F481211

General Info

Members Datasets Scaffolds Average Seq Length
796 333 1593 110

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0421984|Ga0496107_0421984_134_499
Length 121
Sequence MQRGGDDMPPRGVKKGTKRARQYEHIKESLQERGTSTDRAEEIAARTVNKERARSGEAQSPSRLSRTDMSSGRRGGLRSGTNRPKGRTRDQLYNEAKSLNIRGRSKMSKAELERAVEAKKR

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
105 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
197 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
203 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
204 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
205 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
206 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
213 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
214 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
302 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
303 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
304 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
305 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
306 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
307 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
326 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
327 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
328 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
332 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
333 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.22
Metatranscriptomes 5.53
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 7.04
Rhizosphere 89.2
Stem 0
Stem Tuber 0
Unclassified 1.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0421984 3300048910 Bacteria 992
2 JGI25406J46586_10001263 3300003203 Bacteria 11868
3 rootH2_10006169 3300003320 Bacteria 3443
4 rootL2_10041069 3300003322 Bacteria 8471
5 rootH1_10027198 3300003316 Bacteria 2915
6 rootH1_10027198 3300003323 Bacteria 7953
7 Ga0007427J51700_109519 3300003559 Bacteria 569
8 Ga0070658_10017583 3300005327 Bacteria 5718
9 Ga0070683_100013246 3300005329 Bacteria 7187
10 Ga0070683_100375877 3300005329 Bacteria 1354
11 Ga0070683_100705175 3300005329 Bacteria 967
12 Ga0070683_100985451 3300005329 Bacteria 809
13 Ga0068869_101011515 3300005334 Bacteria 724
14 Ga0070680_100063278 3300005336 Bacteria 3030
15 Ga0070680_100132125 3300005336 Bacteria 2089
16 Ga0070682_100045721 3300005337 Bacteria 2715
17 Ga0068868_100129119 3300005338 Bacteria 2067
18 Ga0068868_100155436 3300005338 Bacteria 1886
19 Ga0070660_100044584 3300005339 Bacteria 3393
20 Ga0070660_100789106 3300005339 Bacteria 798
21 Ga0070691_10195979 3300005341 Bacteria 1059
22 Ga0070661_100255804 3300005344 Bacteria 1353
23 Ga0070668_100506346 3300005347 Bacteria 1046
24 Ga0070668_101255012 3300005347 Bacteria 672
25 Ga0070675_100165282 3300005354 Bacteria 1906
26 Ga0070674_100313926 3300005356 Bacteria 1254
27 Ga0070659_100336249 3300005366 Bacteria 1265
28 Ga0070714_100003734 3300005435 Bacteria 11416
29 Ga0070714_100055825 3300005435 Bacteria 3376
30 Ga0070714_100082557 3300005435 Bacteria 2800
31 Ga0070714_100140653 3300005435 Bacteria 2166
32 Ga0070714_100250950 3300005435 Bacteria 1636
33 Ga0070714_100402850 3300005435 Bacteria 1293
34 Ga0070714_100518757 3300005435 Bacteria 1138
35 Ga0070714_100642648 3300005435 Bacteria 1021
36 Ga0070714_101296095 3300005435 Bacteria 711
37 Ga0070714_102143551 3300005435 Bacteria 544
38 Ga0070714_102184503 3300005435 Bacteria 539
39 Ga0070713_100113659 3300005436 Bacteria 2364
40 Ga0070713_100506482 3300005436 Bacteria 1140
41 Ga0070713_101086562 3300005436 Bacteria 773
42 Ga0070710_10048385 3300005437 Bacteria 2375
43 Ga0070710_10116205 3300005437 Bacteria 1613
44 Ga0070710_11360357 3300005437 Bacteria 530
45 Ga0070711_100022262 3300005439 Bacteria 4106
46 Ga0070711_101490501 3300005439 Bacteria 590
47 Ga0070711_101860131 3300005439 Bacteria 529
48 Ga0070700_100066551 3300005441 Bacteria 2287
49 Ga0070700_101506203 3300005441 Bacteria 572
50 Ga0070694_100467226 3300005444 Bacteria 999
51 Ga0070708_100010297 3300005445 Bacteria 7570
52 Ga0070663_100101967 3300005455 Bacteria 2143
53 Ga0070678_100055483 3300005456 Bacteria 2893
54 Ga0070681_10172375 3300005458 Bacteria 2085
55 Ga0070681_10552771 3300005458 Bacteria 1065
56 Ga0068867_101040855 3300005459 Bacteria 744
57 Ga0068867_101809007 3300005459 Bacteria 574
58 Ga0070706_100000038 3300005467 Bacteria 150665
59 Ga0070707_100901231 3300005468 Bacteria 849
60 Ga0070707_101202545 3300005468 Bacteria 724
61 Ga0070699_101426364 3300005518 Bacteria 635
62 Ga0070679_100041942 3300005530 Bacteria 4556
63 Ga0070679_100140028 3300005530 Bacteria 2399
64 Ga0070684_100003352 3300005535 Bacteria 12000
65 Ga0070684_100502815 3300005535 Bacteria 1123
66 Ga0070684_101734784 3300005535 Bacteria 589
67 Ga0070697_100015294 3300005536 Bacteria 6022
68 Ga0070697_100378885 3300005536 Bacteria 1225
69 Ga0070697_101592217 3300005536 Bacteria 584
70 Ga0070672_102169589 3300005543 Bacteria 501
71 Ga0070695_100118600 3300005545 Bacteria 1807
72 Ga0070695_100474583 3300005545 Bacteria 963
73 Ga0070696_100241651 3300005546 Bacteria 1362
74 Ga0070693_100089845 3300005547 Bacteria 1850
75 Ga0070704_100258443 3300005549 Bacteria 1434
76 Ga0070704_100634884 3300005549 Bacteria 942
77 Ga0068855_101903392 3300005563 Bacteria 602
78 Ga0070664_100784656 3300005564 Bacteria 890
79 Ga0070664_101001750 3300005564 Bacteria 785
80 Ga0070664_101918820 3300005564 Bacteria 562
81 Ga0068857_101696120 3300005577 Bacteria 618
82 Ga0068854_100486918 3300005578 Bacteria 1036
83 Ga0068854_101880928 3300005578 Bacteria 550
84 Ga0068856_100017061 3300005614 Bacteria 7039
85 Ga0068856_100035062 3300005614 Bacteria 4916
86 Ga0068856_100194421 3300005614 Bacteria 2043
87 Ga0068856_101731509 3300005614 Bacteria 637
88 Ga0068852_100290518 3300005616 Bacteria 1579
89 Ga0068852_101399278 3300005616 Bacteria 721
90 Ga0068859_101935074 3300005617 Bacteria 651
91 Ga0068866_10244675 3300005718 Bacteria 1094
92 Ga0068861_100008993 3300005719 Bacteria 6884
93 Ga0068870_10066305 3300005840 Bacteria 1955
94 Ga0068870_11158466 3300005840 Bacteria 558
95 Ga0068860_100229996 3300005843 Bacteria 1802
96 Ga0068862_100251249 3300005844 Bacteria 1611
97 Ga0081455_10022384 3300005937 Bacteria 5908
98 Ga0081455_10050705 3300005937 Bacteria 3566
99 Ga0081455_10074069 3300005937 Bacteria 2813
100 Ga0081538_10061172 3300005981 Bacteria 2158
101 Ga0081538_10103111 3300005981 Bacteria 1429
102 Ga0081538_10172110 3300005981 Bacteria 943
103 Ga0081539_10000369 3300005985 Bacteria 98527
104 Ga0081539_10011388 3300005985 Bacteria 7036
105 Ga0070717_10006823 3300006028 Bacteria 8428
106 Ga0070717_10072447 3300006028 Bacteria 2877
107 Ga0070717_10282232 3300006028 Bacteria 1473
108 Ga0075365_10172637 3300006038 Bacteria 1509
109 Ga0075368_10094537 3300006042 Bacteria 1224
110 Ga0075363_100849818 3300006048 Unclassified 557
111 Ga0075432_10009415 3300006058 Bacteria 3326
112 Ga0070715_10186187 3300006163 Bacteria 1045
113 Ga0070716_100475034 3300006173 Bacteria 917
114 Ga0070716_100759739 3300006173 Bacteria 747
115 Ga0070716_101042025 3300006173 Bacteria 649
116 Ga0070712_100044941 3300006175 Bacteria 3047
117 Ga0070712_100361826 3300006175 Bacteria 1190
118 Ga0070712_100512183 3300006175 Bacteria 1007
119 Ga0070712_100634130 3300006175 Bacteria 907
120 Ga0097621_100473646 3300006237 Bacteria 1131
121 Ga0068871_100652199 3300006358 Bacteria 961
122 Ga0068871_101166646 3300006358 Bacteria 722
123 Ga0075431_100753382 3300006847 Bacteria 949
124 Ga0075431_100788510 3300006847 Bacteria 924
125 Ga0075433_10003586 3300006852 Bacteria 11988
126 Ga0075433_10056467 3300006852 Bacteria 3429
127 Ga0075433_11841064 3300006852 Bacteria 520
128 Ga0075434_100091860 3300006871 Bacteria 3037
129 Ga0075436_100006385 3300006914 Bacteria 8080
130 Ga0075436_100515069 3300006914 Bacteria 876
131 Ga0075436_100979493 3300006914 Bacteria 634
132 Ga0097620_101934276 3300006931 Bacteria 651
133 Ga0075435_100002208 3300007076 Bacteria 12844
134 Ga0105240_10034366 3300009093 Bacteria 6539
135 Ga0105240_10126196 3300009093 Bacteria 3075
136 Ga0105240_10513658 3300009093 Bacteria 1330
137 Ga0105240_12045589 3300009093 Bacteria 595
138 Ga0105240_12515721 3300009093 Bacteria 532
139 Ga0111539_10007774 3300009094 Bacteria 13687
140 Ga0111539_10838796 3300009094 Bacteria 1069
141 Ga0111539_13436260 3300009094 Bacteria 509
142 Ga0105245_10033318 3300009098 Bacteria 4565
143 Ga0105245_10147667 3300009098 Bacteria 2220
144 Ga0105245_10341429 3300009098 Bacteria 1481
145 Ga0105245_12536946 3300009098 Bacteria 566
146 Ga0114129_10003258 3300009147 Bacteria 22793
147 Ga0114129_10022983 3300009147 Bacteria 8846
148 Ga0114129_10042773 3300009147 Bacteria 6376
149 Ga0114129_10089066 3300009147 Bacteria 4278
150 Ga0114129_10198037 3300009147 Bacteria 2723
151 Ga0114129_11425992 3300009147 Bacteria 854
152 Ga0105243_10268733 3300009148 Bacteria 1530
153 Ga0105243_12668447 3300009148 Bacteria 540
154 Ga0105241_10076162 3300009174 Bacteria 2615
155 Ga0105242_10178226 3300009176 Bacteria 1873
156 Ga0105242_10379590 3300009176 Bacteria 1313
157 Ga0105242_10503282 3300009176 Bacteria 1153
158 Ga0105242_11771625 3300009176 Bacteria 655
159 Ga0105248_10441455 3300009177 Bacteria 1466
160 Ga0105238_10170075 3300009551 Bacteria 2155
161 Ga0105238_10612817 3300009551 Bacteria 1097
162 Ga0105238_11160752 3300009551 Bacteria 796
163 Ga0105249_10004322 3300009553 Bacteria 12288
164 Ga0105249_10241944 3300009553 Bacteria 1784
165 Ga0105249_11545437 3300009553 Bacteria 736
166 Ga0105249_12871418 3300009553 Bacteria 553
167 Ga0105035_105785 3300009988 Bacteria 1011
168 Ga0105239_10114643 3300010375 Bacteria 2989
169 Ga0105239_10255417 3300010375 Bacteria 1969
170 Ga0105246_10121420 3300011119 Bacteria 1937
171 Ga0157338_1069510 3300012515 Bacteria 547
172 Ga0157373_10107685 3300013100 Bacteria 1959
173 Ga0157373_10144905 3300013100 Bacteria 1670
174 Ga0157370_10041767 3300013104 Bacteria 4422
175 Ga0157369_10453376 3300013105 Bacteria 1328
176 Ga0157369_10583990 3300013105 Bacteria 1154
177 Ga0157369_10682895 3300013105 Bacteria 1058
178 Ga0157374_10072133 3300013296 Bacteria 3257
179 Ga0157374_10528438 3300013296 Bacteria 1186
180 Ga0157374_10644564 3300013296 Bacteria 1071
181 Ga0157374_10846268 3300013296 Bacteria 931
182 Ga0157378_10187518 3300013297 Bacteria 1949
183 Ga0157378_10248398 3300013297 Bacteria 1702
184 Ga0163162_10061222 3300013306 Bacteria 3801
185 Ga0163162_10602345 3300013306 Bacteria 1225
186 Ga0157372_10224887 3300013307 Bacteria 2176
187 Ga0157372_10315805 3300013307 Bacteria 1819
188 Ga0157372_10709614 3300013307 Bacteria 1170
189 Ga0157372_12726129 3300013307 Bacteria 567
190 Ga0163163_11104000 3300014325 Bacteria 856
191 Ga0163163_12050608 3300014325 Bacteria 632
192 Ga0157380_10819296 3300014326 Bacteria 950
193 Ga0182008_10002753 3300014497 Bacteria 10904
194 Ga0182008_10094827 3300014497 Bacteria 1472
195 Ga0157377_10223701 3300014745 Bacteria 1206
196 Ga0157376_10789959 3300014969 Bacteria 961
197 Ga0157376_12409677 3300014969 Bacteria 566
198 Ga0182005_1220384 3300015265 Bacteria 577
199 Ga0163161_10034532 3300017792 Bacteria 3619
200 Ga0163161_10069910 3300017792 Bacteria 2567
201 Ga0163161_10202511 3300017792 Bacteria 1530
202 Ga0163161_10959493 3300017792 Unclassified 728
203 Ga0197907_10332727 3300020069 Bacteria 1363
204 Ga0197907_10363442 3300020069 Bacteria 803
205 Ga0197907_10743962 3300020069 Bacteria 805
206 Ga0197907_11264428 3300020069 Bacteria 631
207 Ga0197907_11434933 3300020069 Bacteria 761
208 Ga0197907_11510751 3300020069 Bacteria 545
209 Ga0206356_10181818 3300020070 Bacteria 518
210 Ga0206356_10546293 3300020070 Bacteria 1820
211 Ga0206356_10592005 3300020070 Bacteria 737
212 Ga0206356_10698070 3300020070 Bacteria 1344
213 Ga0206349_1920437 3300020075 Bacteria 1664
214 Ga0206355_1085196 3300020076 Bacteria 659
215 Ga0206355_1308480 3300020076 Bacteria 608
216 Ga0206351_10319915 3300020077 Bacteria 839
217 Ga0206351_10474388 3300020077 Bacteria 813
218 Ga0206352_10153780 3300020078 Bacteria 641
219 Ga0206352_11150846 3300020078 Bacteria 820
220 Ga0206350_10182264 3300020080 Bacteria 1936
221 Ga0206350_10323725 3300020080 Bacteria 773
222 Ga0206350_10327635 3300020080 Bacteria 980
223 Ga0206350_10559710 3300020080 Bacteria 779
224 Ga0206350_10707709 3300020080 Bacteria 733
225 Ga0206354_10483478 3300020081 Bacteria 501
226 Ga0206354_10657736 3300020081 Bacteria 638
227 Ga0206354_11076545 3300020081 Bacteria 727
228 Ga0206354_11153462 3300020081 Bacteria 1448
229 Ga0206353_10514252 3300020082 Bacteria 725
230 Ga0206353_10720181 3300020082 Bacteria 534
231 Ga0206353_10843001 3300020082 Bacteria 1025
232 Ga0206353_11002661 3300020082 Bacteria 651
233 Ga0206353_11007032 3300020082 Bacteria 784
234 Ga0206353_11829862 3300020082 Bacteria 1115
235 Ga0154015_1063933 3300020610 Bacteria 1784
236 Ga0154015_1530244 3300020610 Bacteria 591
237 Ga0154015_1563210 3300020610 Bacteria 630
238 Ga0213873_10112564 3300021358 Bacteria 792
239 Ga0213876_10020324 3300021384 Bacteria 3509
240 Ga0213876_10324209 3300021384 Bacteria 819
241 Ga0213876_10462812 3300021384 Bacteria 675
242 Ga0213871_10037010 3300021441 Bacteria 1297
243 Ga0224712_10055564 3300022467 Bacteria 1558
244 Ga0224712_10084999 3300022467 Bacteria 1314
245 Ga0224712_10092383 3300022467 Bacteria 1270
246 Ga0224712_10182936 3300022467 Bacteria 945
247 Ga0224712_10694745 3300022467 Bacteria 500
248 Ga0207692_10030852 3300025898 Bacteria 2561
249 Ga0207692_10835417 3300025898 Bacteria 604
250 Ga0207692_10907766 3300025898 Bacteria 580
251 Ga0207642_10488112 3300025899 Bacteria 752
252 Ga0207642_10742001 3300025899 Bacteria 621
253 Ga0207688_10024249 3300025901 Bacteria 3326
254 Ga0207685_10136424 3300025905 Bacteria 1095
255 Ga0207645_10783587 3300025907 Bacteria 648
256 Ga0207643_10073542 3300025908 Bacteria 1970
257 Ga0207643_10473607 3300025908 Bacteria 799
258 Ga0207705_10245209 3300025909 Bacteria 1365
259 Ga0207705_10970350 3300025909 Bacteria 657
260 Ga0207654_10143223 3300025911 Bacteria 1526
261 Ga0207654_10178672 3300025911 Bacteria 1383
262 Ga0207707_10009751 3300025912 Bacteria 8331
263 Ga0207707_10049009 3300025912 Bacteria 3681
264 Ga0207707_10400128 3300025912 Bacteria 1179
265 Ga0207707_10966335 3300025912 Bacteria 701
266 Ga0207695_10129279 3300025913 Bacteria 2484
267 Ga0207695_10193261 3300025913 Bacteria 1952
268 Ga0207693_10233463 3300025915 Bacteria 1444
269 Ga0207693_10388323 3300025915 Bacteria 1091
270 Ga0207693_11177333 3300025915 Bacteria 579
271 Ga0207693_11230232 3300025915 Bacteria 563
272 Ga0207663_10033597 3300025916 Bacteria 3058
273 Ga0207663_10597694 3300025916 Bacteria 867
274 Ga0207660_10034396 3300025917 Bacteria 3513
275 Ga0207660_10269902 3300025917 Bacteria 1348
276 Ga0207657_10066364 3300025919 Bacteria 3072
277 Ga0207657_10201426 3300025919 Bacteria 1601
278 Ga0207657_10503961 3300025919 Bacteria 948
279 Ga0207649_10158542 3300025920 Bacteria 1566
280 Ga0207649_10371279 3300025920 Bacteria 1064
281 Ga0207652_10108673 3300025921 Bacteria 2458
282 Ga0207646_10538050 3300025922 Bacteria 1051
283 Ga0207646_11489378 3300025922 Bacteria 586
284 Ga0207694_10167563 3300025924 Bacteria 1777
285 Ga0207694_10600219 3300025924 Bacteria 926
286 Ga0207694_11042800 3300025924 Bacteria 692
287 Ga0207659_10142642 3300025926 Bacteria 1861
288 Ga0207659_10398422 3300025926 Bacteria 1151
289 Ga0207687_10093469 3300025927 Bacteria 2199
290 Ga0207687_10096370 3300025927 Bacteria 2168
291 Ga0207687_10332931 3300025927 Bacteria 1232
292 Ga0207687_10622081 3300025927 Bacteria 912
293 Ga0207700_10079146 3300025928 Bacteria 2559
294 Ga0207700_10176035 3300025928 Bacteria 1788
295 Ga0207700_11007881 3300025928 Bacteria 745
296 Ga0207700_11815318 3300025928 Bacteria 536
297 Ga0207664_10001110 3300025929 Bacteria 17923
298 Ga0207664_10040220 3300025929 Bacteria 3634
299 Ga0207664_10126186 3300025929 Bacteria 2149
300 Ga0207664_10213640 3300025929 Bacteria 1670
301 Ga0207664_10348533 3300025929 Bacteria 1310
302 Ga0207664_10541593 3300025929 Bacteria 1044
303 Ga0207664_10576313 3300025929 Bacteria 1010
304 Ga0207664_11499032 3300025929 Bacteria 596
305 Ga0207664_11694125 3300025929 Bacteria 554
306 Ga0207690_10955466 3300025932 Bacteria 712
307 Ga0207690_11387720 3300025932 Bacteria 587
308 Ga0207690_11503512 3300025932 Bacteria 563
309 Ga0207686_10103405 3300025934 Bacteria 1906
310 Ga0207686_11012088 3300025934 Bacteria 675
311 Ga0207686_11033387 3300025934 Bacteria 668
312 Ga0207709_10480028 3300025935 Bacteria 966
313 Ga0207669_10018377 3300025937 Bacteria 3613
314 Ga0207669_10222109 3300025937 Bacteria 1387
315 Ga0207704_10359120 3300025938 Bacteria 1137
316 Ga0207704_10886307 3300025938 Bacteria 750
317 Ga0207665_10288678 3300025939 Bacteria 1223
318 Ga0207665_10379502 3300025939 Bacteria 1072
319 Ga0207691_10083210 3300025940 Bacteria 2873
320 Ga0207661_10003499 3300025944 Bacteria 10910
321 Ga0207661_10150833 3300025944 Bacteria 2009
322 Ga0207661_10335228 3300025944 Bacteria 1362
323 Ga0207661_10822273 3300025944 Bacteria 855
324 Ga0207679_10134046 3300025945 Bacteria 1992
325 Ga0207679_10688582 3300025945 Bacteria 927
326 Ga0207667_10187100 3300025949 Bacteria 2125
327 Ga0207667_10799711 3300025949 Bacteria 940
328 Ga0207667_11080450 3300025949 Bacteria 786
329 Ga0207667_11108592 3300025949 Bacteria 774
330 Ga0207712_10014920 3300025961 Bacteria 5004
331 Ga0207712_10279047 3300025961 Bacteria 1363
332 Ga0207668_10078430 3300025972 Bacteria 2385
333 Ga0207640_10348348 3300025981 Bacteria 1189
334 Ga0207640_10966753 3300025981 Bacteria 747
335 Ga0207677_10057299 3300026023 Bacteria 2675
336 Ga0207703_10223388 3300026035 Bacteria 1685
337 Ga0207678_10268487 3300026067 Bacteria 1463
338 Ga0207678_10686147 3300026067 Bacteria 901
339 Ga0207708_10612013 3300026075 Bacteria 924
340 Ga0207708_11437801 3300026075 Bacteria 605
341 Ga0207702_10033017 3300026078 Bacteria 4321
342 Ga0207702_10092917 3300026078 Bacteria 2645
343 Ga0207702_10151992 3300026078 Bacteria 2107
344 Ga0207702_10756343 3300026078 Bacteria 959
345 Ga0207648_10015239 3300026089 Bacteria 7071
346 Ga0207648_10037269 3300026089 Bacteria 4283
347 Ga0207648_10210834 3300026089 Bacteria 1724
348 Ga0207675_100000145 3300026118 Bacteria 61287
349 Ga0207675_101372708 3300026118 Bacteria 727
350 Ga0207683_10012399 3300026121 Bacteria 7274
351 Ga0207683_10617308 3300026121 Bacteria 1004
352 Ga0207683_11270055 3300026121 Bacteria 682
353 Ga0209813_10114621 3300027866 Bacteria 932
354 Ga0207428_10144022 3300027907 Bacteria 1817
355 Ga0268264_10755473 3300028381 Bacteria 969
356 Ga0268264_12504684 3300028381 Bacteria 521
357 Ga0307515_10040196 3300028794 Bacteria 7403
358 Ga0265332_10101410 3300031238 Bacteria 1214
359 Ga0307513_10006849 3300031456 Bacteria 14843
360 Ga0307408_100154950 3300031548 Bacteria 1813
361 Ga0307408_102477567 3300031548 Bacteria 504
362 Ga0307514_10102858 3300031649 Bacteria 2047
363 Ga0307516_10878469 3300031730 Bacteria 562
364 Ga0307405_10517716 3300031731 Bacteria 959
365 Ga0307413_10162282 3300031824 Bacteria 1571
366 Ga0307413_10169573 3300031824 Bacteria 1543
367 Ga0307518_10001217 3300031838 Bacteria 19293
368 Ga0307410_10018121 3300031852 Bacteria 4248
369 Ga0307410_10056893 3300031852 Bacteria 2661
370 Ga0307406_10078773 3300031901 Bacteria 2184
371 Ga0307407_10939744 3300031903 Bacteria 665
372 Ga0307407_11517429 3300031903 Bacteria 530
373 Ga0307412_10806629 3300031911 Bacteria 815
374 Ga0307409_100001368 3300031995 Bacteria 11893
375 Ga0307409_100252141 3300031995 Bacteria 1614
376 Ga0307409_100756745 3300031995 Bacteria 976
377 Ga0307409_100758814 3300031995 Bacteria 974
378 Ga0307409_100903762 3300031995 Bacteria 897
379 Ga0307416_100001194 3300032002 Bacteria 13967
380 Ga0307416_100152679 3300032002 Bacteria 2121
381 Ga0307416_100188729 3300032002 Bacteria 1941
382 Ga0307416_100606586 3300032002 Bacteria 1175
383 Ga0307416_101492580 3300032002 Bacteria 782
384 Ga0307414_10803716 3300032004 Bacteria 858
385 Ga0307411_10092491 3300032005 Bacteria 2115
386 Ga0307411_10336472 3300032005 Bacteria 1225
387 Ga0307411_10926068 3300032005 Bacteria 776
388 Ga0307415_100000800 3300032126 Bacteria 14302
389 Ga0307415_100031999 3300032126 Bacteria 3397
390 Ga0307415_100175968 3300032126 Bacteria 1674
391 Ga0373944_0199230 3300035089 Bacteria 724
392 Ga0373945_0173179 3300035116 Bacteria 885
393 Ga0373943_0026521 3300035170 Bacteria 2715
394 Ga0373943_0192210 3300035170 Bacteria 1126
395 Ga0373955_0017789 3300035172 Bacteria 3522
396 Ga0373955_0961612 3300035172 Unclassified 526
397 Ga0373947_0534586 3300035725 Bacteria 798
398 Ga0373947_0811535 3300035725 Bacteria 639
399 Ga0373937_0077207 3300036401 Bacteria 3077
400 Ga0373937_0723860 3300036401 Bacteria 942
401 Ga0373925_0363799 3300037068 Bacteria 1176
402 Ga0373925_0413038 3300037068 Bacteria 1102
403 Ga0395899_0000690 3300037312 Bacteria 33973
404 Ga0395899_0068077 3300037312 Bacteria 2611
405 Ga0395900_0006008 3300037418 Bacteria 12665
406 Ga0395900_0020460 3300037418 Bacteria 6755
407 Ga0395900_0060217 3300037418 Bacteria 3908
408 Ga0395900_0118162 3300037418 Bacteria 2721
409 Ga0395900_0254429 3300037418 Bacteria 1756
410 Ga0395900_0284682 3300037418 Bacteria 1644
411 Ga0395900_0465477 3300037418 Bacteria 1218
412 Ga0395900_0666622 3300037418 Bacteria 976
413 Ga0395900_1661557 3300037418 Bacteria 550
414 Ga0395898_0002283 3300037466 Bacteria 23109
415 Ga0395898_0039754 3300037466 Bacteria 4654
416 Ga0395898_0087916 3300037466 Bacteria 2993
417 Ga0395898_0263849 3300037466 Bacteria 1643
418 Ga0395898_0271233 3300037466 Bacteria 1618
419 Ga0395898_0275440 3300037466 Bacteria 1605
420 Ga0395898_0862553 3300037466 Bacteria 844
421 Ga0395898_0918425 3300037466 Bacteria 813
422 Ga0395905_0006791 3300037471 Bacteria 11468
423 Ga0395905_0007518 3300037471 Bacteria 10838
424 Ga0395905_0031972 3300037471 Bacteria 4951
425 Ga0395905_0033401 3300037471 Bacteria 4833
426 Ga0395905_0380713 3300037471 Bacteria 1305
427 Ga0395905_0781309 3300037471 Bacteria 858
428 Ga0395905_1179691 3300037471 Bacteria 669
429 Ga0395905_1243414 3300037471 Bacteria 648
430 Ga0395905_1364623 3300037471 Bacteria 613
431 Ga0395905_1457621 3300037471 Bacteria 589
432 Ga0436364_0446177 3300037853 Bacteria 2034
433 Ga0436364_1436221 3300037853 Bacteria 14944
434 Ga0395901_0000684 3300038443 Bacteria 38890
435 Ga0395901_0015726 3300038443 Bacteria 7709
436 Ga0395901_0042498 3300038443 Bacteria 4712
437 Ga0395901_0043740 3300038443 Bacteria 4645
438 Ga0395901_0075215 3300038443 Bacteria 3523
439 Ga0395901_0181245 3300038443 Bacteria 2209
440 Ga0395901_0329988 3300038443 Bacteria 1577
441 Ga0395901_0407474 3300038443 Bacteria 1396
442 Ga0395901_0724209 3300038443 Bacteria 990
443 Ga0395901_0728053 3300038443 Bacteria 987
444 Ga0395901_0812718 3300038443 Bacteria 923
445 Ga0395901_0845094 3300038443 Bacteria 901
446 Ga0395901_1573775 3300038443 Bacteria 611
447 Ga0436365_0965370 3300039437 Bacteria 1508
448 Ga0436365_1394435 3300039437 Bacteria 665
449 Ga0436365_1710482 3300039437 Bacteria 577
450 Ga0436360_0070468 3300039438 Bacteria 8813
451 Ga0436363_0123979 3300039450 Bacteria 501
452 Ga0436363_0228062 3300039450 Bacteria 1548
453 Ga0436363_0728344 3300039450 Bacteria 674
454 Ga0436363_0762749 3300039450 Bacteria 567
455 Ga0436363_1073212 3300039450 Bacteria 1132
456 Ga0436363_1341439 3300039450 Bacteria 735
457 Ga0436362_0852653 3300039453 Bacteria 692
458 Ga0451797_0928882 3300041453 Bacteria 774
459 Ga0451804_0630778 3300041463 Bacteria 854
460 Ga0451807_0324428 3300041486 Bacteria 712
461 Ga0451807_2017991 3300041486 Bacteria 503
462 Ga0451837_0673922 3300041494 Bacteria 607
463 Ga0451853_3110468 3300041512 Bacteria 992
464 Ga0439448_0041978 3300042005 Bacteria 1482
465 Ga0450907_025218 3300042146 Bacteria 1005
466 Ga0450907_069073 3300042146 Bacteria 612
467 Ga0450910_033138 3300042147 Bacteria 816
468 Ga0439434_0109960 3300042435 Bacteria 892
469 Ga0439464_0126521 3300042439 Bacteria 790
470 Ga0450918_017770 3300042531 Bacteria 1239
471 Ga0466969_0009309 3300044656 Bacteria 5207
472 Ga0466972_0142500 3300044658 Bacteria 1128
473 Ga0466972_0224583 3300044658 Bacteria 879
474 Ga0466972_0278295 3300044658 Bacteria 782
475 Ga0466966_0029102 3300044684 Bacteria 3596
476 Ga0466966_0120821 3300044684 Bacteria 1609
477 Ga0466966_0178062 3300044684 Bacteria 1291
478 Ga0466961_0161797 3300044693 Bacteria 1395
479 Ga0466961_0437014 3300044693 Bacteria 792
480 Ga0466961_0540369 3300044693 Bacteria 702
481 Ga0466963_0000276 3300044694 Bacteria 22861
482 Ga0466963_0000438 3300044694 Bacteria 19248
483 Ga0466963_0000673 3300044694 Bacteria 16556
484 Ga0466963_0030594 3300044694 Bacteria 3476
485 Ga0466963_0036673 3300044694 Bacteria 3198
486 Ga0466963_1116729 3300044694 Bacteria 554
487 Ga0466964_0012342 3300044706 Bacteria 3233
488 Ga0466964_0082817 3300044706 Bacteria 1380
489 Ga0466964_0473385 3300044706 Bacteria 668
490 Ga0466971_0029827 3300044719 Bacteria 2440
491 Ga0466971_0037646 3300044719 Bacteria 2169
492 Ga0466971_0570020 3300044719 Bacteria 563
493 Ga0466968_0043267 3300044735 Bacteria 1906
494 Ga0466968_0082917 3300044735 Bacteria 1412
495 Ga0466968_0206837 3300044735 Bacteria 921
496 Ga0466968_0291259 3300044735 Bacteria 783
497 Ga0466970_0438429 3300044765 Bacteria 748
498 Ga0466970_0715616 3300044765 Bacteria 584
499 Ga0466957_0007688 3300044842 Bacteria 6095
500 Ga0466957_0027851 3300044842 Bacteria 3360
501 Ga0466957_0080515 3300044842 Bacteria 2028
502 Ga0466957_0122257 3300044842 Bacteria 1660
503 Ga0466960_0672286 3300044901 Bacteria 619
504 Ga0466959_0064655 3300045049 Bacteria 2656
505 Ga0466959_0330900 3300045049 Bacteria 1040
506 Ga0466959_0403891 3300045049 Bacteria 928
507 Ga0466959_1077613 3300045049 Bacteria 534
508 Ga0451576_1497396 3300045051 Bacteria 701
509 Ga0451576_1953328 3300045051 Bacteria 605
510 Ga0466958_0002935 3300045836 Bacteria 8719
511 Ga0466958_0007963 3300045836 Bacteria 5856
512 Ga0466958_0030937 3300045836 Bacteria 3181
513 Ga0466958_0087483 3300045836 Bacteria 1924
514 Ga0466958_0172170 3300045836 Bacteria 1371
515 Ga0466958_0336860 3300045836 Bacteria 970
516 Ga0466958_0343516 3300045836 Bacteria 960
517 Ga0466958_0433703 3300045836 Bacteria 850
518 Ga0466958_0983381 3300045836 Bacteria 551
519 Ga0466967_0043133 3300045976 Bacteria 3904
520 Ga0466967_0043772 3300045976 Bacteria 3878
521 Ga0466967_0076649 3300045976 Bacteria 3008
522 Ga0466967_0344547 3300045976 Bacteria 1441
523 Ga0466967_0425213 3300045976 Bacteria 1295
524 Ga0466967_0547251 3300045976 Bacteria 1139
525 Ga0466967_0609988 3300045976 Bacteria 1077
526 Ga0466967_0802437 3300045976 Bacteria 935
527 Ga0466967_1282723 3300045976 Unclassified 730
528 Ga0466967_1521816 3300045976 Bacteria 666
529 Ga0466967_1670366 3300045976 Bacteria 634
530 Ga0495617_006894 3300046452 Bacteria 3966
531 Ga0495603_0324865 3300046455 Bacteria 883
532 Ga0495590_0110049 3300046457 Bacteria 983
533 Ga0495629_0115823 3300046459 Bacteria 1868
534 Ga0495641_0299773 3300046461 Bacteria 724
535 Ga0495641_0351749 3300046461 Bacteria 666
536 Ga0495651_0126825 3300046462 Bacteria 1868
537 Ga0495653_0267016 3300046463 Bacteria 1128
538 Ga0495653_0694864 3300046463 Bacteria 618
539 Ga0495582_0342758 3300046473 Bacteria 860
540 Ga0495639_0693877 3300046475 Bacteria 526
541 Ga0495664_0707938 3300046477 Bacteria 595
542 Ga0495584_0574218 3300046491 Bacteria 575
543 Ga0495608_0006359 3300046511 Bacteria 8386
544 Ga0495628_0415644 3300046516 Bacteria 981
545 Ga0495630_0572434 3300046517 Bacteria 866
546 Ga0495630_0985266 3300046517 Bacteria 641
547 Ga0495652_0128720 3300046529 Bacteria 2007
548 Ga0495652_0147821 3300046529 Unclassified 1840
549 Ga0495652_0154494 3300046529 Bacteria 1788
550 Ga0495652_0466651 3300046529 Bacteria 881
551 Ga0495640_0062224 3300046533 Bacteria 2532
552 Ga0495587_0024019 3300046536 Bacteria 3741
553 Ga0495587_0229803 3300046536 Bacteria 1045
554 Ga0495598_0128432 3300046537 Bacteria 867
555 Ga0495645_0067875 3300046543 Bacteria 2575
556 Ga0495645_0618096 3300046543 Bacteria 665
557 Ga0495656_0347720 3300046615 Bacteria 768
558 Ga0495656_0600236 3300046615 Bacteria 589
559 Ga0495668_0102977 3300046616 Bacteria 1562
560 Ga0495625_0353582 3300046660 Bacteria 928
561 Ga0495635_0181983 3300046663 Bacteria 1428
562 Ga0495635_0932299 3300046663 Bacteria 555
563 Ga0495588_0637593 3300046674 Bacteria 558
564 Ga0495657_0042711 3300046675 Bacteria 3093
565 Ga0495623_0043156 3300046679 Bacteria 2870
566 Ga0495623_0169756 3300046679 Bacteria 1275
567 Ga0495600_0228671 3300046809 Bacteria 1188
568 Ga0495604_0000218 3300047317 Bacteria 52385
569 Ga0495604_0017744 3300047317 Bacteria 5695
570 Ga0495604_0166210 3300047317 Bacteria 1555
571 Ga0495604_0284053 3300047317 Bacteria 1117
572 Ga0495604_0297958 3300047317 Bacteria 1084
573 Ga0495604_0349062 3300047317 Bacteria 983
574 Ga0495636_0009995 3300047318 Bacteria 3740
575 Ga0495672_0054123 3300047320 Unclassified 2348
576 Ga0495676_0268302 3300047321 Bacteria 1159
577 Ga0495676_0599519 3300047321 Bacteria 717
578 Ga0495680_0016214 3300047322 Bacteria 6407
579 Ga0495680_0029916 3300047322 Bacteria 4453
580 Ga0495680_0181119 3300047322 Bacteria 1521
581 Ga0495687_004253 3300047443 Bacteria 9805
582 Ga0495675_0317373 3300047444 Bacteria 922
583 Ga0495685_054811 3300047447 Bacteria 1349
584 Ga0495685_259261 3300047447 Bacteria 550
585 Ga0495681_0037200 3300047470 Bacteria 2400
586 Ga0495684_0099715 3300047471 Bacteria 2196
587 Ga0495686_0006203 3300047472 Bacteria 9221
588 Ga0495593_0333188 3300047673 Bacteria 759
589 Ga0495602_0237459 3300048088 Bacteria 1365
590 Ga0495602_0327822 3300048088 Bacteria 1111
591 Ga0495602_0463825 3300048088 Bacteria 892
592 Ga0496100_0006193 3300048903 Bacteria 6508
593 Ga0496100_0020253 3300048903 Bacteria 3985
594 Ga0496100_0100388 3300048903 Bacteria 1994
595 Ga0496100_0137830 3300048903 Bacteria 1726
596 Ga0496100_0175884 3300048903 Bacteria 1545
597 Ga0496100_0201780 3300048903 Bacteria 1450
598 Ga0496101_0010181 3300048904 Bacteria 6205
599 Ga0496101_0033594 3300048904 Bacteria 3618
600 Ga0496101_0095023 3300048904 Bacteria 2223
601 Ga0496101_0168140 3300048904 Bacteria 1684
602 Ga0496101_0880524 3300048904 Bacteria 705
603 Ga0496102_0018165 3300048905 Bacteria 6172
604 Ga0496102_0152265 3300048905 Bacteria 2174
605 Ga0496102_0240692 3300048905 Bacteria 1706
606 Ga0496102_0566989 3300048905 Bacteria 1058
607 Ga0496102_0722053 3300048905 Bacteria 919
608 Ga0496102_1076746 3300048905 Bacteria 724
609 Ga0496102_1521830 3300048905 Bacteria 588
610 Ga0496103_0024971 3300048906 Bacteria 3608
611 Ga0496104_0021737 3300048907 Bacteria 5891
612 Ga0496104_0129139 3300048907 Bacteria 2427
613 Ga0496104_0601573 3300048907 Bacteria 1010
614 Ga0496104_0784763 3300048907 Bacteria 859
615 Ga0496104_1603132 3300048907 Bacteria 554
616 Ga0496105_0100448 3300048908 Bacteria 2389
617 Ga0496105_0855440 3300048908 Bacteria 688
618 Ga0496106_0087524 3300048909 Bacteria 2400
619 Ga0496107_0071434 3300048910 Bacteria 2522
620 Ga0496107_0183214 3300048910 Bacteria 1555
621 Ga0496108_0006205 3300048911 Bacteria 9679
622 Ga0496108_0804621 3300048911 Bacteria 811
623 Ga0496109_0081172 3300048912 Bacteria 2988
624 Ga0496109_1005306 3300048912 Bacteria 771
625 Ga0496109_1075497 3300048912 Unclassified 741
626 Ga0496111_0001392 3300048914 Bacteria 13733
627 Ga0496111_0495737 3300048914 Bacteria 899
628 Ga0496112_0018376 3300048915 Bacteria 6582
629 Ga0496112_0177507 3300048915 Bacteria 2094
630 Ga0496112_0212136 3300048915 Bacteria 1893
631 Ga0496112_0295532 3300048915 Bacteria 1566
632 Ga0496112_0361108 3300048915 Bacteria 1394
633 Ga0496113_0104443 3300048916 Bacteria 2199
634 Ga0496113_1240308 3300048916 Bacteria 581
635 Ga0496114_0002314 3300048917 Bacteria 14514
636 Ga0496114_0014347 3300048917 Bacteria 6355
637 Ga0496114_0063849 3300048917 Bacteria 3083
638 Ga0496114_0140685 3300048917 Bacteria 2089
639 Ga0496115_0117988 3300048918 Bacteria 2183
640 Ga0496115_0213967 3300048918 Unclassified 1592
641 Ga0496115_0403622 3300048918 Bacteria 1109
642 Ga0496115_1197057 3300048918 Bacteria 571
643 Ga0501031_0004724 3300049568 Bacteria 8837
644 Ga0501031_0015481 3300049568 Bacteria 4951
645 Ga0501031_0238501 3300049568 Bacteria 1182
646 Ga0501031_0919864 3300049568 Bacteria 560
647 Ga0501032_0006332 3300049569 Bacteria 8724
648 Ga0501032_0153932 3300049569 Bacteria 1511
649 Ga0501032_0748343 3300049569 Unclassified 618
650 Ga0501033_0018426 3300049570 Bacteria 5274
651 Ga0501033_0507940 3300049570 Bacteria 833
652 Ga0501034_0222585 3300049571 Bacteria 1839
653 Ga0501034_0734047 3300049571 Bacteria 884
654 Ga0501036_0000812 3300049572 Bacteria 23195
655 Ga0501036_0044936 3300049572 Bacteria 3742
656 Ga0501036_1487287 3300049572 Bacteria 548
657 Ga0501037_0016003 3300049573 Bacteria 5520
658 Ga0501037_0024768 3300049573 Bacteria 4437
659 Ga0501037_0026653 3300049573 Bacteria 4271
660 Ga0501038_0010256 3300049574 Bacteria 8572
661 Ga0501038_0064916 3300049574 Bacteria 3112
662 Ga0501038_0217559 3300049574 Bacteria 1526
663 Ga0501039_0002075 3300049575 Bacteria 14847
664 Ga0501039_0030116 3300049575 Bacteria 4183
665 Ga0501039_0574868 3300049575 Bacteria 884
666 Ga0501040_0003014 3300049576 Bacteria 10909
667 Ga0501040_0003628 3300049576 Bacteria 9996
668 Ga0501041_0003633 3300049577 Bacteria 8869
669 Ga0501041_0019700 3300049577 Bacteria 4030
670 Ga0501041_0174475 3300049577 Bacteria 1345
671 Ga0501042_0000147 3300049578 Bacteria 31455
672 Ga0501042_0002332 3300049578 Bacteria 11619
673 Ga0501042_0787412 3300049578 Bacteria 692
674 Ga0501043_0024081 3300049579 Bacteria 4777
675 Ga0501043_0025764 3300049579 Bacteria 4613
676 Ga0501043_0084805 3300049579 Bacteria 2490
677 Ga0501046_0005060 3300049580 Bacteria 11819
678 Ga0501046_0047284 3300049580 Bacteria 3411
679 Ga0501046_0169804 3300049580 Bacteria 1638
680 Ga0501046_0196604 3300049580 Bacteria 1502
681 Ga0501048_0001869 3300049582 Bacteria 15973
682 Ga0501048_0083770 3300049582 Bacteria 2248
683 Ga0501067_0291689 3300049583 Bacteria 908
684 Ga0501068_0151587 3300049584 Unclassified 1457
685 Ga0501069_0121458 3300049585 Bacteria 1492
686 Ga0501069_0140503 3300049585 Bacteria 1385
687 Ga0501069_0157931 3300049585 Bacteria 1305
688 Ga0501069_0432070 3300049585 Bacteria 781
689 Ga0501069_0849803 3300049585 Bacteria 554
690 Ga0501070_0007144 3300049586 Bacteria 9487
691 Ga0501070_0050332 3300049586 Bacteria 3459
692 Ga0501070_0074059 3300049586 Bacteria 2818
693 Ga0501070_0318170 3300049586 Bacteria 1266
694 Ga0501071_0000047 3300049587 Bacteria 42225
695 Ga0501071_0001462 3300049587 Bacteria 13701
696 Ga0501071_0400706 3300049587 Bacteria 1048
697 Ga0501071_0424026 3300049587 Bacteria 1017
698 Ga0501071_0956355 3300049587 Bacteria 661
699 Ga0501071_1370587 3300049587 Bacteria 546
700 Ga0501072_0008567 3300049588 Bacteria 7757
701 Ga0501072_0036825 3300049588 Bacteria 3836
702 Ga0501072_0332984 3300049588 Bacteria 1206
703 Ga0501072_0483022 3300049588 Bacteria 980
704 Ga0501072_0620579 3300049588 Bacteria 852
705 Ga0501073_0045489 3300049589 Bacteria 3091
706 Ga0501073_0534203 3300049589 Bacteria 810
707 Ga0501074_0002160 3300049590 Bacteria 13621
708 Ga0501074_0002330 3300049590 Bacteria 13214
709 Ga0501074_0021987 3300049590 Bacteria 4632
710 Ga0501074_0633774 3300049590 Bacteria 755
711 Ga0501075_0000079 3300049591 Bacteria 43500
712 Ga0501075_0056213 3300049591 Bacteria 2962
713 Ga0501076_0000958 3300049592 Bacteria 18864
714 Ga0501076_0031546 3300049592 Bacteria 4133
715 Ga0501076_0070405 3300049592 Bacteria 2796
716 Ga0501077_0004216 3300049593 Bacteria 8687
717 Ga0501077_0019882 3300049593 Bacteria 4248
718 Ga0501077_0189351 3300049593 Bacteria 1307
719 Ga0501079_0002715 3300049741 Bacteria 12895
720 Ga0501079_0169633 3300049741 Bacteria 1701
721 Ga0501079_0306324 3300049741 Bacteria 1243
722 Ga0501079_0525971 3300049741 Bacteria 930
723 Ga0501080_0011964 3300049742 Bacteria 7948
724 Ga0501080_1023407 3300049742 Bacteria 716
725 Ga0501081_0027861 3300049743 Bacteria 3809
726 Ga0501081_0080082 3300049743 Bacteria 2285
727 Ga0501081_0130558 3300049743 Bacteria 1795
728 Ga0501081_0493803 3300049743 Bacteria 912
729 Ga0501083_0035256 3300049744 Bacteria 3418
730 Ga0501265_096010 3300049762 Bacteria 536
731 Ga0501266_061137 3300049763 Bacteria 603
732 Ga0501271_061139 3300049768 Bacteria 529
733 Ga0501035_0013024 3300049822 Bacteria 7674
734 Ga0501035_0040510 3300049822 Bacteria 4209
735 Ga0501035_0081954 3300049822 Bacteria 2847
736 Ga0501035_0760572 3300049822 Bacteria 777
737 Ga0501044_0041057 3300049823 Bacteria 4816
738 Ga0501044_1291062 3300049823 Bacteria 597
739 Ga0501045_0022920 3300049824 Bacteria 4473
740 Ga0501045_0035370 3300049824 Bacteria 3626
741 Ga0501045_0501122 3300049824 Bacteria 902
742 Ga0501045_0826247 3300049824 Bacteria 682
743 Ga0501045_1182943 3300049824 Bacteria 558
744 nmdc:mga06z11_689971_c1 3300050494 Bacteria 622
745 nmdc:mga04h51_135070_c1 3300050495 Bacteria 931
746 nmdc:mga05p37_106441_c1 3300050507 Bacteria 3450
747 nmdc:mga05p37_14687_c1 3300050507 Bacteria 9407
748 nmdc:mga05p37_29833_c1 3300050507 Bacteria 6655
749 nmdc:mga05p37_704389_c1 3300050507 Bacteria 1121
750 nmdc:mga05p37_759123_c1 3300050507 Bacteria 1068
751 nmdc:mga05p37_86863_c2 3300050507 Bacteria 2119
752 nmdc:mga06r32_1094404_c1 3300050510 Unclassified 746
753 nmdc:mga06r32_274308_c1 3300050510 Bacteria 1674
754 nmdc:mga06r32_855413_c1 3300050510 Bacteria 868
755 nmdc:mga08y16_220876_c1 3300050511 Bacteria 1962
756 nmdc:mga08y16_611976_c1 3300050511 Bacteria 1097
757 nmdc:mga0n895_798438_c1 3300050512 Bacteria 934
758 nmdc:mga0rr50_1333085_c1 3300050513 Bacteria 608
759 nmdc:mga0rr50_155897_c1 3300050513 Bacteria 1850
760 nmdc:mga0rr50_264575_c1 3300050513 Bacteria 1432
761 nmdc:mga0rr50_714393_c1 3300050513 Bacteria 855
762 nmdc:mga08x19_6447_c1 3300050514 Bacteria 6950
763 nmdc:mga08x19_885176_c1 3300050514 Bacteria 634
764 nmdc:mga0a205_1027771_c1 3300050515 Bacteria 671
765 nmdc:mga0a205_43514_c1 3300050515 Bacteria 4330
766 nmdc:mga0a205_5282_c1 3300050515 Bacteria 11632
767 Ga0495601_0000451 3300053077 Bacteria 21517
768 Ga0495601_0035908 3300053077 Bacteria 3095
769 Ga0495601_0147141 3300053077 Bacteria 1538
770 Ga0495612_0155113 3300053078 Bacteria 998
771 Ga0495612_0524899 3300053078 Bacteria 544
772 Ga0495595_0030846 3300053084 Bacteria 2406
773 Ga0495595_0080306 3300053084 Bacteria 1552
774 Ga0495595_0441692 3300053084 Bacteria 661
775 Ga0495619_0160628 3300053085 Bacteria 1552
776 Ga0495619_0281701 3300053085 Bacteria 1152
777 Ga0501084_0007613 3300054114 Bacteria 8928
778 Ga0501084_0014656 3300054114 Bacteria 6499
779 Ga0501084_0666509 3300054114 Bacteria 878
780 Ga0501084_1030755 3300054114 Bacteria 691
781 Ga0590071_023617 3300059421 Bacteria 1455
782 Ga0590074_035309 3300059423 Bacteria 891
783 Ga0590075_024433 3300059424 Bacteria 1517
784 Ga0587114_051507 3300059655 Bacteria 698
785 Ga0587114_062636 3300059655 Bacteria 656
786 Ga0587114_063614 3300059655 Bacteria 653
787 Ga0501082_0008586 3300060353 Bacteria 8812
788 Ga0501082_0118548 3300060353 Bacteria 2293
789 Ga0501082_0550052 3300060353 Unclassified 1009
790 Ga0466962_0001910 3300061719 Bacteria 9803
791 Ga0466962_0251119 3300061719 Bacteria 869
792 Ga0466962_0298795 3300061719 Bacteria 796
793 Ga0530510_0002032 3300061734 Bacteria 13902
794 Ga0530510_0007097 3300061734 Bacteria 7797
795 Ga0530510_0030104 3300061734 Bacteria 3897
796 2616699007 2616644814 Bacteria 11555299
797 2795782429 2795385470 Bacteria 8317180
798 Ga0496107_0421984
799 JGI25406J46586_10001263
800 rootH2_10006169
801 rootL2_10041069
802 rootH1_10027198
803 Ga0007427J51700_109519
804 Ga0070658_10017583
805 Ga0070683_100013246
806 Ga0070683_100375877
807 Ga0070683_100705175
808 Ga0070683_100985451
809 Ga0068869_101011515
810 Ga0070680_100063278
811 Ga0070680_100132125
812 Ga0070682_100045721
813 Ga0068868_100129119
814 Ga0068868_100155436
815 Ga0070660_100044584
816 Ga0070660_100789106
817 Ga0070691_10195979
818 Ga0070661_100255804
819 Ga0070668_100506346
820 Ga0070668_101255012
821 Ga0070675_100165282
822 Ga0070674_100313926
823 Ga0070659_100336249
824 Ga0070714_100003734
825 Ga0070714_100055825
826 Ga0070714_100082557
827 Ga0070714_100140653
828 Ga0070714_100250950
829 Ga0070714_100402850
830 Ga0070714_100518757
831 Ga0070714_100642648
832 Ga0070714_101296095
833 Ga0070714_102143551
834 Ga0070714_102184503
835 Ga0070713_100113659
836 Ga0070713_100506482
837 Ga0070713_101086562
838 Ga0070710_10048385
839 Ga0070710_10116205
840 Ga0070710_11360357
841 Ga0070711_100022262
842 Ga0070711_101490501
843 Ga0070711_101860131
844 Ga0070700_100066551
845 Ga0070700_101506203
846 Ga0070694_100467226
847 Ga0070708_100010297
848 Ga0070663_100101967
849 Ga0070678_100055483
850 Ga0070681_10172375
851 Ga0070681_10552771
852 Ga0068867_101040855
853 Ga0068867_101809007
854 Ga0070706_100000038
855 Ga0070707_100901231
856 Ga0070707_101202545
857 Ga0070699_101426364
858 Ga0070679_100041942
859 Ga0070679_100140028
860 Ga0070684_100003352
861 Ga0070684_100502815
862 Ga0070684_101734784
863 Ga0070697_100015294
864 Ga0070697_100378885
865 Ga0070697_101592217
866 Ga0070672_102169589
867 Ga0070695_100118600
868 Ga0070695_100474583
869 Ga0070696_100241651
870 Ga0070693_100089845
871 Ga0070704_100258443
872 Ga0070704_100634884
873 Ga0068855_101903392
874 Ga0070664_100784656
875 Ga0070664_101001750
876 Ga0070664_101918820
877 Ga0068857_101696120
878 Ga0068854_100486918
879 Ga0068854_101880928
880 Ga0068856_100017061
881 Ga0068856_100035062
882 Ga0068856_100194421
883 Ga0068856_101731509
884 Ga0068852_100290518
885 Ga0068852_101399278
886 Ga0068859_101935074
887 Ga0068866_10244675
888 Ga0068861_100008993
889 Ga0068870_10066305
890 Ga0068870_11158466
891 Ga0068860_100229996
892 Ga0068862_100251249
893 Ga0081455_10022384
894 Ga0081455_10050705
895 Ga0081455_10074069
896 Ga0081538_10061172
897 Ga0081538_10103111
898 Ga0081538_10172110
899 Ga0081539_10000369
900 Ga0081539_10011388
901 Ga0070717_10006823
902 Ga0070717_10072447
903 Ga0070717_10282232
904 Ga0075365_10172637
905 Ga0075368_10094537
906 Ga0075363_100849818
907 Ga0075432_10009415
908 Ga0070715_10186187
909 Ga0070716_100475034
910 Ga0070716_100759739
911 Ga0070716_101042025
912 Ga0070712_100044941
913 Ga0070712_100361826
914 Ga0070712_100512183
915 Ga0070712_100634130
916 Ga0097621_100473646
917 Ga0068871_100652199
918 Ga0068871_101166646
919 Ga0075431_100753382
920 Ga0075431_100788510
921 Ga0075433_10003586
922 Ga0075433_10056467
923 Ga0075433_11841064
924 Ga0075434_100091860
925 Ga0075436_100006385
926 Ga0075436_100515069
927 Ga0075436_100979493
928 Ga0097620_101934276
929 Ga0075435_100002208
930 Ga0105240_10034366
931 Ga0105240_10126196
932 Ga0105240_10513658
933 Ga0105240_12045589
934 Ga0105240_12515721
935 Ga0111539_10007774
936 Ga0111539_10838796
937 Ga0111539_13436260
938 Ga0105245_10033318
939 Ga0105245_10147667
940 Ga0105245_10341429
941 Ga0105245_12536946
942 Ga0114129_10003258
943 Ga0114129_10022983
944 Ga0114129_10042773
945 Ga0114129_10089066
946 Ga0114129_10198037
947 Ga0114129_11425992
948 Ga0105243_10268733
949 Ga0105243_12668447
950 Ga0105241_10076162
951 Ga0105242_10178226
952 Ga0105242_10379590
953 Ga0105242_10503282
954 Ga0105242_11771625
955 Ga0105248_10441455
956 Ga0105238_10170075
957 Ga0105238_10612817
958 Ga0105238_11160752
959 Ga0105249_10004322
960 Ga0105249_10241944
961 Ga0105249_11545437
962 Ga0105249_12871418
963 Ga0105035_105785
964 Ga0105239_10114643
965 Ga0105239_10255417
966 Ga0105246_10121420
967 Ga0157338_1069510
968 Ga0157373_10107685
969 Ga0157373_10144905
970 Ga0157370_10041767
971 Ga0157369_10453376
972 Ga0157369_10583990
973 Ga0157369_10682895
974 Ga0157374_10072133
975 Ga0157374_10528438
976 Ga0157374_10644564
977 Ga0157374_10846268
978 Ga0157378_10187518
979 Ga0157378_10248398
980 Ga0163162_10061222
981 Ga0163162_10602345
982 Ga0157372_10224887
983 Ga0157372_10315805
984 Ga0157372_10709614
985 Ga0157372_12726129
986 Ga0163163_11104000
987 Ga0163163_12050608
988 Ga0157380_10819296
989 Ga0182008_10002753
990 Ga0182008_10094827
991 Ga0157377_10223701
992 Ga0157376_10789959
993 Ga0157376_12409677
994 Ga0182005_1220384
995 Ga0163161_10034532
996 Ga0163161_10069910
997 Ga0163161_10202511
998 Ga0163161_10959493
999 Ga0197907_10332727
1000 Ga0197907_10363442
1001 Ga0197907_10743962
1002 Ga0197907_11264428
1003 Ga0197907_11434933
1004 Ga0197907_11510751
1005 Ga0206356_10181818
1006 Ga0206356_10546293
1007 Ga0206356_10592005
1008 Ga0206356_10698070
1009 Ga0206349_1920437
1010 Ga0206355_1085196
1011 Ga0206355_1308480
1012 Ga0206351_10319915
1013 Ga0206351_10474388
1014 Ga0206352_10153780
1015 Ga0206352_11150846
1016 Ga0206350_10182264
1017 Ga0206350_10323725
1018 Ga0206350_10327635
1019 Ga0206350_10559710
1020 Ga0206350_10707709
1021 Ga0206354_10483478
1022 Ga0206354_10657736
1023 Ga0206354_11076545
1024 Ga0206354_11153462
1025 Ga0206353_10514252
1026 Ga0206353_10720181
1027 Ga0206353_10843001
1028 Ga0206353_11002661
1029 Ga0206353_11007032
1030 Ga0206353_11829862
1031 Ga0154015_1063933
1032 Ga0154015_1530244
1033 Ga0154015_1563210
1034 Ga0213873_10112564
1035 Ga0213876_10020324
1036 Ga0213876_10324209
1037 Ga0213876_10462812
1038 Ga0213871_10037010
1039 Ga0224712_10055564
1040 Ga0224712_10084999
1041 Ga0224712_10092383
1042 Ga0224712_10182936
1043 Ga0224712_10694745
1044 Ga0207692_10030852
1045 Ga0207692_10835417
1046 Ga0207692_10907766
1047 Ga0207642_10488112
1048 Ga0207642_10742001
1049 Ga0207688_10024249
1050 Ga0207685_10136424
1051 Ga0207645_10783587
1052 Ga0207643_10073542
1053 Ga0207643_10473607
1054 Ga0207705_10245209
1055 Ga0207705_10970350
1056 Ga0207654_10143223
1057 Ga0207654_10178672
1058 Ga0207707_10009751
1059 Ga0207707_10049009
1060 Ga0207707_10400128
1061 Ga0207707_10966335
1062 Ga0207695_10129279
1063 Ga0207695_10193261
1064 Ga0207693_10233463
1065 Ga0207693_10388323
1066 Ga0207693_11177333
1067 Ga0207693_11230232
1068 Ga0207663_10033597
1069 Ga0207663_10597694
1070 Ga0207660_10034396
1071 Ga0207660_10269902
1072 Ga0207657_10066364
1073 Ga0207657_10201426
1074 Ga0207657_10503961
1075 Ga0207649_10158542
1076 Ga0207649_10371279
1077 Ga0207652_10108673
1078 Ga0207646_10538050
1079 Ga0207646_11489378
1080 Ga0207694_10167563
1081 Ga0207694_10600219
1082 Ga0207694_11042800
1083 Ga0207659_10142642
1084 Ga0207659_10398422
1085 Ga0207687_10093469
1086 Ga0207687_10096370
1087 Ga0207687_10332931
1088 Ga0207687_10622081
1089 Ga0207700_10079146
1090 Ga0207700_10176035
1091 Ga0207700_11007881
1092 Ga0207700_11815318
1093 Ga0207664_10001110
1094 Ga0207664_10040220
1095 Ga0207664_10126186
1096 Ga0207664_10213640
1097 Ga0207664_10348533
1098 Ga0207664_10541593
1099 Ga0207664_10576313
1100 Ga0207664_11499032
1101 Ga0207664_11694125
1102 Ga0207690_10955466
1103 Ga0207690_11387720
1104 Ga0207690_11503512
1105 Ga0207686_10103405
1106 Ga0207686_11012088
1107 Ga0207686_11033387
1108 Ga0207709_10480028
1109 Ga0207669_10018377
1110 Ga0207669_10222109
1111 Ga0207704_10359120
1112 Ga0207704_10886307
1113 Ga0207665_10288678
1114 Ga0207665_10379502
1115 Ga0207691_10083210
1116 Ga0207661_10003499
1117 Ga0207661_10150833
1118 Ga0207661_10335228
1119 Ga0207661_10822273
1120 Ga0207679_10134046
1121 Ga0207679_10688582
1122 Ga0207667_10187100
1123 Ga0207667_10799711
1124 Ga0207667_11080450
1125 Ga0207667_11108592
1126 Ga0207712_10014920
1127 Ga0207712_10279047
1128 Ga0207668_10078430
1129 Ga0207640_10348348
1130 Ga0207640_10966753
1131 Ga0207677_10057299
1132 Ga0207703_10223388
1133 Ga0207678_10268487
1134 Ga0207678_10686147
1135 Ga0207708_10612013
1136 Ga0207708_11437801
1137 Ga0207702_10033017
1138 Ga0207702_10092917
1139 Ga0207702_10151992
1140 Ga0207702_10756343
1141 Ga0207648_10015239
1142 Ga0207648_10037269
1143 Ga0207648_10210834
1144 Ga0207675_100000145
1145 Ga0207675_101372708
1146 Ga0207683_10012399
1147 Ga0207683_10617308
1148 Ga0207683_11270055
1149 Ga0209813_10114621
1150 Ga0207428_10144022
1151 Ga0268264_10755473
1152 Ga0268264_12504684
1153 Ga0307515_10040196
1154 Ga0265332_10101410
1155 Ga0307513_10006849
1156 Ga0307408_100154950
1157 Ga0307408_102477567
1158 Ga0307514_10102858
1159 Ga0307516_10878469
1160 Ga0307405_10517716
1161 Ga0307413_10162282
1162 Ga0307413_10169573
1163 Ga0307518_10001217
1164 Ga0307410_10018121
1165 Ga0307410_10056893
1166 Ga0307406_10078773
1167 Ga0307407_10939744
1168 Ga0307407_11517429
1169 Ga0307412_10806629
1170 Ga0307409_100001368
1171 Ga0307409_100252141
1172 Ga0307409_100756745
1173 Ga0307409_100758814
1174 Ga0307409_100903762
1175 Ga0307416_100001194
1176 Ga0307416_100152679
1177 Ga0307416_100188729
1178 Ga0307416_100606586
1179 Ga0307416_101492580
1180 Ga0307414_10803716
1181 Ga0307411_10092491
1182 Ga0307411_10336472
1183 Ga0307411_10926068
1184 Ga0307415_100000800
1185 Ga0307415_100031999
1186 Ga0307415_100175968
1187 Ga0373944_0199230
1188 Ga0373945_0173179
1189 Ga0373943_0026521
1190 Ga0373943_0192210
1191 Ga0373955_0017789
1192 Ga0373955_0961612
1193 Ga0373947_0534586
1194 Ga0373947_0811535
1195 Ga0373937_0077207
1196 Ga0373937_0723860
1197 Ga0373925_0363799
1198 Ga0373925_0413038
1199 Ga0395899_0000690
1200 Ga0395899_0068077
1201 Ga0395900_0006008
1202 Ga0395900_0020460
1203 Ga0395900_0060217
1204 Ga0395900_0118162
1205 Ga0395900_0254429
1206 Ga0395900_0284682
1207 Ga0395900_0465477
1208 Ga0395900_0666622
1209 Ga0395900_1661557
1210 Ga0395898_0002283
1211 Ga0395898_0039754
1212 Ga0395898_0087916
1213 Ga0395898_0263849
1214 Ga0395898_0271233
1215 Ga0395898_0275440
1216 Ga0395898_0862553
1217 Ga0395898_0918425
1218 Ga0395905_0006791
1219 Ga0395905_0007518
1220 Ga0395905_0031972
1221 Ga0395905_0033401
1222 Ga0395905_0380713
1223 Ga0395905_0781309
1224 Ga0395905_1179691
1225 Ga0395905_1243414
1226 Ga0395905_1364623
1227 Ga0395905_1457621
1228 Ga0436364_0446177
1229 Ga0436364_1436221
1230 Ga0395901_0000684
1231 Ga0395901_0015726
1232 Ga0395901_0042498
1233 Ga0395901_0043740
1234 Ga0395901_0075215
1235 Ga0395901_0181245
1236 Ga0395901_0329988
1237 Ga0395901_0407474
1238 Ga0395901_0724209
1239 Ga0395901_0728053
1240 Ga0395901_0812718
1241 Ga0395901_0845094
1242 Ga0395901_1573775
1243 Ga0436365_0965370
1244 Ga0436365_1394435
1245 Ga0436365_1710482
1246 Ga0436360_0070468
1247 Ga0436363_0123979
1248 Ga0436363_0228062
1249 Ga0436363_0728344
1250 Ga0436363_0762749
1251 Ga0436363_1073212
1252 Ga0436363_1341439
1253 Ga0436362_0852653
1254 Ga0451797_0928882
1255 Ga0451804_0630778
1256 Ga0451807_0324428
1257 Ga0451807_2017991
1258 Ga0451837_0673922
1259 Ga0451853_3110468
1260 Ga0439448_0041978
1261 Ga0450907_025218
1262 Ga0450907_069073
1263 Ga0450910_033138
1264 Ga0439434_0109960
1265 Ga0439464_0126521
1266 Ga0450918_017770
1267 Ga0466969_0009309
1268 Ga0466972_0142500
1269 Ga0466972_0224583
1270 Ga0466972_0278295
1271 Ga0466966_0029102
1272 Ga0466966_0120821
1273 Ga0466966_0178062
1274 Ga0466961_0161797
1275 Ga0466961_0437014
1276 Ga0466961_0540369
1277 Ga0466963_0000276
1278 Ga0466963_0000438
1279 Ga0466963_0000673
1280 Ga0466963_0030594
1281 Ga0466963_0036673
1282 Ga0466963_1116729
1283 Ga0466964_0012342
1284 Ga0466964_0082817
1285 Ga0466964_0473385
1286 Ga0466971_0029827
1287 Ga0466971_0037646
1288 Ga0466971_0570020
1289 Ga0466968_0043267
1290 Ga0466968_0082917
1291 Ga0466968_0206837
1292 Ga0466968_0291259
1293 Ga0466970_0438429
1294 Ga0466970_0715616
1295 Ga0466957_0007688
1296 Ga0466957_0027851
1297 Ga0466957_0080515
1298 Ga0466957_0122257
1299 Ga0466960_0672286
1300 Ga0466959_0064655
1301 Ga0466959_0330900
1302 Ga0466959_0403891
1303 Ga0466959_1077613
1304 Ga0451576_1497396
1305 Ga0451576_1953328
1306 Ga0466958_0002935
1307 Ga0466958_0007963
1308 Ga0466958_0030937
1309 Ga0466958_0087483
1310 Ga0466958_0172170
1311 Ga0466958_0336860
1312 Ga0466958_0343516
1313 Ga0466958_0433703
1314 Ga0466958_0983381
1315 Ga0466967_0043133
1316 Ga0466967_0043772
1317 Ga0466967_0076649
1318 Ga0466967_0344547
1319 Ga0466967_0425213
1320 Ga0466967_0547251
1321 Ga0466967_0609988
1322 Ga0466967_0802437
1323 Ga0466967_1282723
1324 Ga0466967_1521816
1325 Ga0466967_1670366
1326 Ga0495617_006894
1327 Ga0495603_0324865
1328 Ga0495590_0110049
1329 Ga0495629_0115823
1330 Ga0495641_0299773
1331 Ga0495641_0351749
1332 Ga0495651_0126825
1333 Ga0495653_0267016
1334 Ga0495653_0694864
1335 Ga0495582_0342758
1336 Ga0495639_0693877
1337 Ga0495664_0707938
1338 Ga0495584_0574218
1339 Ga0495608_0006359
1340 Ga0495628_0415644
1341 Ga0495630_0572434
1342 Ga0495630_0985266
1343 Ga0495652_0128720
1344 Ga0495652_0147821
1345 Ga0495652_0154494
1346 Ga0495652_0466651
1347 Ga0495640_0062224
1348 Ga0495587_0024019
1349 Ga0495587_0229803
1350 Ga0495598_0128432
1351 Ga0495645_0067875
1352 Ga0495645_0618096
1353 Ga0495656_0347720
1354 Ga0495656_0600236
1355 Ga0495668_0102977
1356 Ga0495625_0353582
1357 Ga0495635_0181983
1358 Ga0495635_0932299
1359 Ga0495588_0637593
1360 Ga0495657_0042711
1361 Ga0495623_0043156
1362 Ga0495623_0169756
1363 Ga0495600_0228671
1364 Ga0495604_0000218
1365 Ga0495604_0017744
1366 Ga0495604_0166210
1367 Ga0495604_0284053
1368 Ga0495604_0297958
1369 Ga0495604_0349062
1370 Ga0495636_0009995
1371 Ga0495672_0054123
1372 Ga0495676_0268302
1373 Ga0495676_0599519
1374 Ga0495680_0016214
1375 Ga0495680_0029916
1376 Ga0495680_0181119
1377 Ga0495687_004253
1378 Ga0495675_0317373
1379 Ga0495685_054811
1380 Ga0495685_259261
1381 Ga0495681_0037200
1382 Ga0495684_0099715
1383 Ga0495686_0006203
1384 Ga0495593_0333188
1385 Ga0495602_0237459
1386 Ga0495602_0327822
1387 Ga0495602_0463825
1388 Ga0496100_0006193
1389 Ga0496100_0020253
1390 Ga0496100_0100388
1391 Ga0496100_0137830
1392 Ga0496100_0175884
1393 Ga0496100_0201780
1394 Ga0496101_0010181
1395 Ga0496101_0033594
1396 Ga0496101_0095023
1397 Ga0496101_0168140
1398 Ga0496101_0880524
1399 Ga0496102_0018165
1400 Ga0496102_0152265
1401 Ga0496102_0240692
1402 Ga0496102_0566989
1403 Ga0496102_0722053
1404 Ga0496102_1076746
1405 Ga0496102_1521830
1406 Ga0496103_0024971
1407 Ga0496104_0021737
1408 Ga0496104_0129139
1409 Ga0496104_0601573
1410 Ga0496104_0784763
1411 Ga0496104_1603132
1412 Ga0496105_0100448
1413 Ga0496105_0855440
1414 Ga0496106_0087524
1415 Ga0496107_0071434
1416 Ga0496107_0183214
1417 Ga0496108_0006205
1418 Ga0496108_0804621
1419 Ga0496109_0081172
1420 Ga0496109_1005306
1421 Ga0496109_1075497
1422 Ga0496111_0001392
1423 Ga0496111_0495737
1424 Ga0496112_0018376
1425 Ga0496112_0177507
1426 Ga0496112_0212136
1427 Ga0496112_0295532
1428 Ga0496112_0361108
1429 Ga0496113_0104443
1430 Ga0496113_1240308
1431 Ga0496114_0002314
1432 Ga0496114_0014347
1433 Ga0496114_0063849
1434 Ga0496114_0140685
1435 Ga0496115_0117988
1436 Ga0496115_0213967
1437 Ga0496115_0403622
1438 Ga0496115_1197057
1439 Ga0501031_0004724
1440 Ga0501031_0015481
1441 Ga0501031_0238501
1442 Ga0501031_0919864
1443 Ga0501032_0006332
1444 Ga0501032_0153932
1445 Ga0501032_0748343
1446 Ga0501033_0018426
1447 Ga0501033_0507940
1448 Ga0501034_0222585
1449 Ga0501034_0734047
1450 Ga0501036_0000812
1451 Ga0501036_0044936
1452 Ga0501036_1487287
1453 Ga0501037_0016003
1454 Ga0501037_0024768
1455 Ga0501037_0026653
1456 Ga0501038_0010256
1457 Ga0501038_0064916
1458 Ga0501038_0217559
1459 Ga0501039_0002075
1460 Ga0501039_0030116
1461 Ga0501039_0574868
1462 Ga0501040_0003014
1463 Ga0501040_0003628
1464 Ga0501041_0003633
1465 Ga0501041_0019700
1466 Ga0501041_0174475
1467 Ga0501042_0000147
1468 Ga0501042_0002332
1469 Ga0501042_0787412
1470 Ga0501043_0024081
1471 Ga0501043_0025764
1472 Ga0501043_0084805
1473 Ga0501046_0005060
1474 Ga0501046_0047284
1475 Ga0501046_0169804
1476 Ga0501046_0196604
1477 Ga0501048_0001869
1478 Ga0501048_0083770
1479 Ga0501067_0291689
1480 Ga0501068_0151587
1481 Ga0501069_0121458
1482 Ga0501069_0140503
1483 Ga0501069_0157931
1484 Ga0501069_0432070
1485 Ga0501069_0849803
1486 Ga0501070_0007144
1487 Ga0501070_0050332
1488 Ga0501070_0074059
1489 Ga0501070_0318170
1490 Ga0501071_0000047
1491 Ga0501071_0001462
1492 Ga0501071_0400706
1493 Ga0501071_0424026
1494 Ga0501071_0956355
1495 Ga0501071_1370587
1496 Ga0501072_0008567
1497 Ga0501072_0036825
1498 Ga0501072_0332984
1499 Ga0501072_0483022
1500 Ga0501072_0620579
1501 Ga0501073_0045489
1502 Ga0501073_0534203
1503 Ga0501074_0002160
1504 Ga0501074_0002330
1505 Ga0501074_0021987
1506 Ga0501074_0633774
1507 Ga0501075_0000079
1508 Ga0501075_0056213
1509 Ga0501076_0000958
1510 Ga0501076_0031546
1511 Ga0501076_0070405
1512 Ga0501077_0004216
1513 Ga0501077_0019882
1514 Ga0501077_0189351
1515 Ga0501079_0002715
1516 Ga0501079_0169633
1517 Ga0501079_0306324
1518 Ga0501079_0525971
1519 Ga0501080_0011964
1520 Ga0501080_1023407
1521 Ga0501081_0027861
1522 Ga0501081_0080082
1523 Ga0501081_0130558
1524 Ga0501081_0493803
1525 Ga0501083_0035256
1526 Ga0501265_096010
1527 Ga0501266_061137
1528 Ga0501271_061139
1529 Ga0501035_0013024
1530 Ga0501035_0040510
1531 Ga0501035_0081954
1532 Ga0501035_0760572
1533 Ga0501044_0041057
1534 Ga0501044_1291062
1535 Ga0501045_0022920
1536 Ga0501045_0035370
1537 Ga0501045_0501122
1538 Ga0501045_0826247
1539 Ga0501045_1182943
1540 nmdc:mga06z11_689971_c1
1541 nmdc:mga04h51_135070_c1
1542 nmdc:mga05p37_106441_c1
1543 nmdc:mga05p37_14687_c1
1544 nmdc:mga05p37_29833_c1
1545 nmdc:mga05p37_704389_c1
1546 nmdc:mga05p37_759123_c1
1547 nmdc:mga05p37_86863_c2
1548 nmdc:mga06r32_1094404_c1
1549 nmdc:mga06r32_274308_c1
1550 nmdc:mga06r32_855413_c1
1551 nmdc:mga08y16_220876_c1
1552 nmdc:mga08y16_611976_c1
1553 nmdc:mga0n895_798438_c1
1554 nmdc:mga0rr50_1333085_c1
1555 nmdc:mga0rr50_155897_c1
1556 nmdc:mga0rr50_264575_c1
1557 nmdc:mga0rr50_714393_c1
1558 nmdc:mga08x19_6447_c1
1559 nmdc:mga08x19_885176_c1
1560 nmdc:mga0a205_1027771_c1
1561 nmdc:mga0a205_43514_c1
1562 nmdc:mga0a205_5282_c1
1563 Ga0495601_0000451
1564 Ga0495601_0035908
1565 Ga0495601_0147141
1566 Ga0495612_0155113
1567 Ga0495612_0524899
1568 Ga0495595_0030846
1569 Ga0495595_0080306
1570 Ga0495595_0441692
1571 Ga0495619_0160628
1572 Ga0495619_0281701
1573 Ga0501084_0007613
1574 Ga0501084_0014656
1575 Ga0501084_0666509
1576 Ga0501084_1030755
1577 Ga0590071_023617
1578 Ga0590074_035309
1579 Ga0590075_024433
1580 Ga0587114_051507
1581 Ga0587114_062636
1582 Ga0587114_063614
1583 Ga0501082_0008586
1584 Ga0501082_0118548
1585 Ga0501082_0550052
1586 Ga0466962_0001910
1587 Ga0466962_0251119
1588 Ga0466962_0298795
1589 Ga0530510_0002032
1590 Ga0530510_0007097
1591 Ga0530510_0030104
1592 2616699007
1593 2795782429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u4v-assembly1.cif.gz_A structure of a nitrate/nitrite antiporter nark in apo inward-open state 0.9496 12 41
1orl-assembly1.cif.gz_A 1h nmr structure determination of viscotoxin c1 0.9473 15 37
3mbj-assembly1.cif.gz_A crystal structure of a putative phosphomethylpyrimidine kinase (bt_4458) from bacteroides thetaiotaomicron vpi-5482 at 2.10 a resolution (rhombohedral form) 0.8824 12 54
5zwb-assembly1.cif.gz_A crystal structure of pyridoxal kinase (pdxk) from salmonella typhimurium in complex with adp, pl-linked to lys233 via a schiff base 0.8568 6 50
5zwa-assembly1.cif.gz_B crystal structure of pyridoxal kinase (pdxk) from salmonella typhimurium in complex with adp, pl-linked to lys233 via schiff base in protomer a and the product (plp) in protomer b 0.7827 6 49
ID Description Score Start End Superfamily
2v9bB00 Alpha Beta;2-Layer Sandwich;Crambin;Thionin-like 0.986 14 37 3.30.1350.10
af_Q2FWD7_13_140_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9621 66 98 2.40.50.140
af_C0H498_14_269_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.9536 12 41 1.50.40.10
1orlA00 Alpha Beta;2-Layer Sandwich;Crambin;Thionin-like 0.9473 15 37 3.30.1350.10
af_Q04013_4_135_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.9425 12 42 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A812WSN6-F1-model_v4 DnaJ protein 0.9531 12 49
AF-A0A1Q3T468-F1-model_v4 Plasmid stabilization protein 0.9434 3 55
AF-A0A2T4V204-F1-model_v4 Plasmid stabilization protein 0.9407 1 55
AF-R6UT83-F1-model_v4 deleted 0.9384 10 46
AF-A7HF89-F1-model_v4 Plasmid stabilization protein 0.9358 1 55

Map