ga0495607_0028022_1301_2578 425
564 3300046501 Ga0495607_0043480 Ga0495607_0043480_324_1601 425
565 3300046506 Ga0495583_0003019 Ga0495583_0003019_7361_8638 425
566 3300046507 Ga0495606_0017721 Ga0495606_0017721_1274_2551 425
567 3300046513 Ga0495616_0006765 Ga0495616_0006765_751_2028 425
568 3300046513 Ga0495616_0015488 Ga0495616_0015488_632_1909 425
569 3300046513 Ga0495616_0019091 Ga0495616_0019091_2018_3295 425
570 3300046513 Ga0495616_0083987 Ga0495616_0083987_46_1323 425
571 3300046519 Ga0495632_0001724 Ga0495632_0001724_7198_8475 425
572 3300046519 Ga0495632_0019098 Ga0495632_0019098_1852_3129 425
573 3300046522 Ga0495643_0000983 Ga0495643_0000983_4228_5505 425
574 3300046522 Ga0495643_0001243 Ga0495643_0001243_2710_3987 425
575 3300046522 Ga0495643_0009267 Ga0495643_0009267_2560_3837 425
576 3300046522 Ga0495643_0018628 Ga0495643_0018628_1704_2981 425
577 3300046522 Ga0495643_0021644 Ga0495643_0021644_1995_3272 425
578 3300046523 Ga0495644_0013780 Ga0495644_0013780_746_2023 425
579 3300046524 Ga0495648_0002408 Ga0495648_0002408_1732_3009 425
580 3300046524 Ga0495648_0006066 Ga0495648_0006066_7259_8536 425
581 3300046524 Ga0495648_0006655 Ga0495648_0006655_1203_2480 425
582 3300046525 Ga0495663_0006301 Ga0495663_0006301_1364_2641 425
583 3300046526 Ga0495666_0007649 Ga0495666_0007649_1632_2909 425
584 3300046528 Ga0495642_0002646 Ga0495642_0002646_3261_4538 425
585 3300046528 Ga0495642_0016098 Ga0495642_0016098_914_2191 425
586 3300046529 Ga0495652_0124737 Ga0495652_0124737_398_1681 425
587 3300046531 Ga0495665_0011811 Ga0495665_0011811_78_1355 425
588 3300046535 Ga0495586_0044065 Ga0495586_0044065_154_1431 425
589 3300046538 Ga0495609_0000028 Ga0495609_0000028_49518_50795 425
590 3300046538 Ga0495609_0002870 Ga0495609_0002870_6614_7891 425
591 3300046538 Ga0495609_0005090 Ga0495609_0005090_2136_3413 425
592 3300046538 Ga0495609_0029527 Ga0495609_0029527_501_1778 425
593 3300046542 Ga0495597_0007716 Ga0495597_0007716_1986_3263 425
594 3300046558 Ga0495633_0025626 Ga0495633_0025626_1350_2627 425
595 3300046558 Ga0495633_0026080 Ga0495633_0026080_230_1534 425
596 3300046615 Ga0495656_0001209 Ga0495656_0001209_2468_3745 425
597 3300046616 Ga0495668_0093555 Ga0495668_0093555_332_1615 425
598 3300046642 Ga0495634_0000991 Ga0495634_0000991_5511_6788 425
599 3300046648 Ga0495611_0043745 Ga0495611_0043745_695_1972 425
600 3300046660 Ga0495625_0055874 Ga0495625_0055874_1397_2674 425
601 3300046664 Ga0495659_0008002 Ga0495659_0008002_1376_2653 425
602 3300046665 Ga0495661_0000157 Ga0495661_0000157_18106_19383 425
603 3300046665 Ga0495661_0002008 Ga0495661_0002008_14460_15737 425
604 3300046665 Ga0495661_0004573 Ga0495661_0004573_8404_9681 425
605 3300046665 Ga0495661_0018779 Ga0495661_0018779_2347_3624 425
606 3300046665 Ga0495661_0031969 Ga0495661_0031969_776_2080 425
607 3300046665 Ga0495661_0044035 Ga0495661_0044035_333_1610 425
608 3300046665 Ga0495661_0046669 Ga0495661_0046669_350_1627 425
609 3300046665 Ga0495661_0060555 Ga0495661_0060555_719_1996 425
610 3300046665 Ga0495661_0084247 Ga0495661_0084247_459_1736 425
611 3300046674 Ga0495588_0000113 Ga0495588_0000113_62090_63367 425
612 3300046679 Ga0495623_0034581 Ga0495623_0034581_1480_2763 425
613 3300046684 Ga0495669_0048026 Ga0495669_0048026_262_1539 425
614 3300046691 Ga0495670_0012681 Ga0495670_0012681_820_2124 425
615 3300046694 Ga0495649_0052867 Ga0495649_0052867_889_2166 425
616 3300046794 Ga0495589_0000098 Ga0495589_0000098_33209_34486 425
617 3300046794 Ga0495589_0000117 Ga0495589_0000117_14878_16155 425
618 3300046794 Ga0495589_0025125 Ga0495589_0025125_990_2267 425
619 3300046810 Ga0495660_0005424 Ga0495660_0005424_2887_4164 425
620 3300047317 Ga0495604_0097389 Ga0495604_0097389_740_2017 425
621 3300047318 Ga0495636_0009716 Ga0495636_0009716_254_1531 425
622 3300047320 Ga0495672_0000014 Ga0495672_0000014_95752_97140 425
623 3300047320 Ga0495672_0000464 Ga0495672_0000464_13559_14836 425
624 3300047320 Ga0495672_0004632 Ga0495672_0004632_7682_8959 425
625 3300047321 Ga0495676_0071183 Ga0495676_0071183_379_1656 425
626 3300047323 Ga0495683_0000112 Ga0495683_0000112_7159_8436 425
627 3300047323 Ga0495683_0009188 Ga0495683_0009188_3630_4907 425
628 3300047323 Ga0495683_0032215 Ga0495683_0032215_323_1600 425
629 3300047443 Ga0495687_000054 Ga0495687_000054_83561_84838 425
630 3300047443 Ga0495687_000430 Ga0495687_000430_43626_44903 425
631 3300047443 Ga0495687_006707 Ga0495687_006707_3084_4361 425
632 3300047444 Ga0495675_0000641 Ga0495675_0000641_1062_2339 425
633 3300047445 Ga0495677_0000012 Ga0495677_0000012_83418_84695 425
634 3300047445 Ga0495677_0000154 Ga0495677_0000154_22784_24061 425
635 3300047445 Ga0495677_0001386 Ga0495677_0001386_8348_9625 425
636 3300047445 Ga0495677_0003569 Ga0495677_0003569_528_1805 425
637 3300047445 Ga0495677_0004324 Ga0495677_0004324_3827_5131 425
638 3300047470 Ga0495681_0042084 Ga0495681_0042084_22_1299 425
639 3300047472 Ga0495686_0000219 Ga0495686_0000219_45579_46856 425
640 3300047472 Ga0495686_0046279 Ga0495686_0046279_639_1979 425
641 3300048088 Ga0495602_0002022 Ga0495602_0002022_12810_14087 425
642 3300048091 Ga0495626_0000036 Ga0495626_0000036_107121_108398 425
643 3300048091 Ga0495626_0000603 Ga0495626_0000603_7458_8735 425
644 3300048091 Ga0495626_0001290 Ga0495626_0001290_16030_17307 425
645 3300048091 Ga0495626_0006446 Ga0495626_0006446_4399_5676 425
646 3300048091 Ga0495626_0007753 Ga0495626_0007753_98_1375 425
647 3300048091 Ga0495626_0016949 Ga0495626_0016949_984_2261 425
648 3300048091 Ga0495626_0058503 Ga0495626_0058503_247_1551 425
649 3300048906 Ga0496103_0049118 Ga0496103_0049118_1058_2335 425
650 3300048908 Ga0496105_0006505 Ga0496105_0006505_7013_8308 425
651 3300048909 Ga0496106_0009466 Ga0496106_0009466_1180_2457 425
652 3300048917 Ga0496114_0031518 Ga0496114_0031518_741_2036 425
653 3300048927 Ga0496124_0124526 Ga0496124_0124526_587_1864 425
654 3300049459 Ga0495678_002126 Ga0495678_002126_4002_5282 425
655 3300049459 Ga0495678_010341 Ga0495678_010341_2735_4015 425
656 3300049526 Ga0501303_001395 Ga0501303_001395_311_1588 425
657 3300050496 nmdc:mga07m45_80278_c1 nmdc:mga07m45_80278_c1_451_1728 425
658 3300050516 nmdc:mga0sz30_9719_c1 nmdc:mga0sz30_9719_c1_2015_3310 425
659 3300061719 Ga0466962_0026080 Ga0466962_0026080_548_1825 425
660 iso_pu_bacteria 2842733646 2842738904 425
661 iso_pu_bacteria 2904541872 2904545458 425
662 iso_pu_bacteria 2929160207 2929168097 425
663 3300001979 JGI24740J21852_10014361 JGI24740J21852_100143613 426
664 3300002987 JGI25159J45721_1011057 JGI25159J45721_10110572 426
665 3300003187 JGI25151J46595_10000695 JGI25151J46595_1000069512 426
666 3300003320 rootH2_10072399 rootH2_100723992 426
667 3300003578 Ga0006562J51391_1083712 Ga0006562J51391_10837123 426
668 3300003761 Ga0055535_1005347 Ga0055535_10053473 426
669 3300003762 Ga0055542_1000003 Ga0055542_100000332 426
670 3300005262 Ga0065165_1021691 Ga0065165_10216912 426
671 3300005289 Ga0065704_10154625 Ga0065704_101546251 426
672 3300005327 Ga0070658_10102832 Ga0070658_101028322 426
673 3300005334 Ga0068869_100041629 Ga0068869_1000416294 426
674 3300005335 Ga0070666_10142253 Ga0070666_101422532 426
675 3300005340 Ga0070689_100052468 Ga0070689_1000524683 426
676 3300005353 Ga0070669_100007962 Ga0070669_1000079626 426
677 3300005354 Ga0070675_100033538 Ga0070675_1000335384 426
678 3300005441 Ga0070700_100013454 Ga0070700_1000134544 426
679 3300005563 Ga0068855_100065592 Ga0068855_1000655922 426
680 3300005564 Ga0070664_100022410 Ga0070664_1000224103 426
681 3300005616 Ga0068852_100037047 Ga0068852_1000370473 426
682 3300005617 Ga0068859_100042745 Ga0068859_1000427455 426
683 3300005834 Ga0068851_10001660 Ga0068851_100016605 426
684 3300005842 Ga0068858_100045414 Ga0068858_1000454143 426
685 3300005843 Ga0068860_100106666 Ga0068860_1001066664 426
686 3300005844 Ga0068862_100014905 Ga0068862_1000149055 426
687 3300006177 Ga0075362_10043920 Ga0075362_100439202 426
688 3300006237 Ga0097621_100104451 Ga0097621_1001044512 426
689 3300006353 Ga0075370_10001330 Ga0075370_100013305 426
690 3300006358 Ga0068871_100039244 Ga0068871_1000392442 426
691 3300006881 Ga0068865_100034173 Ga0068865_1000341733 426
692 3300006931 Ga0097620_100042744 Ga0097620_1000427444 426
693 3300009093 Ga0105240_10013577 Ga0105240_100135775 426
694 3300009093 Ga0105240_10034345 Ga0105240_100343452 426
695 3300009147 Ga0114129_10037773 Ga0114129_100377736 426
696 3300009176 Ga0105242_10003323 Ga0105242_100033232 426
697 3300009545 Ga0105237_10000373 Ga0105237_1000037357 426
698 3300009551 Ga0105238_10007050 Ga0105238_100070504 426
699 3300010375 Ga0105239_10007855 Ga0105239_100078554 426
700 3300010375 Ga0105239_10027359 Ga0105239_100273595 426
701 3300013100 Ga0157373_10025982 Ga0157373_100259825 426
702 3300013102 Ga0157371_10023628 Ga0157371_100236284 426
703 3300013104 Ga0157370_10145322 Ga0157370_101453222 426
704 3300013105 Ga0157369_10011382 Ga0157369_100113824 426
705 3300014325 Ga0163163_10006631 Ga0163163_100066319 426
706 3300014497 Ga0182008_10000669 Ga0182008_100006694 426
707 3300014497 Ga0182008_10004332 Ga0182008_100043326 426
708 3300014968 Ga0157379_10232763 Ga0157379_102327632 426
709 3300017792 Ga0163161_10000117 Ga0163161_1000011720 426
710 3300017792 Ga0163161_10078831 Ga0163161_100788312 426
711 3300017792 Ga0163161_10100253 Ga0163161_101002532 426
712 3300021384 Ga0213876_10029348 Ga0213876_100293482 426
713 3300025228 Ga0209672_100709 Ga0209672_1007095 426
714 3300025229 Ga0209147_100791 Ga0209147_1007918 426
715 3300025242 Ga0209258_100015 Ga0209258_100015150 426
716 3300025245 Ga0207425_1000635 Ga0207425_10006354 426
717 3300025254 Ga0209148_1000028 Ga0209148_1000028518 426
718 3300025284 Ga0209130_1004806 Ga0209130_10048062 426
719 3300025294 Ga0209025_1000029 Ga0209025_1000029293 426
720 3300025294 Ga0209025_1000102 Ga0209025_1000102138 426
721 3300025297 Ga0209758_1008239 Ga0209758_10082393 426
722 3300025298 Ga0209050_1008771 Ga0209050_10087711 426
723 3300025302 Ga0207426_1010023 Ga0207426_10100233 426
724 3300025321 Ga0207656_10013430 Ga0207656_100134303 426
725 3300025899 Ga0207642_10015711 Ga0207642_100157112 426
726 3300025909 Ga0207705_10046473 Ga0207705_100464733 426
727 3300025913 Ga0207695_10018467 Ga0207695_100184675 426
728 3300025914 Ga0207671_10006670 Ga0207671_100066708 426
729 3300025917 Ga0207660_10084349 Ga0207660_100843493 426
730 3300025918 Ga0207662_10066090 Ga0207662_100660903 426
731 3300025927 Ga0207687_10039884 Ga0207687_100398844 426
732 3300025934 Ga0207686_10030105 Ga0207686_100301054 426
733 3300025936 Ga0207670_10051788 Ga0207670_100517883 426
734 3300025938 Ga0207704_10029962 Ga0207704_100299622 426
735 3300025942 Ga0207689_10008236 Ga0207689_100082364 426
736 3300025942 Ga0207689_10067944 Ga0207689_100679442 426
737 3300025949 Ga0207667_10179760 Ga0207667_101797601 426
738 3300026035 Ga0207703_10021334 Ga0207703_100213343 426
739 3300026035 Ga0207703_10205623 Ga0207703_102056232 426
740 3300026041 Ga0207639_10051558 Ga0207639_100515582 426
741 3300026075 Ga0207708_10002375 Ga0207708_1000237510 426
742 3300026089 Ga0207648_10006030 Ga0207648_100060307 426
743 3300026118 Ga0207675_100031263 Ga0207675_1000312632 426
744 3300028379 Ga0268266_10151459 Ga0268266_101514592 426
745 3300028380 Ga0268265_10186240 Ga0268265_101862402 426
746 3300028794 Ga0307515_10000873 Ga0307515_1000087324 426
747 3300037471 Ga0395905_0026610 Ga0395905_0026610_3507_4814 426
748 3300037471 Ga0395905_0047612 Ga0395905_0047612_637_1932 426
749 3300037471 Ga0395905_0091400 Ga0395905_0091400_868_2181 426
750 3300037471 Ga0395905_0238178 Ga0395905_0238178_169_1449 426
751 3300039437 Ga0436365_1875695 Ga0436365_1875695_2890_4173 426
752 3300041404 Ga0439436_0002503 Ga0439436_0002503_2335_3618 426
753 3300041410 Ga0439461_0002679 Ga0439461_0002679_840_2123 426
754 3300041411 Ga0439466_0004282 Ga0439466_0004282_2033_3316 426
755 3300041413 Ga0439465_0001337 Ga0439465_0001337_792_2075 426
756 3300041997 Ga0439431_0002212 Ga0439431_0002212_1648_2931 426
757 3300041999 Ga0439433_0000393 Ga0439433_0000393_1190_2473 426
758 3300042004 Ga0439445_0001138 Ga0439445_0001138_4356_5639 426
759 3300042006 Ga0439432_002995 Ga0439432_002995_44_1354 426
760 3300042006 Ga0439432_015490 Ga0439432_015490_120_1403 426
761 3300042007 Ga0439449_0000440 Ga0439449_0000440_631_1914 426
762 3300042007 Ga0439449_0002955 Ga0439449_0002955_671_1981 426
763 3300042010 Ga0439452_002568 Ga0439452_002568_2226_3536 426
764 3300042010 Ga0439452_004053 Ga0439452_004053_2871_4154 426
765 3300042014 Ga0439457_002668 Ga0439457_002668_3555_4838 426
766 3300042015 Ga0439462_0016150 Ga0439462_0016150_263_1573 426
767 3300042115 Ga0450911_000229 Ga0450911_000229_18106_19407 426
768 3300042131 Ga0450894_004420 Ga0450894_004420_154_1491 426
769 3300042134 Ga0450898_008797 Ga0450898_008797_202_1491 426
770 3300042145 Ga0450906_008648 Ga0450906_008648_138_1448 426
771 3300042156 Ga0439446_0001674 Ga0439446_0001674_2569_3852 426
772 3300042435 Ga0439434_0013114 Ga0439434_0013114_910_2220 426
773 3300042435 Ga0439434_0016440 Ga0439434_0016440_58_1341 426
774 3300042532 Ga0450893_0007321 Ga0450893_0007321_208_1497 426
775 3300046471 Ga0495650_0003845 Ga0495650_0003845_527_1807 426
776 3300046528 Ga0495642_0018068 Ga0495642_0018068_1252_2535 426
777 3300046539 Ga0495621_0009386 Ga0495621_0009386_316_1758 426
778 3300046615 Ga0495656_0000057 Ga0495656_0000057_50770_52212 426
779 3300048090 Ga0495615_0007699 Ga0495615_0007699_607_1890 426
780 3300048904 Ga0496101_0152460 Ga0496101_0152460_238_1533 426
781 3300048911 Ga0496108_0015356 Ga0496108_0015356_1112_2395 426
782 3300048911 Ga0496108_0095376 Ga0496108_0095376_979_2271 426
783 3300048912 Ga0496109_0087066 Ga0496109_0087066_161_1444 426
784 3300048915 Ga0496112_0008206 Ga0496112_0008206_4933_6225 426
785 3300048916 Ga0496113_0145983 Ga0496113_0145983_483_1775 426
786 3300048920 Ga0496117_0009273 Ga0496117_0009273_3056_4375 426
787 3300048921 Ga0496118_0005723 Ga0496118_0005723_3204_4484 426
788 3300048925 Ga0496122_0000039 Ga0496122_0000039_165920_167254 426
789 3300048926 Ga0496123_0000026 Ga0496123_0000026_166016_167350 426
790 3300048928 Ga0496125_0005683 Ga0496125_0005683_1556_2839 426
791 3300050489 nmdc:mga03683_30774_c1 nmdc:mga03683_30774_c1_756_2045 426
792 3300050490 nmdc:mga03n38_73780_c1 nmdc:mga03n38_73780_c1_86_1375 426
793 3300050514 nmdc:mga08x19_91616_c1 nmdc:mga08x19_91616_c1_89_1378 426
794 3300053121 Ga0500607_011616 Ga0500607_011616_3260_4540 426
795 iso_pu_bacteria 2643221654 2644301903 426
796 iso_pu_bacteria 2738541277 2738721944 426
797 iso_pu_bacteria 2738543019 2739282308 426

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13091

PLDc_2

PLD-like domain

313

442

0.96

PF13091

PLDc_2

PLD-like domain

128

270

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.8577 244 401
1byr-assembly1.cif.gz_A crystal structure of a phospholipase d family member, nuc from salmonella typhimurium 0.8473 244 401
6ohr-assembly1.cif.gz_A structure of compound 5 bound human phospholipase d1 catalytic domain 0.8101 60 379
4gem-assembly1.cif.gz_B crystal structure of zucchini (k171a) 0.8047 247 400
6ohm-assembly1.cif.gz_A structure of tungstate bound human phospholipase d2 catalytic domain 0.801 60 379
ID Description Score Start End Superfamily
af_P0A6H8_316_458_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9602 261 398 3.30.870.10
af_Q2FWG8_323_468_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9518 261 400 3.30.870.10
af_P0AA84_201_339_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9496 261 392 3.30.870.10
af_Q54P99_397_594_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9486 247 417 3.30.870.10
af_Q2FYW4_304_492_3.30.870.10 Alpha Beta;2-Layer Sandwich;Endonuclease; Chain A;Endonuclease Chain A 0.9403 241 424 3.30.870.10
ID Description Score Start End GO Terms
AF-A0A527ZF64-F1-model_v4 Phospholipase D (Choline phosphatase) 0.9799 257 355 GO:0005576
GO:0008808
GO:0016020
GO:0032049
AF-A0A519HAL0-F1-model_v4 deleted 0.9796 191 426
AF-A0A519HAL0-F1-model_v4 deleted 0.9755 191 426
AF-A0A536WF28-F1-model_v4 Cardiolipin synthase B 0.9749 256 426 GO:0030572
GO:0032049
AF-A0A3S3RFX2-F1-model_v4 Phospholipase D (Choline phosphatase) 0.9747 180 426 GO:0005576
GO:0008808
GO:0016020
GO:0032049

Feature Viewer

pLDDT pTM Quality
88.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map