F481200
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 796 | 398 | 796 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300042115|Ga0450911_015214|Ga0450911_015214_384_893 |
| Length | 169 |
| Sequence | MKRPVDGRERIDGKGVSAMRFMIIVKASKDSEAGVMPSEKLLAEMGKFNEELSNAGILLAGEGLHASSKGARVKFSGSTRTVIDGPFAETKELIAGFWLWKVTSKEEAIEWVKRCPNPHNEDSEIEIRQVFEAEDFGAEFTPELREQEDRVRAQAAKTASDRSASRDRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 112 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 130 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 210 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 211 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 212 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 213 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 214 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 244 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 245 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 246 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 247 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 248 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 249 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 250 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 251 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 256 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 257 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 258 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 259 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 260 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 261 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 262 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 307 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 308 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 309 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 310 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 311 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 312 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 313 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 314 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 315 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 316 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 341 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 342 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 343 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 344 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 347 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 348 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 349 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 350 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 351 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 352 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 353 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 354 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 355 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 356 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 357 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 358 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 359 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 360 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 365 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 366 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 367 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 368 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 369 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 370 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 371 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 372 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 373 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 374 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 378 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 379 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 383 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 384 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 398 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.26 |
| Nodule | 0 |
| Rhizoplane | 1.51 |
| Rhizosphere | 94.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARCol0yngRDRAFT_1011104 | 3300000652 | Bacteria | 661 |
| 2 | JGI24748J21848_1000012 | 3300002074 | Bacteria | 152599 |
| 3 | JGI24034J26672_10000003 | 3300002239 | Bacteria | 501747 |
| 4 | JGI24742J22300_10011251 | 3300002244 | Bacteria | 1484 |
| 5 | JGI25406J46586_10048926 | 3300003203 | Bacteria | 1430 |
| 6 | rootL2_10010204 | 3300003322 | Unclassified | 1705 |
| 7 | JGI25405J52794_10036267 | 3300003911 | Bacteria | 1034 |
| 8 | Ga0065704_10411573 | 3300005289 | Bacteria | 741 |
| 9 | Ga0065712_10008628 | 3300005290 | Bacteria | 4096 |
| 10 | Ga0065715_10125661 | 3300005293 | Bacteria | 2125 |
| 11 | Ga0065715_10244344 | 3300005293 | Bacteria | 1188 |
| 12 | Ga0065715_10571324 | 3300005293 | Bacteria | 727 |
| 13 | Ga0065707_10259690 | 3300005295 | Bacteria | 1099 |
| 14 | Ga0070658_10262617 | 3300005327 | Bacteria | 1466 |
| 15 | Ga0070676_10004156 | 3300005328 | Bacteria | 7603 |
| 16 | Ga0070676_10029047 | 3300005328 | Bacteria | 3143 |
| 17 | Ga0070676_10613533 | 3300005328 | Bacteria | 786 |
| 18 | Ga0070676_10681638 | 3300005328 | Bacteria | 749 |
| 19 | Ga0070683_100100763 | 3300005329 | Bacteria | 2719 |
| 20 | Ga0070683_100523770 | 3300005329 | Bacteria | 1133 |
| 21 | Ga0070690_100000599 | 3300005330 | Bacteria | 18205 |
| 22 | Ga0070690_100161692 | 3300005330 | Bacteria | 1535 |
| 23 | Ga0070690_100285694 | 3300005330 | Bacteria | 1178 |
| 24 | Ga0070670_100088623 | 3300005331 | Bacteria | 2660 |
| 25 | Ga0070670_100248534 | 3300005331 | Bacteria | 1549 |
| 26 | Ga0070670_100795342 | 3300005331 | Bacteria | 854 |
| 27 | Ga0070670_101467059 | 3300005331 | Bacteria | 626 |
| 28 | Ga0068869_100050795 | 3300005334 | Bacteria | 3006 |
| 29 | Ga0068869_100069062 | 3300005334 | Unclassified | 2611 |
| 30 | Ga0068869_100150934 | 3300005334 | Bacteria | 1802 |
| 31 | Ga0068869_100172318 | 3300005334 | Bacteria | 1691 |
| 32 | Ga0068869_100614009 | 3300005334 | Bacteria | 920 |
| 33 | Ga0070666_10067559 | 3300005335 | Bacteria | 2427 |
| 34 | Ga0070680_100012677 | 3300005336 | Bacteria | 6552 |
| 35 | Ga0070680_101458106 | 3300005336 | Bacteria | 593 |
| 36 | Ga0070682_100073346 | 3300005337 | Bacteria | 2195 |
| 37 | Ga0070682_100198196 | 3300005337 | Bacteria | 1414 |
| 38 | Ga0070682_101133175 | 3300005337 | Bacteria | 657 |
| 39 | Ga0068868_100176479 | 3300005338 | Bacteria | 1771 |
| 40 | Ga0068868_100616430 | 3300005338 | Unclassified | 963 |
| 41 | Ga0068868_100705181 | 3300005338 | Bacteria | 903 |
| 42 | Ga0070689_100036501 | 3300005340 | Bacteria | 3759 |
| 43 | Ga0070691_10187153 | 3300005341 | Bacteria | 1081 |
| 44 | Ga0070687_100001696 | 3300005343 | Bacteria | 7909 |
| 45 | Ga0070687_100830263 | 3300005343 | Bacteria | 657 |
| 46 | Ga0070661_100314878 | 3300005344 | Bacteria | 1221 |
| 47 | Ga0070661_100416365 | 3300005344 | Bacteria | 1064 |
| 48 | Ga0070692_10261449 | 3300005345 | Bacteria | 1041 |
| 49 | Ga0070692_10408232 | 3300005345 | Bacteria | 859 |
| 50 | Ga0070668_100065443 | 3300005347 | Bacteria | 2820 |
| 51 | Ga0070668_100769900 | 3300005347 | Bacteria | 853 |
| 52 | Ga0070669_100198254 | 3300005353 | Bacteria | 1578 |
| 53 | Ga0070675_100094928 | 3300005354 | Bacteria | 2503 |
| 54 | Ga0070675_100206245 | 3300005354 | Bacteria | 1707 |
| 55 | Ga0070675_100516493 | 3300005354 | Bacteria | 1077 |
| 56 | Ga0070675_100953101 | 3300005354 | Bacteria | 787 |
| 57 | Ga0070671_100136728 | 3300005355 | Bacteria | 2066 |
| 58 | Ga0070671_100549325 | 3300005355 | Bacteria | 996 |
| 59 | Ga0070671_100654473 | 3300005355 | Bacteria | 910 |
| 60 | Ga0070674_100292029 | 3300005356 | Bacteria | 1296 |
| 61 | Ga0070673_100004650 | 3300005364 | Bacteria | 8709 |
| 62 | Ga0070673_100037834 | 3300005364 | Bacteria | 3680 |
| 63 | Ga0070673_100046048 | 3300005364 | Unclassified | 3386 |
| 64 | Ga0070673_100130869 | 3300005364 | Bacteria | 2105 |
| 65 | Ga0070673_100474562 | 3300005364 | Bacteria | 1128 |
| 66 | Ga0070688_100004390 | 3300005365 | Bacteria | 7332 |
| 67 | Ga0070688_100033351 | 3300005365 | Bacteria | 3112 |
| 68 | Ga0070688_100712628 | 3300005365 | Bacteria | 778 |
| 69 | Ga0070667_100464141 | 3300005367 | Bacteria | 1158 |
| 70 | Ga0070667_100491684 | 3300005367 | Bacteria | 1124 |
| 71 | Ga0070667_100651284 | 3300005367 | Bacteria | 973 |
| 72 | Ga0070703_10239648 | 3300005406 | Bacteria | 731 |
| 73 | Ga0070714_101134731 | 3300005435 | Bacteria | 762 |
| 74 | Ga0070713_100258326 | 3300005436 | Bacteria | 1591 |
| 75 | Ga0070701_10052198 | 3300005438 | Bacteria | 2123 |
| 76 | Ga0070701_10719014 | 3300005438 | Bacteria | 674 |
| 77 | Ga0070701_10806121 | 3300005438 | Bacteria | 641 |
| 78 | Ga0070701_11172320 | 3300005438 | Bacteria | 544 |
| 79 | Ga0070711_100543300 | 3300005439 | Bacteria | 963 |
| 80 | Ga0070705_100157023 | 3300005440 | Bacteria | 1516 |
| 81 | Ga0070705_100164723 | 3300005440 | Bacteria | 1486 |
| 82 | Ga0070705_100213782 | 3300005440 | Bacteria | 1331 |
| 83 | Ga0070705_100227464 | 3300005440 | Bacteria | 1295 |
| 84 | Ga0070700_100000112 | 3300005441 | Bacteria | 52067 |
| 85 | Ga0070700_100007644 | 3300005441 | Bacteria | 5848 |
| 86 | Ga0070700_100062776 | 3300005441 | Bacteria | 2348 |
| 87 | Ga0070700_100411028 | 3300005441 | Bacteria | 1020 |
| 88 | Ga0070700_101688730 | 3300005441 | Bacteria | 543 |
| 89 | Ga0070694_100005880 | 3300005444 | Bacteria | 7440 |
| 90 | Ga0070694_100094648 | 3300005444 | Bacteria | 2102 |
| 91 | Ga0070694_100271900 | 3300005444 | Bacteria | 1289 |
| 92 | Ga0070694_100434248 | 3300005444 | Bacteria | 1034 |
| 93 | Ga0070694_101051226 | 3300005444 | Bacteria | 677 |
| 94 | Ga0070708_100247272 | 3300005445 | Bacteria | 1675 |
| 95 | Ga0070708_101041012 | 3300005445 | Bacteria | 767 |
| 96 | Ga0070662_100157604 | 3300005457 | Bacteria | 1773 |
| 97 | Ga0070681_11105579 | 3300005458 | Bacteria | 713 |
| 98 | Ga0068867_101090848 | 3300005459 | Bacteria | 728 |
| 99 | Ga0070685_10038440 | 3300005466 | Bacteria | 2714 |
| 100 | Ga0070685_10136387 | 3300005466 | Bacteria | 1540 |
| 101 | Ga0070685_10202802 | 3300005466 | Bacteria | 1290 |
| 102 | Ga0070706_100235927 | 3300005467 | Bacteria | 1708 |
| 103 | Ga0070707_100010371 | 3300005468 | Bacteria | 8677 |
| 104 | Ga0070698_100208912 | 3300005471 | Bacteria | 1887 |
| 105 | Ga0070698_100271035 | 3300005471 | Bacteria | 1629 |
| 106 | Ga0070699_100369492 | 3300005518 | Bacteria | 1294 |
| 107 | Ga0070699_100520006 | 3300005518 | Bacteria | 1082 |
| 108 | Ga0070699_101306913 | 3300005518 | Bacteria | 665 |
| 109 | Ga0070697_100125632 | 3300005536 | Bacteria | 2149 |
| 110 | Ga0070697_100399680 | 3300005536 | Bacteria | 1192 |
| 111 | Ga0068853_100235387 | 3300005539 | Bacteria | 1676 |
| 112 | Ga0068853_101284617 | 3300005539 | Bacteria | 707 |
| 113 | Ga0070672_100024691 | 3300005543 | Bacteria | 4446 |
| 114 | Ga0070672_100038522 | 3300005543 | Bacteria | 3654 |
| 115 | Ga0070672_100044427 | 3300005543 | Bacteria | 3431 |
| 116 | Ga0070672_101477149 | 3300005543 | Bacteria | 609 |
| 117 | Ga0070686_100002331 | 3300005544 | Bacteria | 10472 |
| 118 | Ga0070686_100014523 | 3300005544 | Bacteria | 4543 |
| 119 | Ga0070686_100170927 | 3300005544 | Bacteria | 1537 |
| 120 | Ga0070695_100221271 | 3300005545 | Bacteria | 1364 |
| 121 | Ga0070704_100021936 | 3300005549 | Bacteria | 4148 |
| 122 | Ga0070704_101245344 | 3300005549 | Bacteria | 680 |
| 123 | Ga0068855_101108493 | 3300005563 | Bacteria | 827 |
| 124 | Ga0070664_100038990 | 3300005564 | Bacteria | 4001 |
| 125 | Ga0070664_100093410 | 3300005564 | Unclassified | 2607 |
| 126 | Ga0070664_100137888 | 3300005564 | Bacteria | 2146 |
| 127 | Ga0068857_100455849 | 3300005577 | Bacteria | 1196 |
| 128 | Ga0068854_100233892 | 3300005578 | Bacteria | 1460 |
| 129 | Ga0070702_100009329 | 3300005615 | Bacteria | 4799 |
| 130 | Ga0070702_100772034 | 3300005615 | Bacteria | 740 |
| 131 | Ga0068852_100943138 | 3300005616 | Bacteria | 881 |
| 132 | Ga0068859_100028447 | 3300005617 | Bacteria | 5603 |
| 133 | Ga0068859_100088053 | 3300005617 | Bacteria | 3154 |
| 134 | Ga0068859_100172050 | 3300005617 | Bacteria | 2247 |
| 135 | Ga0068859_100242086 | 3300005617 | Bacteria | 1893 |
| 136 | Ga0068859_100548247 | 3300005617 | Bacteria | 1251 |
| 137 | Ga0068864_100390915 | 3300005618 | Bacteria | 1320 |
| 138 | Ga0068864_100571716 | 3300005618 | Bacteria | 1094 |
| 139 | Ga0068864_101906595 | 3300005618 | Bacteria | 600 |
| 140 | Ga0068866_10238249 | 3300005718 | Bacteria | 1107 |
| 141 | Ga0068861_100522719 | 3300005719 | Bacteria | 1076 |
| 142 | Ga0068861_100657520 | 3300005719 | Bacteria | 969 |
| 143 | Ga0068861_101269620 | 3300005719 | Bacteria | 715 |
| 144 | Ga0068851_10112572 | 3300005834 | Bacteria | 1454 |
| 145 | Ga0068870_10007646 | 3300005840 | Bacteria | 4832 |
| 146 | Ga0068870_10115763 | 3300005840 | Unclassified | 1537 |
| 147 | Ga0068863_100045685 | 3300005841 | Bacteria | 4156 |
| 148 | Ga0068863_100047258 | 3300005841 | Bacteria | 4083 |
| 149 | Ga0068863_100388678 | 3300005841 | Bacteria | 1363 |
| 150 | Ga0068863_100470856 | 3300005841 | Bacteria | 1235 |
| 151 | Ga0068863_100673630 | 3300005841 | Bacteria | 1027 |
| 152 | Ga0068858_100000468 | 3300005842 | Bacteria | 42170 |
| 153 | Ga0068858_100709379 | 3300005842 | Bacteria | 979 |
| 154 | Ga0068860_100123788 | 3300005843 | Bacteria | 2478 |
| 155 | Ga0068860_100283909 | 3300005843 | Bacteria | 1618 |
| 156 | Ga0068862_100262870 | 3300005844 | Bacteria | 1576 |
| 157 | Ga0068862_100367579 | 3300005844 | Bacteria | 1338 |
| 158 | Ga0081455_10001030 | 3300005937 | Bacteria | 35155 |
| 159 | Ga0081455_10353898 | 3300005937 | Bacteria | 1035 |
| 160 | Ga0081540_1036911 | 3300005983 | Bacteria | 2598 |
| 161 | Ga0081539_10002450 | 3300005985 | Bacteria | 26176 |
| 162 | Ga0075364_10180947 | 3300006051 | Bacteria | 1426 |
| 163 | Ga0070716_100172065 | 3300006173 | Bacteria | 1414 |
| 164 | Ga0070716_100802108 | 3300006173 | Bacteria | 729 |
| 165 | Ga0070712_100842937 | 3300006175 | Bacteria | 788 |
| 166 | Ga0075362_10009812 | 3300006177 | Bacteria | 3715 |
| 167 | Ga0075366_10868011 | 3300006195 | Bacteria | 562 |
| 168 | Ga0097621_100009441 | 3300006237 | Bacteria | 7080 |
| 169 | Ga0097621_100009709 | 3300006237 | Bacteria | 7000 |
| 170 | Ga0097621_100011882 | 3300006237 | Bacteria | 6438 |
| 171 | Ga0097621_100046664 | 3300006237 | Bacteria | 3506 |
| 172 | Ga0075370_10019829 | 3300006353 | Bacteria | 3665 |
| 173 | Ga0068871_100008898 | 3300006358 | Bacteria | 7243 |
| 174 | Ga0068871_100021047 | 3300006358 | Bacteria | 5006 |
| 175 | Ga0068871_100051771 | 3300006358 | Bacteria | 3324 |
| 176 | Ga0068871_100159179 | 3300006358 | Bacteria | 1930 |
| 177 | Ga0068871_100450349 | 3300006358 | Bacteria | 1154 |
| 178 | Ga0068871_100740174 | 3300006358 | Bacteria | 903 |
| 179 | Ga0075428_100003681 | 3300006844 | Bacteria | 16819 |
| 180 | Ga0075428_100015897 | 3300006844 | Bacteria | 8327 |
| 181 | Ga0075428_100035723 | 3300006844 | Bacteria | 5477 |
| 182 | Ga0075428_100531066 | 3300006844 | Bacteria | 1258 |
| 183 | Ga0075428_100610036 | 3300006844 | Bacteria | 1165 |
| 184 | Ga0075428_100926858 | 3300006844 | Bacteria | 923 |
| 185 | Ga0075428_102268729 | 3300006844 | Bacteria | 559 |
| 186 | Ga0075430_100000131 | 3300006846 | Bacteria | 47675 |
| 187 | Ga0075430_100054073 | 3300006846 | Bacteria | 3378 |
| 188 | Ga0075430_100169372 | 3300006846 | Bacteria | 1817 |
| 189 | Ga0075430_100307069 | 3300006846 | Bacteria | 1312 |
| 190 | Ga0075430_101184670 | 3300006846 | Bacteria | 629 |
| 191 | Ga0075431_100000085 | 3300006847 | Bacteria | 56381 |
| 192 | Ga0075431_100032939 | 3300006847 | Bacteria | 5340 |
| 193 | Ga0075431_100056816 | 3300006847 | Bacteria | 4036 |
| 194 | Ga0075431_101606546 | 3300006847 | Bacteria | 608 |
| 195 | Ga0075433_10000073 | 3300006852 | Bacteria | 45023 |
| 196 | Ga0075433_10040245 | 3300006852 | Bacteria | 4045 |
| 197 | Ga0075433_10168638 | 3300006852 | Bacteria | 1948 |
| 198 | Ga0075433_10250034 | 3300006852 | Bacteria | 1573 |
| 199 | Ga0075433_10350541 | 3300006852 | Bacteria | 1304 |
| 200 | Ga0075433_10677621 | 3300006852 | Bacteria | 904 |
| 201 | Ga0075433_11265334 | 3300006852 | Bacteria | 640 |
| 202 | Ga0075433_11464042 | 3300006852 | Bacteria | 590 |
| 203 | Ga0075434_100001311 | 3300006871 | Bacteria | 20762 |
| 204 | Ga0075434_100022086 | 3300006871 | Bacteria | 6196 |
| 205 | Ga0075434_100036222 | 3300006871 | Bacteria | 4881 |
| 206 | Ga0075434_100037538 | 3300006871 | Bacteria | 4797 |
| 207 | Ga0075434_100132287 | 3300006871 | Bacteria | 2514 |
| 208 | Ga0075434_101385548 | 3300006871 | Bacteria | 713 |
| 209 | Ga0075429_100000215 | 3300006880 | Bacteria | 38905 |
| 210 | Ga0075429_100018873 | 3300006880 | Bacteria | 5975 |
| 211 | Ga0075429_100236193 | 3300006880 | Bacteria | 1601 |
| 212 | Ga0075429_100461334 | 3300006880 | Unclassified | 1113 |
| 213 | Ga0068865_100001852 | 3300006881 | Bacteria | 12411 |
| 214 | Ga0068865_100168591 | 3300006881 | Bacteria | 1676 |
| 215 | Ga0068865_101928325 | 3300006881 | Bacteria | 535 |
| 216 | Ga0075436_100000132 | 3300006914 | Bacteria | 44395 |
| 217 | Ga0075436_100000482 | 3300006914 | Bacteria | 25785 |
| 218 | Ga0075436_100066008 | 3300006914 | Bacteria | 2501 |
| 219 | Ga0075436_100071991 | 3300006914 | Bacteria | 2391 |
| 220 | Ga0075436_100349046 | 3300006914 | Bacteria | 1066 |
| 221 | Ga0075436_100576912 | 3300006914 | Bacteria | 827 |
| 222 | Ga0097620_100028446 | 3300006931 | Bacteria | 5603 |
| 223 | Ga0097620_100088055 | 3300006931 | Bacteria | 3154 |
| 224 | Ga0097620_100172052 | 3300006931 | Bacteria | 2247 |
| 225 | Ga0097620_100242081 | 3300006931 | Bacteria | 1893 |
| 226 | Ga0097620_100362429 | 3300006931 | Bacteria | 1545 |
| 227 | Ga0097620_100548231 | 3300006931 | Bacteria | 1251 |
| 228 | Ga0075435_100005423 | 3300007076 | Bacteria | 8900 |
| 229 | Ga0075435_100028232 | 3300007076 | Bacteria | 4399 |
| 230 | Ga0075435_100031014 | 3300007076 | Bacteria | 4208 |
| 231 | Ga0075435_100140957 | 3300007076 | Bacteria | 2023 |
| 232 | Ga0075435_100344822 | 3300007076 | Bacteria | 1276 |
| 233 | Ga0099794_10003354 | 3300007265 | Bacteria | 6097 |
| 234 | Ga0099794_10014781 | 3300007265 | Bacteria | 3429 |
| 235 | Ga0099794_10088314 | 3300007265 | Bacteria | 1536 |
| 236 | Ga0099795_10127966 | 3300007788 | Bacteria | 1022 |
| 237 | Ga0105250_10339842 | 3300009092 | Bacteria | 656 |
| 238 | Ga0105240_10000385 | 3300009093 | Bacteria | 82999 |
| 239 | Ga0105240_10026018 | 3300009093 | Bacteria | 7685 |
| 240 | Ga0111539_10011892 | 3300009094 | Bacteria | 10909 |
| 241 | Ga0111539_10064158 | 3300009094 | Bacteria | 4347 |
| 242 | Ga0111539_10068352 | 3300009094 | Bacteria | 4194 |
| 243 | Ga0111539_10119907 | 3300009094 | Bacteria | 3082 |
| 244 | Ga0111539_10178155 | 3300009094 | Unclassified | 2483 |
| 245 | Ga0111539_10479040 | 3300009094 | Bacteria | 1449 |
| 246 | Ga0111539_10737266 | 3300009094 | Bacteria | 1147 |
| 247 | Ga0105245_11987963 | 3300009098 | Unclassified | 635 |
| 248 | Ga0105247_10000003 | 3300009101 | Bacteria | 694517 |
| 249 | Ga0105247_10048944 | 3300009101 | Bacteria | 2597 |
| 250 | Ga0114129_10003362 | 3300009147 | Bacteria | 22463 |
| 251 | Ga0114129_10028415 | 3300009147 | Bacteria | 7925 |
| 252 | Ga0114129_10098553 | 3300009147 | Bacteria | 4046 |
| 253 | Ga0114129_10111427 | 3300009147 | Bacteria | 3776 |
| 254 | Ga0114129_10206282 | 3300009147 | Bacteria | 2659 |
| 255 | Ga0114129_10984119 | 3300009147 | Bacteria | 1063 |
| 256 | Ga0114129_11582188 | 3300009147 | Bacteria | 803 |
| 257 | Ga0105243_10159225 | 3300009148 | Bacteria | 1945 |
| 258 | Ga0105243_10165569 | 3300009148 | Bacteria | 1910 |
| 259 | Ga0105243_10556173 | 3300009148 | Bacteria | 1097 |
| 260 | Ga0105243_12018515 | 3300009148 | Bacteria | 611 |
| 261 | Ga0105242_10025570 | 3300009176 | Bacteria | 4673 |
| 262 | Ga0105242_10410676 | 3300009176 | Bacteria | 1266 |
| 263 | Ga0105248_10053278 | 3300009177 | Bacteria | 4540 |
| 264 | Ga0105248_10145718 | 3300009177 | Bacteria | 2672 |
| 265 | Ga0105248_11121712 | 3300009177 | Bacteria | 889 |
| 266 | Ga0105237_10226768 | 3300009545 | Bacteria | 1869 |
| 267 | Ga0105237_10518637 | 3300009545 | Bacteria | 1198 |
| 268 | Ga0105237_10754845 | 3300009545 | Bacteria | 979 |
| 269 | Ga0105238_10008147 | 3300009551 | Bacteria | 10483 |
| 270 | Ga0105238_10017429 | 3300009551 | Bacteria | 7299 |
| 271 | Ga0105238_11051604 | 3300009551 | Archaea | 836 |
| 272 | Ga0105249_11278569 | 3300009553 | Bacteria | 805 |
| 273 | Ga0105249_12054164 | 3300009553 | Bacteria | 644 |
| 274 | Ga0105249_12474405 | 3300009553 | Bacteria | 592 |
| 275 | Ga0105239_10000030 | 3300010375 | Bacteria | 233669 |
| 276 | Ga0105239_10008453 | 3300010375 | Bacteria | 11707 |
| 277 | Ga0105239_10095990 | 3300010375 | Bacteria | 3275 |
| 278 | Ga0105239_10721307 | 3300010375 | Bacteria | 1140 |
| 279 | Ga0105246_11998978 | 3300011119 | Bacteria | 559 |
| 280 | Ga0157344_1001832 | 3300012476 | Bacteria | 1064 |
| 281 | Ga0157328_1015418 | 3300012478 | Bacteria | 590 |
| 282 | Ga0157370_10077553 | 3300013104 | Bacteria | 3130 |
| 283 | Ga0157369_10066030 | 3300013105 | Bacteria | 3893 |
| 284 | Ga0157378_10469783 | 3300013297 | Bacteria | 1251 |
| 285 | Ga0157378_10484642 | 3300013297 | Bacteria | 1233 |
| 286 | Ga0157378_10552527 | 3300013297 | Bacteria | 1157 |
| 287 | Ga0157378_11351462 | 3300013297 | Bacteria | 754 |
| 288 | Ga0157378_11580371 | 3300013297 | Bacteria | 701 |
| 289 | Ga0157378_12007373 | 3300013297 | Bacteria | 628 |
| 290 | Ga0163162_10234026 | 3300013306 | Bacteria | 1968 |
| 291 | Ga0163162_10333896 | 3300013306 | Bacteria | 1648 |
| 292 | Ga0163162_11181335 | 3300013306 | Bacteria | 868 |
| 293 | Ga0163162_11847120 | 3300013306 | Bacteria | 691 |
| 294 | Ga0163162_12210336 | 3300013306 | Bacteria | 632 |
| 295 | Ga0157372_10398176 | 3300013307 | Bacteria | 1605 |
| 296 | Ga0157375_10118672 | 3300013308 | Bacteria | 2752 |
| 297 | Ga0157375_11063210 | 3300013308 | Bacteria | 946 |
| 298 | Ga0157375_11737657 | 3300013308 | Bacteria | 739 |
| 299 | Ga0163163_10040967 | 3300014325 | Bacteria | 4527 |
| 300 | Ga0163163_10141088 | 3300014325 | Unclassified | 2452 |
| 301 | Ga0157380_10143149 | 3300014326 | Bacteria | 2057 |
| 302 | Ga0157380_10291923 | 3300014326 | Bacteria | 1498 |
| 303 | Ga0182008_10045440 | 3300014497 | Bacteria | 2184 |
| 304 | Ga0157377_10000545 | 3300014745 | Bacteria | 15900 |
| 305 | Ga0157379_10186631 | 3300014968 | Bacteria | 1874 |
| 306 | Ga0157379_10426844 | 3300014968 | Bacteria | 1221 |
| 307 | Ga0157379_10441806 | 3300014968 | Bacteria | 1200 |
| 308 | Ga0157379_11668085 | 3300014968 | Bacteria | 624 |
| 309 | Ga0157376_10043024 | 3300014969 | Bacteria | 3705 |
| 310 | Ga0157376_10053523 | 3300014969 | Bacteria | 3361 |
| 311 | Ga0157376_10156196 | 3300014969 | Bacteria | 2063 |
| 312 | Ga0182006_1039209 | 3300015261 | Bacteria | 1870 |
| 313 | Ga0182007_10073972 | 3300015262 | Bacteria | 1116 |
| 314 | Ga0163161_10133898 | 3300017792 | Bacteria | 1872 |
| 315 | Ga0163161_10264877 | 3300017792 | Bacteria | 1343 |
| 316 | Ga0206350_11406164 | 3300020080 | Bacteria | 1665 |
| 317 | Ga0213874_10028766 | 3300021377 | Bacteria | 1590 |
| 318 | Ga0213876_10100276 | 3300021384 | Bacteria | 1535 |
| 319 | Ga0213876_10401907 | 3300021384 | Bacteria | 729 |
| 320 | Ga0224712_10667778 | 3300022467 | Bacteria | 510 |
| 321 | Ga0207672_1000256 | 3300025223 | Bacteria | 7312 |
| 322 | Ga0207697_10022285 | 3300025315 | Bacteria | 2594 |
| 323 | Ga0207697_10321863 | 3300025315 | Bacteria | 686 |
| 324 | Ga0207656_10257223 | 3300025321 | Bacteria | 857 |
| 325 | Ga0207653_10262401 | 3300025885 | Bacteria | 664 |
| 326 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 327 | Ga0207710_10043834 | 3300025900 | Bacteria | 1991 |
| 328 | Ga0207680_10584585 | 3300025903 | Bacteria | 798 |
| 329 | Ga0207647_10000659 | 3300025904 | Bacteria | 26975 |
| 330 | Ga0207685_10490033 | 3300025905 | Bacteria | 645 |
| 331 | Ga0207645_10022359 | 3300025907 | Bacteria | 4115 |
| 332 | Ga0207643_10000709 | 3300025908 | Bacteria | 20649 |
| 333 | Ga0207643_10186158 | 3300025908 | Unclassified | 1258 |
| 334 | Ga0207643_10661231 | 3300025908 | Bacteria | 674 |
| 335 | Ga0207705_10299994 | 3300025909 | Bacteria | 1232 |
| 336 | Ga0207684_10297680 | 3300025910 | Bacteria | 1391 |
| 337 | Ga0207684_10620840 | 3300025910 | Bacteria | 922 |
| 338 | Ga0207684_10666297 | 3300025910 | Bacteria | 886 |
| 339 | Ga0207654_10140489 | 3300025911 | Bacteria | 1539 |
| 340 | Ga0207695_10000517 | 3300025913 | Bacteria | 81791 |
| 341 | Ga0207693_10406411 | 3300025915 | Bacteria | 1064 |
| 342 | Ga0207660_10043580 | 3300025917 | Bacteria | 3153 |
| 343 | Ga0207660_10107510 | 3300025917 | Bacteria | 2094 |
| 344 | Ga0207662_10000618 | 3300025918 | Bacteria | 15923 |
| 345 | Ga0207662_10501362 | 3300025918 | Bacteria | 836 |
| 346 | Ga0207662_11152092 | 3300025918 | Bacteria | 551 |
| 347 | Ga0207657_10003367 | 3300025919 | Bacteria | 17087 |
| 348 | Ga0207649_10303221 | 3300025920 | Bacteria | 1168 |
| 349 | Ga0207649_11201540 | 3300025920 | Bacteria | 599 |
| 350 | Ga0207646_10011251 | 3300025922 | Bacteria | 8691 |
| 351 | Ga0207681_10540432 | 3300025923 | Bacteria | 958 |
| 352 | Ga0207681_10713388 | 3300025923 | Bacteria | 834 |
| 353 | Ga0207681_11053772 | 3300025923 | Bacteria | 683 |
| 354 | Ga0207694_10036729 | 3300025924 | Unclassified | 3760 |
| 355 | Ga0207694_10050803 | 3300025924 | Unclassified | 3213 |
| 356 | Ga0207650_10430138 | 3300025925 | Bacteria | 1096 |
| 357 | Ga0207650_10441236 | 3300025925 | Bacteria | 1082 |
| 358 | Ga0207659_10148066 | 3300025926 | Bacteria | 1830 |
| 359 | Ga0207659_10163481 | 3300025926 | Bacteria | 1750 |
| 360 | Ga0207659_10323415 | 3300025926 | Bacteria | 1273 |
| 361 | Ga0207659_11063573 | 3300025926 | Bacteria | 696 |
| 362 | Ga0207700_10183763 | 3300025928 | Bacteria | 1752 |
| 363 | Ga0207700_10275842 | 3300025928 | Bacteria | 1445 |
| 364 | Ga0207664_11530517 | 3300025929 | Bacteria | 589 |
| 365 | Ga0207644_10000637 | 3300025931 | Bacteria | 22247 |
| 366 | Ga0207644_10548962 | 3300025931 | Bacteria | 956 |
| 367 | Ga0207706_10062103 | 3300025933 | Bacteria | 3291 |
| 368 | Ga0207706_10135051 | 3300025933 | Unclassified | 2170 |
| 369 | Ga0207706_10772357 | 3300025933 | Bacteria | 818 |
| 370 | Ga0207686_10006896 | 3300025934 | Bacteria | 6115 |
| 371 | Ga0207686_10692363 | 3300025934 | Bacteria | 810 |
| 372 | Ga0207670_10016562 | 3300025936 | Bacteria | 4433 |
| 373 | Ga0207670_10609679 | 3300025936 | Bacteria | 897 |
| 374 | Ga0207704_10187589 | 3300025938 | Bacteria | 1501 |
| 375 | Ga0207704_10637502 | 3300025938 | Bacteria | 876 |
| 376 | Ga0207704_11711013 | 3300025938 | Bacteria | 541 |
| 377 | Ga0207665_10084973 | 3300025939 | Bacteria | 2184 |
| 378 | Ga0207665_10315165 | 3300025939 | Bacteria | 1172 |
| 379 | Ga0207691_10006466 | 3300025940 | Bacteria | 11319 |
| 380 | Ga0207691_10007979 | 3300025940 | Bacteria | 10185 |
| 381 | Ga0207691_10154703 | 3300025940 | Bacteria | 2014 |
| 382 | Ga0207691_10184427 | 3300025940 | Bacteria | 1822 |
| 383 | Ga0207691_11008885 | 3300025940 | Bacteria | 694 |
| 384 | Ga0207711_10134380 | 3300025941 | Bacteria | 2220 |
| 385 | Ga0207711_10271360 | 3300025941 | Bacteria | 1561 |
| 386 | Ga0207711_10642241 | 3300025941 | Bacteria | 990 |
| 387 | Ga0207689_10010960 | 3300025942 | Bacteria | 7793 |
| 388 | Ga0207689_10086940 | 3300025942 | Bacteria | 2569 |
| 389 | Ga0207689_10114386 | 3300025942 | Bacteria | 2218 |
| 390 | Ga0207689_10404098 | 3300025942 | Bacteria | 1139 |
| 391 | Ga0207689_11034679 | 3300025942 | Unclassified | 693 |
| 392 | Ga0207661_10373243 | 3300025944 | Bacteria | 1290 |
| 393 | Ga0207679_10017660 | 3300025945 | Bacteria | 4763 |
| 394 | Ga0207679_10182419 | 3300025945 | Unclassified | 1738 |
| 395 | Ga0207679_10311507 | 3300025945 | Bacteria | 1360 |
| 396 | Ga0207667_11178314 | 3300025949 | Bacteria | 747 |
| 397 | Ga0207651_10015836 | 3300025960 | Unclassified | 4396 |
| 398 | Ga0207651_10072954 | 3300025960 | Bacteria | 2439 |
| 399 | Ga0207651_10166169 | 3300025960 | Bacteria | 1735 |
| 400 | Ga0207651_10228337 | 3300025960 | Bacteria | 1509 |
| 401 | Ga0207651_10731968 | 3300025960 | Bacteria | 873 |
| 402 | Ga0207712_10245038 | 3300025961 | Bacteria | 1446 |
| 403 | Ga0207712_12026801 | 3300025961 | Bacteria | 515 |
| 404 | Ga0207668_10148459 | 3300025972 | Bacteria | 1812 |
| 405 | Ga0207668_10238480 | 3300025972 | Bacteria | 1470 |
| 406 | Ga0207668_10681356 | 3300025972 | Bacteria | 902 |
| 407 | Ga0207640_10130985 | 3300025981 | Bacteria | 1813 |
| 408 | Ga0207640_11146419 | 3300025981 | Bacteria | 689 |
| 409 | Ga0207640_11369742 | 3300025981 | Bacteria | 633 |
| 410 | Ga0207658_10217921 | 3300025986 | Bacteria | 1604 |
| 411 | Ga0207658_10256401 | 3300025986 | Bacteria | 1489 |
| 412 | Ga0207658_11024477 | 3300025986 | Bacteria | 753 |
| 413 | Ga0207677_10065248 | 3300026023 | Bacteria | 2539 |
| 414 | Ga0207677_10465291 | 3300026023 | Unclassified | 1086 |
| 415 | Ga0207677_10670875 | 3300026023 | Bacteria | 917 |
| 416 | Ga0207703_10000080 | 3300026035 | Bacteria | 111786 |
| 417 | Ga0207703_10445249 | 3300026035 | Bacteria | 1209 |
| 418 | Ga0207703_10990836 | 3300026035 | Bacteria | 806 |
| 419 | Ga0207703_11173880 | 3300026035 | Unclassified | 738 |
| 420 | Ga0207639_10505175 | 3300026041 | Bacteria | 1105 |
| 421 | Ga0207678_10763403 | 3300026067 | Bacteria | 853 |
| 422 | Ga0207708_10000059 | 3300026075 | Bacteria | 94590 |
| 423 | Ga0207708_10071285 | 3300026075 | Bacteria | 2662 |
| 424 | Ga0207708_10218025 | 3300026075 | Unclassified | 1528 |
| 425 | Ga0207708_10259927 | 3300026075 | Bacteria | 1401 |
| 426 | Ga0207708_11064364 | 3300026075 | Bacteria | 704 |
| 427 | Ga0207708_11718095 | 3300026075 | Bacteria | 551 |
| 428 | Ga0207708_11826332 | 3300026075 | Bacteria | 533 |
| 429 | Ga0207702_10192989 | 3300026078 | Bacteria | 1883 |
| 430 | Ga0207702_10838689 | 3300026078 | Bacteria | 909 |
| 431 | Ga0207641_10012236 | 3300026088 | Bacteria | 7042 |
| 432 | Ga0207641_10291046 | 3300026088 | Bacteria | 1539 |
| 433 | Ga0207641_10728586 | 3300026088 | Bacteria | 978 |
| 434 | Ga0207641_10785997 | 3300026088 | Bacteria | 941 |
| 435 | Ga0207641_10973959 | 3300026088 | Bacteria | 844 |
| 436 | Ga0207641_11124798 | 3300026088 | Bacteria | 784 |
| 437 | Ga0207648_10014351 | 3300026089 | Bacteria | 7323 |
| 438 | Ga0207676_10780748 | 3300026095 | Bacteria | 931 |
| 439 | Ga0207674_10459959 | 3300026116 | Bacteria | 1230 |
| 440 | Ga0207674_11068435 | 3300026116 | Bacteria | 776 |
| 441 | Ga0207675_100017050 | 3300026118 | Bacteria | 6787 |
| 442 | Ga0207675_100056084 | 3300026118 | Bacteria | 3676 |
| 443 | Ga0207675_100414116 | 3300026118 | Bacteria | 1330 |
| 444 | Ga0207675_100700063 | 3300026118 | Bacteria | 1022 |
| 445 | Ga0207675_101519770 | 3300026118 | Bacteria | 690 |
| 446 | Ga0207683_10007997 | 3300026121 | Bacteria | 9045 |
| 447 | Ga0209588_1004073 | 3300027671 | Bacteria | 4094 |
| 448 | Ga0209588_1098073 | 3300027671 | Bacteria | 943 |
| 449 | Ga0209588_1126662 | 3300027671 | Bacteria | 816 |
| 450 | Ga0209966_1063471 | 3300027695 | Bacteria | 801 |
| 451 | Ga0209974_10042165 | 3300027876 | Bacteria | 1520 |
| 452 | Ga0207428_10000954 | 3300027907 | Bacteria | 32134 |
| 453 | Ga0207428_10043428 | 3300027907 | Bacteria | 3630 |
| 454 | Ga0207428_10100472 | 3300027907 | Bacteria | 2236 |
| 455 | Ga0207428_10146497 | 3300027907 | Unclassified | 1799 |
| 456 | Ga0207428_10901134 | 3300027907 | Bacteria | 625 |
| 457 | Ga0207428_11193921 | 3300027907 | Bacteria | 529 |
| 458 | Ga0268266_10162486 | 3300028379 | Bacteria | 2022 |
| 459 | Ga0268266_10646821 | 3300028379 | Bacteria | 1017 |
| 460 | Ga0268265_10116552 | 3300028380 | Bacteria | 2192 |
| 461 | Ga0268265_10383638 | 3300028380 | Bacteria | 1293 |
| 462 | Ga0268265_11051904 | 3300028380 | Bacteria | 806 |
| 463 | Ga0268265_11633133 | 3300028380 | Bacteria | 650 |
| 464 | Ga0268264_10741028 | 3300028381 | Bacteria | 978 |
| 465 | Ga0268264_11297280 | 3300028381 | Bacteria | 738 |
| 466 | Ga0265334_10052383 | 3300028573 | Bacteria | 1562 |
| 467 | Ga0265338_10008740 | 3300028800 | Bacteria | 12245 |
| 468 | Ga0307513_10219268 | 3300031456 | Bacteria | 1725 |
| 469 | Ga0307408_100178391 | 3300031548 | Bacteria | 1701 |
| 470 | Ga0307514_10121942 | 3300031649 | Bacteria | 1816 |
| 471 | Ga0307405_10023672 | 3300031731 | Bacteria | 3494 |
| 472 | Ga0307413_10495922 | 3300031824 | Bacteria | 979 |
| 473 | Ga0307410_10299908 | 3300031852 | Bacteria | 1268 |
| 474 | Ga0307410_10460347 | 3300031852 | Bacteria | 1039 |
| 475 | Ga0307407_10008386 | 3300031903 | Bacteria | 4738 |
| 476 | Ga0307412_10019557 | 3300031911 | Bacteria | 4104 |
| 477 | Ga0307409_101432426 | 3300031995 | Bacteria | 717 |
| 478 | Ga0307416_103181633 | 3300032002 | Bacteria | 549 |
| 479 | Ga0307414_10137183 | 3300032004 | Bacteria | 1909 |
| 480 | Ga0307411_10570407 | 3300032005 | Bacteria | 968 |
| 481 | Ga0307411_10899827 | 3300032005 | Bacteria | 786 |
| 482 | Ga0307415_100006252 | 3300032126 | Bacteria | 6397 |
| 483 | Ga0307415_100414649 | 3300032126 | Bacteria | 1154 |
| 484 | Ga0373930_0022643 | 3300034816 | Bacteria | 1244 |
| 485 | Ga0373948_0040297 | 3300034817 | Bacteria | 975 |
| 486 | Ga0373959_0009330 | 3300034820 | Bacteria | 1690 |
| 487 | Ga0373938_0116778 | 3300034957 | Bacteria | 684 |
| 488 | Ga0373938_0174696 | 3300034957 | Bacteria | 583 |
| 489 | Ga0373926_0000409 | 3300035083 | Bacteria | 11064 |
| 490 | Ga0373926_0029548 | 3300035083 | Bacteria | 1927 |
| 491 | Ga0373928_0025030 | 3300035084 | Bacteria | 1284 |
| 492 | Ga0373940_0003892 | 3300035088 | Bacteria | 3102 |
| 493 | Ga0373944_0003780 | 3300035089 | Bacteria | 3916 |
| 494 | Ga0373949_0010419 | 3300035090 | Bacteria | 2038 |
| 495 | Ga0373951_0074772 | 3300035091 | Bacteria | 868 |
| 496 | Ga0373952_0035245 | 3300035092 | Bacteria | 1132 |
| 497 | Ga0373952_0041229 | 3300035092 | Bacteria | 1067 |
| 498 | Ga0373923_0168097 | 3300035111 | Bacteria | 1003 |
| 499 | Ga0373932_0354921 | 3300035112 | Bacteria | 558 |
| 500 | Ga0373936_0004563 | 3300035113 | Bacteria | 5242 |
| 501 | Ga0373941_0318024 | 3300035115 | Bacteria | 625 |
| 502 | Ga0373945_0046583 | 3300035116 | Bacteria | 1582 |
| 503 | Ga0373956_0102621 | 3300035119 | Bacteria | 1328 |
| 504 | Ga0373960_0271586 | 3300035121 | Bacteria | 622 |
| 505 | Ga0373943_0022012 | 3300035170 | Bacteria | 2948 |
| 506 | Ga0373946_0012659 | 3300035171 | Bacteria | 3161 |
| 507 | Ga0373961_0101130 | 3300035241 | Bacteria | 933 |
| 508 | Ga0373961_0205366 | 3300035241 | Bacteria | 697 |
| 509 | Ga0373924_0143933 | 3300035410 | Bacteria | 1041 |
| 510 | Ga0373931_0002147 | 3300035691 | Bacteria | 8682 |
| 511 | Ga0373931_0016493 | 3300035691 | Bacteria | 3637 |
| 512 | Ga0373935_0005086 | 3300035692 | Bacteria | 7748 |
| 513 | Ga0373935_0350572 | 3300035692 | Bacteria | 1052 |
| 514 | Ga0373927_0010646 | 3300035695 | Bacteria | 6126 |
| 515 | Ga0373927_0024715 | 3300035695 | Bacteria | 3925 |
| 516 | Ga0373933_0208133 | 3300035724 | Bacteria | 1253 |
| 517 | Ga0373947_0012273 | 3300035725 | Bacteria | 4908 |
| 518 | Ga0373947_0030283 | 3300035725 | Bacteria | 3179 |
| 519 | Ga0373937_0150728 | 3300036401 | Bacteria | 2178 |
| 520 | Ga0373925_0058011 | 3300037068 | Bacteria | 2901 |
| 521 | Ga0395905_0638387 | 3300037471 | Bacteria | 967 |
| 522 | Ga0436364_0248608 | 3300037853 | Bacteria | 640 |
| 523 | Ga0436365_0094627 | 3300039437 | Bacteria | 2408 |
| 524 | Ga0436365_1620852 | 3300039437 | Bacteria | 869 |
| 525 | Ga0436363_0937612 | 3300039450 | Bacteria | 2944 |
| 526 | Ga0439465_0382718 | 3300041413 | Bacteria | 534 |
| 527 | Ga0451843_1540712 | 3300041509 | Bacteria | 936 |
| 528 | Ga0439432_021174 | 3300042006 | Bacteria | 2158 |
| 529 | Ga0439452_006463 | 3300042010 | Bacteria | 3671 |
| 530 | Ga0439454_010449 | 3300042011 | Bacteria | 1224 |
| 531 | Ga0450911_015214 | 3300042115 | Bacteria | 1020 |
| 532 | Ga0450889_012441 | 3300042144 | Bacteria | 893 |
| 533 | Ga0439446_0032242 | 3300042156 | Bacteria | 1519 |
| 534 | Ga0439458_0064658 | 3300042157 | Bacteria | 917 |
| 535 | Ga0450909_012257 | 3300042185 | Bacteria | 1257 |
| 536 | Ga0439434_0275109 | 3300042435 | Bacteria | 579 |
| 537 | Ga0466969_0081471 | 3300044656 | Bacteria | 1544 |
| 538 | Ga0466972_0000439 | 3300044658 | Bacteria | 21493 |
| 539 | Ga0466972_0097969 | 3300044658 | Bacteria | 1388 |
| 540 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 541 | Ga0453683_0000529 | 3300044673 | Bacteria | 42755 |
| 542 | Ga0453683_0001459 | 3300044673 | Bacteria | 20360 |
| 543 | Ga0466965_0056202 | 3300044683 | Bacteria | 1959 |
| 544 | Ga0466966_0014322 | 3300044684 | Bacteria | 5251 |
| 545 | Ga0466964_0001996 | 3300044706 | Bacteria | 7168 |
| 546 | Ga0466971_0082385 | 3300044719 | Bacteria | 1468 |
| 547 | Ga0466968_0008146 | 3300044735 | Bacteria | 4007 |
| 548 | Ga0466970_0000154 | 3300044765 | Bacteria | 32382 |
| 549 | Ga0466970_0097259 | 3300044765 | Bacteria | 1601 |
| 550 | Ga0466957_0912838 | 3300044842 | Bacteria | 628 |
| 551 | Ga0466960_0076798 | 3300044901 | Bacteria | 1673 |
| 552 | Ga0451576_0061086 | 3300045051 | Bacteria | 3930 |
| 553 | Ga0451576_0183851 | 3300045051 | Bacteria | 2182 |
| 554 | Ga0451576_0500950 | 3300045051 | Bacteria | 1276 |
| 555 | Ga0451576_1332183 | 3300045051 | Bacteria | 748 |
| 556 | Ga0451576_1861100 | 3300045051 | Bacteria | 621 |
| 557 | Ga0466958_0395935 | 3300045836 | Bacteria | 891 |
| 558 | Ga0495603_0000212 | 3300046455 | Bacteria | 30148 |
| 559 | Ga0495653_0000588 | 3300046463 | Bacteria | 27983 |
| 560 | Ga0495580_0000358 | 3300046472 | Bacteria | 37269 |
| 561 | Ga0495582_0031458 | 3300046473 | Bacteria | 2916 |
| 562 | Ga0495582_0046513 | 3300046473 | Bacteria | 2390 |
| 563 | Ga0495582_0399202 | 3300046473 | Bacteria | 793 |
| 564 | Ga0495639_0072613 | 3300046475 | Bacteria | 1591 |
| 565 | Ga0495620_0060550 | 3300046515 | Bacteria | 1578 |
| 566 | Ga0495630_0242434 | 3300046517 | Bacteria | 1377 |
| 567 | Ga0495630_0243415 | 3300046517 | Bacteria | 1374 |
| 568 | Ga0495666_0010152 | 3300046526 | Bacteria | 4697 |
| 569 | Ga0495666_0018234 | 3300046526 | Bacteria | 3496 |
| 570 | Ga0495666_0300631 | 3300046526 | Bacteria | 726 |
| 571 | Ga0495642_0495215 | 3300046528 | Bacteria | 541 |
| 572 | Ga0495665_0049976 | 3300046531 | Bacteria | 2217 |
| 573 | Ga0495586_0002478 | 3300046535 | Bacteria | 10009 |
| 574 | Ga0495621_0047467 | 3300046539 | Bacteria | 1527 |
| 575 | Ga0495588_0012162 | 3300046674 | Bacteria | 4058 |
| 576 | Ga0495588_0302815 | 3300046674 | Bacteria | 841 |
| 577 | Ga0495647_0000536 | 3300046681 | Bacteria | 11135 |
| 578 | Ga0495658_0005003 | 3300046683 | Bacteria | 6508 |
| 579 | Ga0495658_0264285 | 3300046683 | Bacteria | 1083 |
| 580 | Ga0495613_0020098 | 3300046689 | Bacteria | 4975 |
| 581 | Ga0495624_0152777 | 3300046690 | Bacteria | 1412 |
| 582 | Ga0495600_0003535 | 3300046809 | Bacteria | 9196 |
| 583 | Ga0495581_0081192 | 3300047315 | Bacteria | 1877 |
| 584 | Ga0495676_0046462 | 3300047321 | Bacteria | 3523 |
| 585 | Ga0495680_0002141 | 3300047322 | Bacteria | 20498 |
| 586 | Ga0495602_0002433 | 3300048088 | Bacteria | 18962 |
| 587 | Ga0495614_0058177 | 3300048089 | Bacteria | 1660 |
| 588 | Ga0496101_1091632 | 3300048904 | Bacteria | 627 |
| 589 | Ga0496102_0292523 | 3300048905 | Bacteria | 1535 |
| 590 | Ga0496102_0309418 | 3300048905 | Bacteria | 1489 |
| 591 | Ga0496102_0345836 | 3300048905 | Bacteria | 1400 |
| 592 | Ga0496102_1089018 | 3300048905 | Bacteria | 719 |
| 593 | Ga0496103_0103565 | 3300048906 | Bacteria | 1803 |
| 594 | Ga0496104_0110081 | 3300048907 | Bacteria | 2640 |
| 595 | Ga0496105_0011527 | 3300048908 | Bacteria | 6988 |
| 596 | Ga0496110_0266317 | 3300048913 | Bacteria | 1560 |
| 597 | Ga0496112_0104709 | 3300048915 | Bacteria | 2799 |
| 598 | Ga0496113_0101144 | 3300048916 | Bacteria | 2234 |
| 599 | Ga0496115_0370511 | 3300048918 | Bacteria | 1166 |
| 600 | Ga0496116_0030962 | 3300048919 | Bacteria | 3838 |
| 601 | Ga0496117_0002926 | 3300048920 | Bacteria | 20663 |
| 602 | Ga0496118_0005709 | 3300048921 | Bacteria | 14011 |
| 603 | Ga0496119_0000058 | 3300048922 | Bacteria | 173131 |
| 604 | Ga0496120_0000184 | 3300048923 | Bacteria | 106643 |
| 605 | Ga0496124_0088357 | 3300048927 | Bacteria | 2533 |
| 606 | Ga0496124_0968336 | 3300048927 | Bacteria | 510 |
| 607 | Ga0496125_0145529 | 3300048928 | Bacteria | 1639 |
| 608 | Ga0501290_000013 | 3300049513 | Bacteria | 26331 |
| 609 | Ga0501291_000266 | 3300049514 | Bacteria | 6458 |
| 610 | Ga0501293_001210 | 3300049516 | Bacteria | 1940 |
| 611 | Ga0501294_000272 | 3300049517 | Bacteria | 6349 |
| 612 | Ga0501295_000355 | 3300049518 | Bacteria | 4318 |
| 613 | Ga0501296_000249 | 3300049519 | Bacteria | 5586 |
| 614 | Ga0501297_000119 | 3300049520 | Bacteria | 8363 |
| 615 | Ga0501298_000404 | 3300049521 | Bacteria | 5862 |
| 616 | Ga0501298_049205 | 3300049521 | Bacteria | 871 |
| 617 | Ga0501299_002574 | 3300049522 | Bacteria | 2523 |
| 618 | Ga0501301_000072 | 3300049524 | Bacteria | 4635 |
| 619 | Ga0501303_000190 | 3300049526 | Bacteria | 5239 |
| 620 | Ga0501031_0002145 | 3300049568 | Bacteria | 12440 |
| 621 | Ga0501031_0060887 | 3300049568 | Bacteria | 2460 |
| 622 | Ga0501032_0009129 | 3300049569 | Bacteria | 7196 |
| 623 | Ga0501032_0052009 | 3300049569 | Bacteria | 2760 |
| 624 | Ga0501032_0190568 | 3300049569 | Bacteria | 1340 |
| 625 | Ga0501033_0008011 | 3300049570 | Bacteria | 8186 |
| 626 | Ga0501033_0058991 | 3300049570 | Bacteria | 2834 |
| 627 | Ga0501034_0897011 | 3300049571 | Bacteria | 774 |
| 628 | Ga0501036_0006619 | 3300049572 | Bacteria | 9417 |
| 629 | Ga0501036_0078378 | 3300049572 | Bacteria | 2794 |
| 630 | Ga0501036_0090339 | 3300049572 | Bacteria | 2587 |
| 631 | Ga0501036_0442168 | 3300049572 | Bacteria | 1083 |
| 632 | Ga0501036_0772581 | 3300049572 | Bacteria | 792 |
| 633 | Ga0501037_0014694 | 3300049573 | Bacteria | 5759 |
| 634 | Ga0501037_0136629 | 3300049573 | Bacteria | 1756 |
| 635 | Ga0501037_0183944 | 3300049573 | Unclassified | 1482 |
| 636 | Ga0501038_0019053 | 3300049574 | Bacteria | 6190 |
| 637 | Ga0501038_0046768 | 3300049574 | Bacteria | 3751 |
| 638 | Ga0501038_0469311 | 3300049574 | Bacteria | 966 |
| 639 | Ga0501038_0634509 | 3300049574 | Bacteria | 805 |
| 640 | Ga0501038_0996639 | 3300049574 | Bacteria | 615 |
| 641 | Ga0501039_0003541 | 3300049575 | Bacteria | 11699 |
| 642 | Ga0501039_0037872 | 3300049575 | Bacteria | 3724 |
| 643 | Ga0501040_0001593 | 3300049576 | Bacteria | 14460 |
| 644 | Ga0501040_0008401 | 3300049576 | Bacteria | 6709 |
| 645 | Ga0501040_0066320 | 3300049576 | Bacteria | 2487 |
| 646 | Ga0501041_0003041 | 3300049577 | Bacteria | 9621 |
| 647 | Ga0501041_0056845 | 3300049577 | Bacteria | 2392 |
| 648 | Ga0501042_0017257 | 3300049578 | Bacteria | 4976 |
| 649 | Ga0501042_0099137 | 3300049578 | Bacteria | 2095 |
| 650 | Ga0501042_0102625 | 3300049578 | Bacteria | 2057 |
| 651 | Ga0501042_1014448 | 3300049578 | Bacteria | 605 |
| 652 | Ga0501043_0007404 | 3300049579 | Bacteria | 8708 |
| 653 | Ga0501043_0022405 | 3300049579 | Bacteria | 4955 |
| 654 | Ga0501043_0028248 | 3300049579 | Bacteria | 4402 |
| 655 | Ga0501043_0133932 | 3300049579 | Bacteria | 1942 |
| 656 | Ga0501046_0023796 | 3300049580 | Bacteria | 5033 |
| 657 | Ga0501046_0045895 | 3300049580 | Bacteria | 3468 |
| 658 | Ga0501047_0745425 | 3300049581 | Bacteria | 795 |
| 659 | Ga0501048_0030061 | 3300049582 | Bacteria | 3934 |
| 660 | Ga0501048_0402553 | 3300049582 | Bacteria | 978 |
| 661 | Ga0501068_0021636 | 3300049584 | Bacteria | 3757 |
| 662 | Ga0501068_0141695 | 3300049584 | Bacteria | 1507 |
| 663 | Ga0501071_0007897 | 3300049587 | Bacteria | 7015 |
| 664 | Ga0501071_0025419 | 3300049587 | Bacteria | 4148 |
| 665 | Ga0501072_0003614 | 3300049588 | Bacteria | 11639 |
| 666 | Ga0501072_0133466 | 3300049588 | Bacteria | 1980 |
| 667 | Ga0501073_1129498 | 3300049589 | Bacteria | 538 |
| 668 | Ga0501074_0057730 | 3300049590 | Bacteria | 2796 |
| 669 | Ga0501075_0021118 | 3300049591 | Bacteria | 4744 |
| 670 | Ga0501076_0102105 | 3300049592 | Bacteria | 2312 |
| 671 | Ga0501076_0451345 | 3300049592 | Bacteria | 1058 |
| 672 | Ga0501077_0000195 | 3300049593 | Bacteria | 34941 |
| 673 | Ga0501077_0007301 | 3300049593 | Bacteria | 6820 |
| 674 | Ga0501201_000863 | 3300049651 | Bacteria | 2838 |
| 675 | Ga0501206_000236 | 3300049653 | Bacteria | 6504 |
| 676 | Ga0501216_000021 | 3300049660 | Bacteria | 13034 |
| 677 | Ga0501217_000668 | 3300049661 | Bacteria | 5822 |
| 678 | Ga0501227_002567 | 3300049665 | Bacteria | 3991 |
| 679 | Ga0501235_024165 | 3300049669 | Bacteria | 1356 |
| 680 | Ga0501236_000687 | 3300049670 | Bacteria | 3778 |
| 681 | Ga0501239_004487 | 3300049672 | Bacteria | 1373 |
| 682 | Ga0501243_000326 | 3300049675 | Bacteria | 6186 |
| 683 | Ga0501246_005188 | 3300049676 | Bacteria | 1087 |
| 684 | Ga0501249_002439 | 3300049679 | Bacteria | 3756 |
| 685 | Ga0501251_000705 | 3300049681 | Bacteria | 3005 |
| 686 | Ga0501255_009031 | 3300049684 | Bacteria | 1096 |
| 687 | Ga0501256_010259 | 3300049685 | Bacteria | 892 |
| 688 | Ga0501257_022385 | 3300049686 | Bacteria | 1495 |
| 689 | Ga0501260_000007 | 3300049689 | Bacteria | 14014 |
| 690 | Ga0501261_000142 | 3300049690 | Bacteria | 10454 |
| 691 | Ga0501219_000423 | 3300049703 | Bacteria | 6935 |
| 692 | Ga0501229_006934 | 3300049706 | Bacteria | 1405 |
| 693 | Ga0501234_000680 | 3300049707 | Bacteria | 5253 |
| 694 | Ga0501245_000494 | 3300049708 | Bacteria | 4784 |
| 695 | Ga0501079_0000550 | 3300049741 | Bacteria | 24508 |
| 696 | Ga0501079_0087970 | 3300049741 | Bacteria | 2405 |
| 697 | Ga0501080_0062340 | 3300049742 | Bacteria | 3470 |
| 698 | Ga0501080_0182128 | 3300049742 | Bacteria | 1932 |
| 699 | Ga0501080_1373954 | 3300049742 | Unclassified | 603 |
| 700 | Ga0501081_0003163 | 3300049743 | Bacteria | 10472 |
| 701 | Ga0501081_0086840 | 3300049743 | Bacteria | 2196 |
| 702 | Ga0501081_0211011 | 3300049743 | Bacteria | 1410 |
| 703 | Ga0501081_0498975 | 3300049743 | Bacteria | 907 |
| 704 | Ga0501262_080416 | 3300049759 | Bacteria | 544 |
| 705 | Ga0501268_001513 | 3300049765 | Bacteria | 2910 |
| 706 | Ga0501269_006189 | 3300049766 | Bacteria | 1441 |
| 707 | Ga0501272_000934 | 3300049769 | Bacteria | 2665 |
| 708 | Ga0501275_000840 | 3300049772 | Bacteria | 3315 |
| 709 | Ga0501276_000212 | 3300049773 | Bacteria | 3253 |
| 710 | Ga0501279_000060 | 3300049775 | Bacteria | 19728 |
| 711 | Ga0501281_02357 | 3300049777 | Bacteria | 1387 |
| 712 | Ga0501282_003473 | 3300049778 | Bacteria | 1701 |
| 713 | Ga0501283_001137 | 3300049779 | Bacteria | 3500 |
| 714 | Ga0501035_0007338 | 3300049822 | Bacteria | 10304 |
| 715 | Ga0501035_0008804 | 3300049822 | Bacteria | 9400 |
| 716 | Ga0501035_0169022 | 3300049822 | Bacteria | 1890 |
| 717 | Ga0501035_0350978 | 3300049822 | Bacteria | 1234 |
| 718 | Ga0501044_0000384 | 3300049823 | Bacteria | 54969 |
| 719 | Ga0501044_0149336 | 3300049823 | Unclassified | 2320 |
| 720 | Ga0501044_1192681 | 3300049823 | Bacteria | 629 |
| 721 | Ga0501045_0004294 | 3300049824 | Bacteria | 9831 |
| 722 | Ga0501045_0015931 | 3300049824 | Bacteria | 5333 |
| 723 | Ga0501045_0067447 | 3300049824 | Bacteria | 2627 |
| 724 | Ga0501045_0281768 | 3300049824 | Bacteria | 1237 |
| 725 | Ga0501204_004265 | 3300049850 | Bacteria | 1537 |
| 726 | Ga0501212_000132 | 3300049851 | Bacteria | 6028 |
| 727 | nmdc:mga03683_25383_c1 | 3300050489 | Bacteria | 2328 |
| 728 | nmdc:mga03n38_376302_c1 | 3300050490 | Bacteria | 777 |
| 729 | nmdc:mga03n38_490999_c1 | 3300050490 | Bacteria | 688 |
| 730 | nmdc:mga00v17_619917_c1 | 3300050491 | Bacteria | 697 |
| 731 | nmdc:mga0k408_532969_c1 | 3300050493 | Bacteria | 695 |
| 732 | nmdc:mga07m45_47528_c1 | 3300050496 | Bacteria | 960 |
| 733 | nmdc:mga05p37_159090_c1 | 3300050507 | Bacteria | 2759 |
| 734 | nmdc:mga05p37_1893_c1 | 3300050507 | Bacteria | 24382 |
| 735 | nmdc:mga05p37_4059_c1 | 3300050507 | Bacteria | 17110 |
| 736 | nmdc:mga05p37_493918_c1 | 3300050507 | Bacteria | 1406 |
| 737 | nmdc:mga05p37_500587_c1 | 3300050507 | Bacteria | 1394 |
| 738 | nmdc:mga05p37_639490_c1 | 3300050507 | Bacteria | 1193 |
| 739 | nmdc:mga05p37_92648_c1 | 3300050507 | Bacteria | 3723 |
| 740 | nmdc:mga09592_2836_c1 | 3300050508 | Bacteria | 14053 |
| 741 | nmdc:mga09592_34311_c1 | 3300050508 | Bacteria | 4241 |
| 742 | nmdc:mga09592_472992_c1 | 3300050508 | Unclassified | 1080 |
| 743 | nmdc:mga0qj67_184272_c1 | 3300050509 | Bacteria | 1696 |
| 744 | nmdc:mga0qj67_563_c1 | 3300050509 | Bacteria | 25259 |
| 745 | nmdc:mga0qj67_63437_c1 | 3300050509 | Bacteria | 2938 |
| 746 | nmdc:mga06r32_1293187_c1 | 3300050510 | Bacteria | 673 |
| 747 | nmdc:mga06r32_1363903_c1 | 3300050510 | Bacteria | 652 |
| 748 | nmdc:mga06r32_65640_c1 | 3300050510 | Bacteria | 3501 |
| 749 | nmdc:mga06r32_786545_c1 | 3300050510 | Bacteria | 913 |
| 750 | nmdc:mga06r32_88506_c1 | 3300050510 | Bacteria | 3023 |
| 751 | nmdc:mga08y16_126897_c1 | 3300050511 | Bacteria | 2654 |
| 752 | nmdc:mga08y16_189928_c1 | 3300050511 | Unclassified | 2131 |
| 753 | nmdc:mga08y16_2080321_c1 | 3300050511 | Bacteria | 516 |
| 754 | nmdc:mga08y16_332248_c1 | 3300050511 | Bacteria | 1563 |
| 755 | nmdc:mga08y16_3676_c1 | 3300050511 | Bacteria | 15964 |
| 756 | nmdc:mga08y16_435143_c1 | 3300050511 | Bacteria | 1339 |
| 757 | nmdc:mga08y16_53521_c1 | 3300050511 | Bacteria | 4220 |
| 758 | nmdc:mga08y16_5581_c1 | 3300050511 | Bacteria | 13180 |
| 759 | nmdc:mga08y16_66291_c1 | 3300050511 | Bacteria | 3768 |
| 760 | nmdc:mga08y16_853476_c1 | 3300050511 | Bacteria | 900 |
| 761 | nmdc:mga0n895_10980_c1 | 3300050512 | Bacteria | 8050 |
| 762 | nmdc:mga0n895_1154944_c1 | 3300050512 | Bacteria | 750 |
| 763 | nmdc:mga0n895_14348_c1 | 3300050512 | Bacteria | 7193 |
| 764 | nmdc:mga0n895_164_c1 | 3300050512 | Bacteria | 40868 |
| 765 | nmdc:mga0n895_364749_c1 | 3300050512 | Bacteria | 1463 |
| 766 | nmdc:mga0n895_86197_c1 | 3300050512 | Bacteria | 3137 |
| 767 | nmdc:mga0rr50_212665_c1 | 3300050513 | Bacteria | 1594 |
| 768 | nmdc:mga0rr50_21387_c1 | 3300050513 | Bacteria | 4416 |
| 769 | nmdc:mga0rr50_299313_c1 | 3300050513 | Bacteria | 1345 |
| 770 | nmdc:mga0rr50_757693_c1 | 3300050513 | Bacteria | 829 |
| 771 | nmdc:mga0rr50_7820_c1 | 3300050513 | Bacteria | 6628 |
| 772 | nmdc:mga0rr50_79065_c1 | 3300050513 | Bacteria | 2532 |
| 773 | nmdc:mga08x19_210_c1 | 3300050514 | Bacteria | 44472 |
| 774 | nmdc:mga08x19_28242_c1 | 3300050514 | Bacteria | 3513 |
| 775 | nmdc:mga08x19_306992_c1 | 3300050514 | Bacteria | 1103 |
| 776 | nmdc:mga08x19_317470_c1 | 3300050514 | Bacteria | 1084 |
| 777 | nmdc:mga08x19_38651_c1 | 3300050514 | Bacteria | 3031 |
| 778 | nmdc:mga08x19_441389_c1 | 3300050514 | Bacteria | 915 |
| 779 | nmdc:mga0a205_130471_c1 | 3300050515 | Bacteria | 2414 |
| 780 | nmdc:mga0a205_1332080_c1 | 3300050515 | Bacteria | 566 |
| 781 | nmdc:mga0a205_176908_c1 | 3300050515 | Bacteria | 2029 |
| 782 | nmdc:mga0a205_229591_c1 | 3300050515 | Bacteria | 1740 |
| 783 | nmdc:mga0a205_23839_c1 | 3300050515 | Bacteria | 2001 |
| 784 | nmdc:mga0a205_429349_c1 | 3300050515 | Bacteria | 1183 |
| 785 | nmdc:mga0a205_58777_c1 | 3300050515 | Bacteria | 3714 |
| 786 | nmdc:mga0a205_866824_c1 | 3300050515 | Bacteria | 750 |
| 787 | nmdc:mga0a205_93_c1 | 3300050515 | Bacteria | 13196 |
| 788 | Ga0495612_0501401 | 3300053078 | Bacteria | 557 |
| 789 | Ga0501084_0001686 | 3300054114 | Bacteria | 17565 |
| 790 | Ga0501084_0834518 | 3300054114 | Bacteria | 776 |
| 791 | Ga0590071_044170 | 3300059421 | Bacteria | 1074 |
| 792 | Ga0501082_0006761 | 3300060353 | Bacteria | 9912 |
| 793 | Ga0501082_0029705 | 3300060353 | Bacteria | 4710 |
| 794 | Ga0501082_0113819 | 3300060353 | Bacteria | 2343 |
| 795 | Ga0466962_0003614 | 3300061719 | Bacteria | 7371 |
| 796 | Ga0530510_0008140 | 3300061734 | Bacteria | 7314 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025908 | Ga0207643_10661231 | Ga0207643_106612312 | 113 |
| 2 | 3300009101 | Ga0105247_10000003 | Ga0105247_10000003313 | 134 |
| 3 | 3300009148 | Ga0105243_10556173 | Ga0105243_105561732 | 134 |
| 4 | 3300014968 | Ga0157379_10441806 | Ga0157379_104418062 | 134 |
| 5 | 3300005327 | Ga0070658_10262617 | Ga0070658_102626171 | 135 |
| 6 | 3300005338 | Ga0068868_100616430 | Ga0068868_1006164301 | 135 |
| 7 | 3300005444 | Ga0070694_101051226 | Ga0070694_1010512261 | 135 |
| 8 | 3300009092 | Ga0105250_10339842 | Ga0105250_103398421 | 135 |
| 9 | 3300009148 | Ga0105243_12018515 | Ga0105243_120185151 | 135 |
| 10 | 3300009545 | Ga0105237_10754845 | Ga0105237_107548452 | 135 |
| 11 | 3300009551 | Ga0105238_10008147 | Ga0105238_100081474 | 135 |
| 12 | 3300010375 | Ga0105239_10095990 | Ga0105239_100959902 | 135 |
| 13 | 3300013105 | Ga0157369_10066030 | Ga0157369_100660302 | 135 |
| 14 | 3300013297 | Ga0157378_10469783 | Ga0157378_104697832 | 135 |
| 15 | 3300013297 | Ga0157378_10484642 | Ga0157378_104846422 | 135 |
| 16 | 3300013307 | Ga0157372_10398176 | Ga0157372_103981761 | 135 |
| 17 | 3300013308 | Ga0157375_11063210 | Ga0157375_110632102 | 135 |
| 18 | 3300014325 | Ga0163163_10040967 | Ga0163163_100409675 | 135 |
| 19 | 3300014325 | Ga0163163_10141088 | Ga0163163_101410883 | 135 |
| 20 | 3300014326 | Ga0157380_10143149 | Ga0157380_101431493 | 135 |
| 21 | 3300014497 | Ga0182008_10045440 | Ga0182008_100454403 | 135 |
| 22 | 3300015261 | Ga0182006_1039209 | Ga0182006_10392092 | 135 |
| 23 | 3300015262 | Ga0182007_10073972 | Ga0182007_100739722 | 135 |
| 24 | 3300025923 | Ga0207681_11053772 | Ga0207681_110537721 | 135 |
| 25 | 3300042156 | Ga0439446_0032242 | Ga0439446_0032242_688_1107 | 135 |
| 26 | 3300048904 | Ga0496101_1091632 | Ga0496101_1091632_119_532 | 135 |
| 27 | 3300048905 | Ga0496102_0292523 | Ga0496102_0292523_701_1114 | 135 |
| 28 | 3300048913 | Ga0496110_0266317 | Ga0496110_0266317_907_1320 | 135 |
| 29 | 3300048915 | Ga0496112_0104709 | Ga0496112_0104709_496_909 | 135 |
| 30 | 3300048916 | Ga0496113_0101144 | Ga0496113_0101144_778_1191 | 135 |
| 31 | 3300050489 | nmdc:mga03683_25383_c1 | nmdc:mga03683_25383_c1_974_1393 | 135 |
| 32 | 3300050490 | nmdc:mga03n38_490999_c1 | nmdc:mga03n38_490999_c1_165_584 | 135 |
| 33 | 3300050508 | nmdc:mga09592_472992_c1 | nmdc:mga09592_472992_c1_30_443 | 135 |
| 34 | 3300005354 | Ga0070675_100206245 | Ga0070675_1002062453 | 136 |
| 35 | 3300005617 | Ga0068859_100172050 | Ga0068859_1001720504 | 136 |
| 36 | 3300006931 | Ga0097620_100172052 | Ga0097620_1001720524 | 136 |
| 37 | 3300009094 | Ga0111539_10737266 | Ga0111539_107372662 | 136 |
| 38 | 3300013104 | Ga0157370_10077553 | Ga0157370_100775532 | 136 |
| 39 | 3300013297 | Ga0157378_11580371 | Ga0157378_115803712 | 136 |
| 40 | 3300013308 | Ga0157375_11737657 | Ga0157375_117376572 | 136 |
| 41 | 3300025926 | Ga0207659_11063573 | Ga0207659_110635731 | 136 |
| 42 | 3300026075 | Ga0207708_11718095 | Ga0207708_117180952 | 136 |
| 43 | 3300027907 | Ga0207428_11193921 | Ga0207428_111939211 | 136 |
| 44 | 3300049569 | Ga0501032_0052009 | Ga0501032_0052009_2153_2563 | 136 |
| 45 | 3300049569 | Ga0501032_0190568 | Ga0501032_0190568_511_921 | 136 |
| 46 | 3300049570 | Ga0501033_0008011 | Ga0501033_0008011_3550_3960 | 136 |
| 47 | 3300049570 | Ga0501033_0058991 | Ga0501033_0058991_1572_2003 | 136 |
| 48 | 3300049572 | Ga0501036_0006619 | Ga0501036_0006619_837_1268 | 136 |
| 49 | 3300049572 | Ga0501036_0078378 | Ga0501036_0078378_337_747 | 136 |
| 50 | 3300049574 | Ga0501038_0019053 | Ga0501038_0019053_60_470 | 136 |
| 51 | 3300049575 | Ga0501039_0003541 | Ga0501039_0003541_1977_2408 | 136 |
| 52 | 3300049575 | Ga0501039_0037872 | Ga0501039_0037872_2214_2624 | 136 |
| 53 | 3300049576 | Ga0501040_0001593 | Ga0501040_0001593_6425_6856 | 136 |
| 54 | 3300049576 | Ga0501040_0008401 | Ga0501040_0008401_2568_2978 | 136 |
| 55 | 3300049577 | Ga0501041_0003041 | Ga0501041_0003041_3756_4187 | 136 |
| 56 | 3300049579 | Ga0501043_0022405 | Ga0501043_0022405_631_1041 | 136 |
| 57 | 3300049580 | Ga0501046_0023796 | Ga0501046_0023796_2063_2473 | 136 |
| 58 | 3300049581 | Ga0501047_0745425 | Ga0501047_0745425_28_438 | 136 |
| 59 | 3300049582 | Ga0501048_0030061 | Ga0501048_0030061_2439_2849 | 136 |
| 60 | 3300049584 | Ga0501068_0021636 | Ga0501068_0021636_3152_3583 | 136 |
| 61 | 3300049584 | Ga0501068_0141695 | Ga0501068_0141695_124_534 | 136 |
| 62 | 3300049587 | Ga0501071_0007897 | Ga0501071_0007897_5421_5852 | 136 |
| 63 | 3300049588 | Ga0501072_0003614 | Ga0501072_0003614_5505_5936 | 136 |
| 64 | 3300049593 | Ga0501077_0000195 | Ga0501077_0000195_23224_23655 | 136 |
| 65 | 3300049741 | Ga0501079_0000550 | Ga0501079_0000550_19391_19822 | 136 |
| 66 | 3300049742 | Ga0501080_0182128 | Ga0501080_0182128_712_1143 | 136 |
| 67 | 3300049743 | Ga0501081_0003163 | Ga0501081_0003163_8312_8743 | 136 |
| 68 | 3300049822 | Ga0501035_0007338 | Ga0501035_0007338_7779_8189 | 136 |
| 69 | 3300049822 | Ga0501035_0169022 | Ga0501035_0169022_380_790 | 136 |
| 70 | 3300049823 | Ga0501044_1192681 | Ga0501044_1192681_86_517 | 136 |
| 71 | 3300049824 | Ga0501045_0004294 | Ga0501045_0004294_5270_5701 | 136 |
| 72 | 3300050510 | nmdc:mga06r32_1293187_c1 | nmdc:mga06r32_1293187_c1_140_571 | 136 |
| 73 | 3300050511 | nmdc:mga08y16_853476_c1 | nmdc:mga08y16_853476_c1_225_635 | 136 |
| 74 | 3300054114 | Ga0501084_0001686 | Ga0501084_0001686_5435_5866 | 136 |
| 75 | 3300060353 | Ga0501082_0006761 | Ga0501082_0006761_3924_4355 | 136 |
| 76 | 3300061734 | Ga0530510_0008140 | Ga0530510_0008140_2197_2628 | 136 |
| 77 | 3300002074 | JGI24748J21848_1000012 | JGI24748J21848_100001222 | 137 |
| 78 | 3300002239 | JGI24034J26672_10000003 | JGI24034J26672_10000003317 | 137 |
| 79 | 3300002244 | JGI24742J22300_10011251 | JGI24742J22300_100112512 | 137 |
| 80 | 3300005337 | Ga0070682_100198196 | Ga0070682_1001981962 | 137 |
| 81 | 3300005338 | Ga0068868_100705181 | Ga0068868_1007051812 | 137 |
| 82 | 3300005345 | Ga0070692_10261449 | Ga0070692_102614492 | 137 |
| 83 | 3300005355 | Ga0070671_100136728 | Ga0070671_1001367284 | 137 |
| 84 | 3300005364 | Ga0070673_100037834 | Ga0070673_1000378346 | 137 |
| 85 | 3300005436 | Ga0070713_100258326 | Ga0070713_1002583263 | 137 |
| 86 | 3300005440 | Ga0070705_100157023 | Ga0070705_1001570231 | 137 |
| 87 | 3300005458 | Ga0070681_11105579 | Ga0070681_111055792 | 137 |
| 88 | 3300005539 | Ga0068853_100235387 | Ga0068853_1002353872 | 137 |
| 89 | 3300005842 | Ga0068858_100000468 | Ga0068858_10000046812 | 137 |
| 90 | 3300006852 | Ga0075433_11464042 | Ga0075433_114640421 | 137 |
| 91 | 3300007265 | Ga0099794_10088314 | Ga0099794_100883142 | 137 |
| 92 | 3300009093 | Ga0105240_10000385 | Ga0105240_1000038514 | 137 |
| 93 | 3300010375 | Ga0105239_10000030 | Ga0105239_1000003014 | 137 |
| 94 | 3300025223 | Ga0207672_1000256 | Ga0207672_10002563 | 137 |
| 95 | 3300025900 | Ga0207710_10000001 | Ga0207710_10000001996 | 137 |
| 96 | 3300025928 | Ga0207700_10275842 | Ga0207700_102758423 | 137 |
| 97 | 3300025931 | Ga0207644_10000637 | Ga0207644_1000063718 | 137 |
| 98 | 3300026023 | Ga0207677_10670875 | Ga0207677_106708752 | 137 |
| 99 | 3300026035 | Ga0207703_10000080 | Ga0207703_1000008027 | 137 |
| 100 | 3300026075 | Ga0207708_10259927 | Ga0207708_102599272 | 137 |
| 101 | 3300028573 | Ga0265334_10052383 | Ga0265334_100523832 | 137 |
| 102 | 3300028800 | Ga0265338_10008740 | Ga0265338_100087402 | 137 |
| 103 | 3300041413 | Ga0439465_0382718 | Ga0439465_0382718_96_521 | 137 |
| 104 | 3300044658 | Ga0466972_0000439 | Ga0466972_0000439_6798_7211 | 137 |
| 105 | 3300044765 | Ga0466970_0000154 | Ga0466970_0000154_6776_7189 | 137 |
| 106 | 3300046463 | Ga0495653_0000588 | Ga0495653_0000588_25414_25830 | 137 |
| 107 | 3300046528 | Ga0495642_0495215 | Ga0495642_0495215_13_429 | 137 |
| 108 | 3300048905 | Ga0496102_0345836 | Ga0496102_0345836_676_1092 | 137 |
| 109 | 3300048906 | Ga0496103_0103565 | Ga0496103_0103565_510_926 | 137 |
| 110 | 3300048927 | Ga0496124_0088357 | Ga0496124_0088357_1320_1736 | 137 |
| 111 | 3300048928 | Ga0496125_0145529 | Ga0496125_0145529_541_957 | 137 |
| 112 | 3300049521 | Ga0501298_049205 | Ga0501298_049205_378_806 | 137 |
| 113 | 3300050507 | nmdc:mga05p37_500587_c1 | nmdc:mga05p37_500587_c1_734_1162 | 137 |
| 114 | 3300050515 | nmdc:mga0a205_866824_c1 | nmdc:mga0a205_866824_c1_212_670 | 137 |
| 115 | 3300005289 | Ga0065704_10411573 | Ga0065704_104115732 | 138 |
| 116 | 3300005328 | Ga0070676_10613533 | Ga0070676_106135331 | 138 |
| 117 | 3300005331 | Ga0070670_100248534 | Ga0070670_1002485342 | 138 |
| 118 | 3300005331 | Ga0070670_101467059 | Ga0070670_1014670591 | 138 |
| 119 | 3300005334 | Ga0068869_100069062 | Ga0068869_1000690623 | 138 |
| 120 | 3300005334 | Ga0068869_100172318 | Ga0068869_1001723182 | 138 |
| 121 | 3300005337 | Ga0070682_101133175 | Ga0070682_1011331751 | 138 |
| 122 | 3300005344 | Ga0070661_100416365 | Ga0070661_1004163652 | 138 |
| 123 | 3300005345 | Ga0070692_10408232 | Ga0070692_104082321 | 138 |
| 124 | 3300005355 | Ga0070671_100654473 | Ga0070671_1006544731 | 138 |
| 125 | 3300005367 | Ga0070667_100651284 | Ga0070667_1006512842 | 138 |
| 126 | 3300005435 | Ga0070714_101134731 | Ga0070714_1011347311 | 138 |
| 127 | 3300005438 | Ga0070701_10052198 | Ga0070701_100521982 | 138 |
| 128 | 3300005439 | Ga0070711_100543300 | Ga0070711_1005433001 | 138 |
| 129 | 3300005441 | Ga0070700_100000112 | Ga0070700_1000001129 | 138 |
| 130 | 3300005459 | Ga0068867_101090848 | Ga0068867_1010908481 | 138 |
| 131 | 3300005468 | Ga0070707_100010371 | Ga0070707_1000103712 | 138 |
| 132 | 3300005518 | Ga0070699_100369492 | Ga0070699_1003694921 | 138 |
| 133 | 3300005544 | Ga0070686_100014523 | Ga0070686_1000145232 | 138 |
| 134 | 3300005549 | Ga0070704_100021936 | Ga0070704_1000219362 | 138 |
| 135 | 3300005549 | Ga0070704_101245344 | Ga0070704_1012453441 | 138 |
| 136 | 3300005564 | Ga0070664_100093410 | Ga0070664_1000934104 | 138 |
| 137 | 3300005564 | Ga0070664_100137888 | Ga0070664_1001378881 | 138 |
| 138 | 3300005616 | Ga0068852_100943138 | Ga0068852_1009431381 | 138 |
| 139 | 3300005618 | Ga0068864_101906595 | Ga0068864_1019065951 | 138 |
| 140 | 3300005841 | Ga0068863_100673630 | Ga0068863_1006736301 | 138 |
| 141 | 3300005937 | Ga0081455_10353898 | Ga0081455_103538982 | 138 |
| 142 | 3300006173 | Ga0070716_100802108 | Ga0070716_1008021081 | 138 |
| 143 | 3300006175 | Ga0070712_100842937 | Ga0070712_1008429371 | 138 |
| 144 | 3300006177 | Ga0075362_10009812 | Ga0075362_100098123 | 138 |
| 145 | 3300006195 | Ga0075366_10868011 | Ga0075366_108680111 | 138 |
| 146 | 3300006353 | Ga0075370_10019829 | Ga0075370_100198295 | 138 |
| 147 | 3300006358 | Ga0068871_100740174 | Ga0068871_1007401741 | 138 |
| 148 | 3300006846 | Ga0075430_100000131 | Ga0075430_10000013141 | 138 |
| 149 | 3300006847 | Ga0075431_100000085 | Ga0075431_10000008550 | 138 |
| 150 | 3300006880 | Ga0075429_100461334 | Ga0075429_1004613343 | 138 |
| 151 | 3300006914 | Ga0075436_100000132 | Ga0075436_10000013232 | 138 |
| 152 | 3300007265 | Ga0099794_10003354 | Ga0099794_100033543 | 138 |
| 153 | 3300007265 | Ga0099794_10014781 | Ga0099794_100147813 | 138 |
| 154 | 3300009093 | Ga0105240_10026018 | Ga0105240_1002601810 | 138 |
| 155 | 3300009094 | Ga0111539_10011892 | Ga0111539_100118926 | 138 |
| 156 | 3300009094 | Ga0111539_10068352 | Ga0111539_100683522 | 138 |
| 157 | 3300009094 | Ga0111539_10119907 | Ga0111539_101199072 | 138 |
| 158 | 3300009101 | Ga0105247_10048944 | Ga0105247_100489442 | 138 |
| 159 | 3300009147 | Ga0114129_10003362 | Ga0114129_1000336221 | 138 |
| 160 | 3300009147 | Ga0114129_10111427 | Ga0114129_101114276 | 138 |
| 161 | 3300009147 | Ga0114129_10206282 | Ga0114129_102062823 | 138 |
| 162 | 3300009147 | Ga0114129_10984119 | Ga0114129_109841191 | 138 |
| 163 | 3300009176 | Ga0105242_10025570 | Ga0105242_100255703 | 138 |
| 164 | 3300009177 | Ga0105248_10053278 | Ga0105248_100532783 | 138 |
| 165 | 3300009177 | Ga0105248_11121712 | Ga0105248_111217122 | 138 |
| 166 | 3300009553 | Ga0105249_11278569 | Ga0105249_112785692 | 138 |
| 167 | 3300009553 | Ga0105249_12054164 | Ga0105249_120541641 | 138 |
| 168 | 3300013297 | Ga0157378_10552527 | Ga0157378_105525272 | 138 |
| 169 | 3300013297 | Ga0157378_11351462 | Ga0157378_113514622 | 138 |
| 170 | 3300013306 | Ga0163162_11181335 | Ga0163162_111813352 | 138 |
| 171 | 3300013306 | Ga0163162_11847120 | Ga0163162_118471201 | 138 |
| 172 | 3300014326 | Ga0157380_10291923 | Ga0157380_102919232 | 138 |
| 173 | 3300021384 | Ga0213876_10401907 | Ga0213876_104019072 | 138 |
| 174 | 3300025315 | Ga0207697_10321863 | Ga0207697_103218631 | 138 |
| 175 | 3300025909 | Ga0207705_10299994 | Ga0207705_102999941 | 138 |
| 176 | 3300025910 | Ga0207684_10666297 | Ga0207684_106662971 | 138 |
| 177 | 3300025915 | Ga0207693_10406411 | Ga0207693_104064111 | 138 |
| 178 | 3300025917 | Ga0207660_10107510 | Ga0207660_101075103 | 138 |
| 179 | 3300025919 | Ga0207657_10003367 | Ga0207657_100033674 | 138 |
| 180 | 3300025920 | Ga0207649_11201540 | Ga0207649_112015401 | 138 |
| 181 | 3300025922 | Ga0207646_10011251 | Ga0207646_100112512 | 138 |
| 182 | 3300025924 | Ga0207694_10036729 | Ga0207694_100367294 | 138 |
| 183 | 3300025925 | Ga0207650_10430138 | Ga0207650_104301382 | 138 |
| 184 | 3300025929 | Ga0207664_11530517 | Ga0207664_115305171 | 138 |
| 185 | 3300025931 | Ga0207644_10548962 | Ga0207644_105489621 | 138 |
| 186 | 3300025933 | Ga0207706_10062103 | Ga0207706_100621034 | 138 |
| 187 | 3300025940 | Ga0207691_10154703 | Ga0207691_101547031 | 138 |
| 188 | 3300025942 | Ga0207689_10010960 | Ga0207689_1001096011 | 138 |
| 189 | 3300025942 | Ga0207689_11034679 | Ga0207689_110346791 | 138 |
| 190 | 3300025945 | Ga0207679_10182419 | Ga0207679_101824192 | 138 |
| 191 | 3300025945 | Ga0207679_10311507 | Ga0207679_103115072 | 138 |
| 192 | 3300025981 | Ga0207640_11369742 | Ga0207640_113697421 | 138 |
| 193 | 3300025986 | Ga0207658_10256401 | Ga0207658_102564012 | 138 |
| 194 | 3300026023 | Ga0207677_10465291 | Ga0207677_104652911 | 138 |
| 195 | 3300026035 | Ga0207703_10445249 | Ga0207703_104452492 | 138 |
| 196 | 3300026075 | Ga0207708_10000059 | Ga0207708_1000005918 | 138 |
| 197 | 3300026088 | Ga0207641_10728586 | Ga0207641_107285861 | 138 |
| 198 | 3300026118 | Ga0207675_101519770 | Ga0207675_1015197701 | 138 |
| 199 | 3300027671 | Ga0209588_1004073 | Ga0209588_10040733 | 138 |
| 200 | 3300027671 | Ga0209588_1126662 | Ga0209588_11266622 | 138 |
| 201 | 3300028380 | Ga0268265_11633133 | Ga0268265_116331332 | 138 |
| 202 | 3300031649 | Ga0307514_10121942 | Ga0307514_101219423 | 138 |
| 203 | 3300032004 | Ga0307414_10137183 | Ga0307414_101371832 | 138 |
| 204 | 3300035083 | Ga0373926_0029548 | Ga0373926_0029548_1290_1709 | 138 |
| 205 | 3300035088 | Ga0373940_0003892 | Ga0373940_0003892_1197_1625 | 138 |
| 206 | 3300035092 | Ga0373952_0035245 | Ga0373952_0035245_547_963 | 138 |
| 207 | 3300035112 | Ga0373932_0354921 | Ga0373932_0354921_103_531 | 138 |
| 208 | 3300035115 | Ga0373941_0318024 | Ga0373941_0318024_82_498 | 138 |
| 209 | 3300035410 | Ga0373924_0143933 | Ga0373924_0143933_70_489 | 138 |
| 210 | 3300035725 | Ga0373947_0012273 | Ga0373947_0012273_3965_4384 | 138 |
| 211 | 3300039437 | Ga0436365_1620852 | Ga0436365_1620852_377_829 | 138 |
| 212 | 3300042011 | Ga0439454_010449 | Ga0439454_010449_232_654 | 138 |
| 213 | 3300044684 | Ga0466966_0014322 | Ga0466966_0014322_4216_4638 | 138 |
| 214 | 3300045051 | Ga0451576_0061086 | Ga0451576_0061086_1070_1498 | 138 |
| 215 | 3300045051 | Ga0451576_0183851 | Ga0451576_0183851_139_564 | 138 |
| 216 | 3300045051 | Ga0451576_0500950 | Ga0451576_0500950_835_1257 | 138 |
| 217 | 3300045051 | Ga0451576_1332183 | Ga0451576_1332183_302_727 | 138 |
| 218 | 3300045051 | Ga0451576_1861100 | Ga0451576_1861100_41_457 | 138 |
| 219 | 3300046526 | Ga0495666_0300631 | Ga0495666_0300631_198_617 | 138 |
| 220 | 3300049513 | Ga0501290_000013 | Ga0501290_000013_25709_26155 | 138 |
| 221 | 3300049568 | Ga0501031_0002145 | Ga0501031_0002145_5995_6411 | 138 |
| 222 | 3300049569 | Ga0501032_0009129 | Ga0501032_0009129_2472_2888 | 138 |
| 223 | 3300049571 | Ga0501034_0897011 | Ga0501034_0897011_22_438 | 138 |
| 224 | 3300049573 | Ga0501037_0014694 | Ga0501037_0014694_3369_3785 | 138 |
| 225 | 3300049574 | Ga0501038_0469311 | Ga0501038_0469311_455_871 | 138 |
| 226 | 3300049574 | Ga0501038_0634509 | Ga0501038_0634509_368_784 | 138 |
| 227 | 3300049578 | Ga0501042_0017257 | Ga0501042_0017257_2566_2982 | 138 |
| 228 | 3300049579 | Ga0501043_0028248 | Ga0501043_0028248_1322_1738 | 138 |
| 229 | 3300049589 | Ga0501073_1129498 | Ga0501073_1129498_16_432 | 138 |
| 230 | 3300049681 | Ga0501251_000705 | Ga0501251_000705_225_671 | 138 |
| 231 | 3300049742 | Ga0501080_1373954 | Ga0501080_1373954_17_454 | 138 |
| 232 | 3300049743 | Ga0501081_0498975 | Ga0501081_0498975_358_795 | 138 |
| 233 | 3300049824 | Ga0501045_0067447 | Ga0501045_0067447_1650_2066 | 138 |
| 234 | 3300050490 | nmdc:mga03n38_376302_c1 | nmdc:mga03n38_376302_c1_107_532 | 138 |
| 235 | 3300050493 | nmdc:mga0k408_532969_c1 | nmdc:mga0k408_532969_c1_82_510 | 138 |
| 236 | 3300050496 | nmdc:mga07m45_47528_c1 | nmdc:mga07m45_47528_c1_235_663 | 138 |
| 237 | 3300050507 | nmdc:mga05p37_159090_c1 | nmdc:mga05p37_159090_c1_787_1218 | 138 |
| 238 | 3300050507 | nmdc:mga05p37_1893_c1 | nmdc:mga05p37_1893_c1_5838_6257 | 138 |
| 239 | 3300050507 | nmdc:mga05p37_493918_c1 | nmdc:mga05p37_493918_c1_915_1337 | 138 |
| 240 | 3300050508 | nmdc:mga09592_34311_c1 | nmdc:mga09592_34311_c1_1377_1808 | 138 |
| 241 | 3300050509 | nmdc:mga0qj67_563_c1 | nmdc:mga0qj67_563_c1_3063_3482 | 138 |
| 242 | 3300050509 | nmdc:mga0qj67_63437_c1 | nmdc:mga0qj67_63437_c1_633_1064 | 138 |
| 243 | 3300050510 | nmdc:mga06r32_1363903_c1 | nmdc:mga06r32_1363903_c1_150_581 | 138 |
| 244 | 3300050510 | nmdc:mga06r32_65640_c1 | nmdc:mga06r32_65640_c1_2488_2919 | 138 |
| 245 | 3300050510 | nmdc:mga06r32_88506_c1 | nmdc:mga06r32_88506_c1_2525_2944 | 138 |
| 246 | 3300050511 | nmdc:mga08y16_332248_c1 | nmdc:mga08y16_332248_c1_1126_1542 | 138 |
| 247 | 3300050511 | nmdc:mga08y16_435143_c1 | nmdc:mga08y16_435143_c1_219_644 | 138 |
| 248 | 3300050511 | nmdc:mga08y16_5581_c1 | nmdc:mga08y16_5581_c1_8314_8739 | 138 |
| 249 | 3300050512 | nmdc:mga0n895_14348_c1 | nmdc:mga0n895_14348_c1_5149_5580 | 138 |
| 250 | 3300050512 | nmdc:mga0n895_364749_c1 | nmdc:mga0n895_364749_c1_521_937 | 138 |
| 251 | 3300050512 | nmdc:mga0n895_86197_c1 | nmdc:mga0n895_86197_c1_1760_2188 | 138 |
| 252 | 3300050513 | nmdc:mga0rr50_212665_c1 | nmdc:mga0rr50_212665_c1_343_771 | 138 |
| 253 | 3300050513 | nmdc:mga0rr50_757693_c1 | nmdc:mga0rr50_757693_c1_180_611 | 138 |
| 254 | 3300050513 | nmdc:mga0rr50_7820_c1 | nmdc:mga0rr50_7820_c1_3542_3958 | 138 |
| 255 | 3300050514 | nmdc:mga08x19_210_c1 | nmdc:mga08x19_210_c1_35850_36275 | 138 |
| 256 | 3300050514 | nmdc:mga08x19_317470_c1 | nmdc:mga08x19_317470_c1_492_920 | 138 |
| 257 | 3300050514 | nmdc:mga08x19_38651_c1 | nmdc:mga08x19_38651_c1_871_1287 | 138 |
| 258 | 3300050515 | nmdc:mga0a205_130471_c1 | nmdc:mga0a205_130471_c1_1524_1952 | 138 |
| 259 | 3300050515 | nmdc:mga0a205_176908_c1 | nmdc:mga0a205_176908_c1_167_598 | 138 |
| 260 | 3300050515 | nmdc:mga0a205_229591_c1 | nmdc:mga0a205_229591_c1_527_943 | 138 |
| 261 | 3300053078 | Ga0495612_0501401 | Ga0495612_0501401_36_455 | 138 |
| 262 | 3300054114 | Ga0501084_0834518 | Ga0501084_0834518_252_689 | 138 |
| 263 | 3300059421 | Ga0590071_044170 | Ga0590071_044170_285_704 | 138 |
| 264 | 3300061719 | Ga0466962_0003614 | Ga0466962_0003614_990_1412 | 138 |
| 265 | 3300005536 | Ga0070697_100399680 | Ga0070697_1003996802 | 139 |
| 266 | 3300006847 | Ga0075431_101606546 | Ga0075431_1016065461 | 139 |
| 267 | 3300034816 | Ga0373930_0022643 | Ga0373930_0022643_790_1209 | 139 |
| 268 | 3300003322 | rootL2_10010204 | rootL2_100102041 | 140 |
| 269 | 3300005329 | Ga0070683_100523770 | Ga0070683_1005237702 | 140 |
| 270 | 3300005331 | Ga0070670_100795342 | Ga0070670_1007953422 | 140 |
| 271 | 3300005441 | Ga0070700_100007644 | Ga0070700_1000076442 | 140 |
| 272 | 3300005441 | Ga0070700_100411028 | Ga0070700_1004110281 | 140 |
| 273 | 3300005518 | Ga0070699_100520006 | Ga0070699_1005200062 | 140 |
| 274 | 3300005577 | Ga0068857_100455849 | Ga0068857_1004558492 | 140 |
| 275 | 3300005615 | Ga0070702_100009329 | Ga0070702_1000093292 | 140 |
| 276 | 3300005719 | Ga0068861_101269620 | Ga0068861_1012696202 | 140 |
| 277 | 3300005840 | Ga0068870_10115763 | Ga0068870_101157632 | 140 |
| 278 | 3300006237 | Ga0097621_100009441 | Ga0097621_10000944111 | 140 |
| 279 | 3300006358 | Ga0068871_100008898 | Ga0068871_1000088987 | 140 |
| 280 | 3300006844 | Ga0075428_100015897 | Ga0075428_1000158976 | 140 |
| 281 | 3300006844 | Ga0075428_102268729 | Ga0075428_1022687291 | 140 |
| 282 | 3300006847 | Ga0075431_100056816 | Ga0075431_1000568161 | 140 |
| 283 | 3300009098 | Ga0105245_11987963 | Ga0105245_119879631 | 140 |
| 284 | 3300009148 | Ga0105243_10165569 | Ga0105243_101655692 | 140 |
| 285 | 3300009545 | Ga0105237_10518637 | Ga0105237_105186372 | 140 |
| 286 | 3300009551 | Ga0105238_10017429 | Ga0105238_100174295 | 140 |
| 287 | 3300010375 | Ga0105239_10721307 | Ga0105239_107213072 | 140 |
| 288 | 3300013297 | Ga0157378_12007373 | Ga0157378_120073731 | 140 |
| 289 | 3300021377 | Ga0213874_10028766 | Ga0213874_100287662 | 140 |
| 290 | 3300021384 | Ga0213876_10100276 | Ga0213876_101002762 | 140 |
| 291 | 3300025904 | Ga0207647_10000659 | Ga0207647_1000065924 | 140 |
| 292 | 3300025908 | Ga0207643_10186158 | Ga0207643_101861582 | 140 |
| 293 | 3300025913 | Ga0207695_10000517 | Ga0207695_1000051713 | 140 |
| 294 | 3300025924 | Ga0207694_10050803 | Ga0207694_100508033 | 140 |
| 295 | 3300025936 | Ga0207670_10609679 | Ga0207670_106096791 | 140 |
| 296 | 3300025944 | Ga0207661_10373243 | Ga0207661_103732432 | 140 |
| 297 | 3300025972 | Ga0207668_10238480 | Ga0207668_102384802 | 140 |
| 298 | 3300026035 | Ga0207703_11173880 | Ga0207703_111738802 | 140 |
| 299 | 3300026041 | Ga0207639_10505175 | Ga0207639_105051751 | 140 |
| 300 | 3300026075 | Ga0207708_10218025 | Ga0207708_102180252 | 140 |
| 301 | 3300026075 | Ga0207708_11064364 | Ga0207708_110643641 | 140 |
| 302 | 3300026116 | Ga0207674_10459959 | Ga0207674_104599592 | 140 |
| 303 | 3300026116 | Ga0207674_11068435 | Ga0207674_110684352 | 140 |
| 304 | 3300027907 | Ga0207428_10043428 | Ga0207428_100434284 | 140 |
| 305 | 3300039437 | Ga0436365_0094627 | Ga0436365_0094627_1230_1655 | 140 |
| 306 | 3300039450 | Ga0436363_0937612 | Ga0436363_0937612_1158_1583 | 140 |
| 307 | 3300044842 | Ga0466957_0912838 | Ga0466957_0912838_58_486 | 140 |
| 308 | 3300046526 | Ga0495666_0018234 | Ga0495666_0018234_974_1399 | 140 |
| 309 | 3300046674 | Ga0495588_0302815 | Ga0495588_0302815_259_684 | 140 |
| 310 | 3300046689 | Ga0495613_0020098 | Ga0495613_0020098_2883_3308 | 140 |
| 311 | 3300046809 | Ga0495600_0003535 | Ga0495600_0003535_1037_1462 | 140 |
| 312 | 3300047322 | Ga0495680_0002141 | Ga0495680_0002141_18799_19224 | 140 |
| 313 | 3300048088 | Ga0495602_0002433 | Ga0495602_0002433_1068_1493 | 140 |
| 314 | 3300048905 | Ga0496102_0309418 | Ga0496102_0309418_84_509 | 140 |
| 315 | 3300048907 | Ga0496104_0110081 | Ga0496104_0110081_221_646 | 140 |
| 316 | 3300048908 | Ga0496105_0011527 | Ga0496105_0011527_1656_2081 | 140 |
| 317 | 3300048919 | Ga0496116_0030962 | Ga0496116_0030962_1637_2062 | 140 |
| 318 | 3300048920 | Ga0496117_0002926 | Ga0496117_0002926_9968_10393 | 140 |
| 319 | 3300048921 | Ga0496118_0005709 | Ga0496118_0005709_7415_7840 | 140 |
| 320 | 3300048922 | Ga0496119_0000058 | Ga0496119_0000058_7410_7835 | 140 |
| 321 | 3300048923 | Ga0496120_0000184 | Ga0496120_0000184_98802_99227 | 140 |
| 322 | 3300049572 | Ga0501036_0772581 | Ga0501036_0772581_325_756 | 140 |
| 323 | 3300050511 | nmdc:mga08y16_66291_c1 | nmdc:mga08y16_66291_c1_2272_2706 | 140 |
| 324 | 3300000652 | ARCol0yngRDRAFT_1011104 | ARCol0yngRDRAFT_10111042 | 141 |
| 325 | 3300003203 | JGI25406J46586_10048926 | JGI25406J46586_100489262 | 141 |
| 326 | 3300003911 | JGI25405J52794_10036267 | JGI25405J52794_100362672 | 141 |
| 327 | 3300005290 | Ga0065712_10008628 | Ga0065712_100086282 | 141 |
| 328 | 3300005293 | Ga0065715_10125661 | Ga0065715_101256612 | 141 |
| 329 | 3300005293 | Ga0065715_10244344 | Ga0065715_102443442 | 141 |
| 330 | 3300005293 | Ga0065715_10571324 | Ga0065715_105713241 | 141 |
| 331 | 3300005295 | Ga0065707_10259690 | Ga0065707_102596902 | 141 |
| 332 | 3300005328 | Ga0070676_10004156 | Ga0070676_100041561 | 141 |
| 333 | 3300005328 | Ga0070676_10029047 | Ga0070676_100290472 | 141 |
| 334 | 3300005328 | Ga0070676_10681638 | Ga0070676_106816381 | 141 |
| 335 | 3300005329 | Ga0070683_100100763 | Ga0070683_1001007634 | 141 |
| 336 | 3300005330 | Ga0070690_100000599 | Ga0070690_1000005995 | 141 |
| 337 | 3300005330 | Ga0070690_100161692 | Ga0070690_1001616922 | 141 |
| 338 | 3300005330 | Ga0070690_100285694 | Ga0070690_1002856942 | 141 |
| 339 | 3300005331 | Ga0070670_100088623 | Ga0070670_1000886232 | 141 |
| 340 | 3300005334 | Ga0068869_100050795 | Ga0068869_1000507952 | 141 |
| 341 | 3300005334 | Ga0068869_100150934 | Ga0068869_1001509342 | 141 |
| 342 | 3300005334 | Ga0068869_100614009 | Ga0068869_1006140092 | 141 |
| 343 | 3300005335 | Ga0070666_10067559 | Ga0070666_100675596 | 141 |
| 344 | 3300005336 | Ga0070680_100012677 | Ga0070680_1000126774 | 141 |
| 345 | 3300005336 | Ga0070680_101458106 | Ga0070680_1014581061 | 141 |
| 346 | 3300005337 | Ga0070682_100073346 | Ga0070682_1000733461 | 141 |
| 347 | 3300005338 | Ga0068868_100176479 | Ga0068868_1001764792 | 141 |
| 348 | 3300005340 | Ga0070689_100036501 | Ga0070689_1000365016 | 141 |
| 349 | 3300005341 | Ga0070691_10187153 | Ga0070691_101871532 | 141 |
| 350 | 3300005343 | Ga0070687_100001696 | Ga0070687_10000169612 | 141 |
| 351 | 3300005343 | Ga0070687_100830263 | Ga0070687_1008302631 | 141 |
| 352 | 3300005344 | Ga0070661_100314878 | Ga0070661_1003148781 | 141 |
| 353 | 3300005347 | Ga0070668_100065443 | Ga0070668_1000654432 | 141 |
| 354 | 3300005347 | Ga0070668_100769900 | Ga0070668_1007699002 | 141 |
| 355 | 3300005353 | Ga0070669_100198254 | Ga0070669_1001982542 | 141 |
| 356 | 3300005354 | Ga0070675_100094928 | Ga0070675_1000949281 | 141 |
| 357 | 3300005354 | Ga0070675_100516493 | Ga0070675_1005164931 | 141 |
| 358 | 3300005354 | Ga0070675_100953101 | Ga0070675_1009531011 | 141 |
| 359 | 3300005355 | Ga0070671_100549325 | Ga0070671_1005493251 | 141 |
| 360 | 3300005356 | Ga0070674_100292029 | Ga0070674_1002920292 | 141 |
| 361 | 3300005364 | Ga0070673_100004650 | Ga0070673_1000046506 | 141 |
| 362 | 3300005364 | Ga0070673_100046048 | Ga0070673_1000460483 | 141 |
| 363 | 3300005364 | Ga0070673_100130869 | Ga0070673_1001308691 | 141 |
| 364 | 3300005364 | Ga0070673_100474562 | Ga0070673_1004745623 | 141 |
| 365 | 3300005365 | Ga0070688_100004390 | Ga0070688_1000043903 | 141 |
| 366 | 3300005365 | Ga0070688_100033351 | Ga0070688_1000333512 | 141 |
| 367 | 3300005365 | Ga0070688_100712628 | Ga0070688_1007126282 | 141 |
| 368 | 3300005367 | Ga0070667_100464141 | Ga0070667_1004641411 | 141 |
| 369 | 3300005367 | Ga0070667_100491684 | Ga0070667_1004916842 | 141 |
| 370 | 3300005406 | Ga0070703_10239648 | Ga0070703_102396481 | 141 |
| 371 | 3300005438 | Ga0070701_10719014 | Ga0070701_107190141 | 141 |
| 372 | 3300005438 | Ga0070701_10806121 | Ga0070701_108061211 | 141 |
| 373 | 3300005438 | Ga0070701_11172320 | Ga0070701_111723201 | 141 |
| 374 | 3300005440 | Ga0070705_100164723 | Ga0070705_1001647233 | 141 |
| 375 | 3300005440 | Ga0070705_100213782 | Ga0070705_1002137822 | 141 |
| 376 | 3300005440 | Ga0070705_100227464 | Ga0070705_1002274642 | 141 |
| 377 | 3300005441 | Ga0070700_100062776 | Ga0070700_1000627762 | 141 |
| 378 | 3300005441 | Ga0070700_101688730 | Ga0070700_1016887301 | 141 |
| 379 | 3300005444 | Ga0070694_100005880 | Ga0070694_1000058808 | 141 |
| 380 | 3300005444 | Ga0070694_100094648 | Ga0070694_1000946482 | 141 |
| 381 | 3300005444 | Ga0070694_100271900 | Ga0070694_1002719001 | 141 |
| 382 | 3300005444 | Ga0070694_100434248 | Ga0070694_1004342481 | 141 |
| 383 | 3300005445 | Ga0070708_100247272 | Ga0070708_1002472723 | 141 |
| 384 | 3300005445 | Ga0070708_101041012 | Ga0070708_1010410121 | 141 |
| 385 | 3300005457 | Ga0070662_100157604 | Ga0070662_1001576042 | 141 |
| 386 | 3300005466 | Ga0070685_10038440 | Ga0070685_100384404 | 141 |
| 387 | 3300005466 | Ga0070685_10136387 | Ga0070685_101363872 | 141 |
| 388 | 3300005466 | Ga0070685_10202802 | Ga0070685_102028022 | 141 |
| 389 | 3300005467 | Ga0070706_100235927 | Ga0070706_1002359272 | 141 |
| 390 | 3300005471 | Ga0070698_100208912 | Ga0070698_1002089122 | 141 |
| 391 | 3300005471 | Ga0070698_100271035 | Ga0070698_1002710352 | 141 |
| 392 | 3300005518 | Ga0070699_101306913 | Ga0070699_1013069131 | 141 |
| 393 | 3300005536 | Ga0070697_100125632 | Ga0070697_1001256322 | 141 |
| 394 | 3300005539 | Ga0068853_101284617 | Ga0068853_1012846172 | 141 |
| 395 | 3300005543 | Ga0070672_100024691 | Ga0070672_1000246916 | 141 |
| 396 | 3300005543 | Ga0070672_100038522 | Ga0070672_1000385222 | 141 |
| 397 | 3300005543 | Ga0070672_100044427 | Ga0070672_1000444272 | 141 |
| 398 | 3300005543 | Ga0070672_101477149 | Ga0070672_1014771491 | 141 |
| 399 | 3300005544 | Ga0070686_100002331 | Ga0070686_10000233110 | 141 |
| 400 | 3300005544 | Ga0070686_100170927 | Ga0070686_1001709273 | 141 |
| 401 | 3300005545 | Ga0070695_100221271 | Ga0070695_1002212711 | 141 |
| 402 | 3300005563 | Ga0068855_101108493 | Ga0068855_1011084932 | 141 |
| 403 | 3300005564 | Ga0070664_100038990 | Ga0070664_1000389905 | 141 |
| 404 | 3300005578 | Ga0068854_100233892 | Ga0068854_1002338922 | 141 |
| 405 | 3300005615 | Ga0070702_100772034 | Ga0070702_1007720341 | 141 |
| 406 | 3300005617 | Ga0068859_100028447 | Ga0068859_1000284475 | 141 |
| 407 | 3300005617 | Ga0068859_100088053 | Ga0068859_1000880535 | 141 |
| 408 | 3300005617 | Ga0068859_100242086 | Ga0068859_1002420862 | 141 |
| 409 | 3300005617 | Ga0068859_100548247 | Ga0068859_1005482473 | 141 |
| 410 | 3300005618 | Ga0068864_100390915 | Ga0068864_1003909151 | 141 |
| 411 | 3300005618 | Ga0068864_100571716 | Ga0068864_1005717162 | 141 |
| 412 | 3300005718 | Ga0068866_10238249 | Ga0068866_102382491 | 141 |
| 413 | 3300005719 | Ga0068861_100522719 | Ga0068861_1005227192 | 141 |
| 414 | 3300005719 | Ga0068861_100657520 | Ga0068861_1006575201 | 141 |
| 415 | 3300005834 | Ga0068851_10112572 | Ga0068851_101125722 | 141 |
| 416 | 3300005840 | Ga0068870_10007646 | Ga0068870_100076465 | 141 |
| 417 | 3300005841 | Ga0068863_100045685 | Ga0068863_1000456852 | 141 |
| 418 | 3300005841 | Ga0068863_100047258 | Ga0068863_1000472585 | 141 |
| 419 | 3300005841 | Ga0068863_100388678 | Ga0068863_1003886781 | 141 |
| 420 | 3300005841 | Ga0068863_100470856 | Ga0068863_1004708562 | 141 |
| 421 | 3300005842 | Ga0068858_100709379 | Ga0068858_1007093792 | 141 |
| 422 | 3300005843 | Ga0068860_100123788 | Ga0068860_1001237884 | 141 |
| 423 | 3300005843 | Ga0068860_100283909 | Ga0068860_1002839094 | 141 |
| 424 | 3300005844 | Ga0068862_100262870 | Ga0068862_1002628701 | 141 |
| 425 | 3300005844 | Ga0068862_100367579 | Ga0068862_1003675792 | 141 |
| 426 | 3300005937 | Ga0081455_10001030 | Ga0081455_1000103042 | 141 |
| 427 | 3300005983 | Ga0081540_1036911 | Ga0081540_10369112 | 141 |
| 428 | 3300005985 | Ga0081539_10002450 | Ga0081539_1000245010 | 141 |
| 429 | 3300006051 | Ga0075364_10180947 | Ga0075364_101809472 | 141 |
| 430 | 3300006173 | Ga0070716_100172065 | Ga0070716_1001720653 | 141 |
| 431 | 3300006237 | Ga0097621_100009709 | Ga0097621_1000097096 | 141 |
| 432 | 3300006237 | Ga0097621_100011882 | Ga0097621_1000118823 | 141 |
| 433 | 3300006237 | Ga0097621_100046664 | Ga0097621_1000466642 | 141 |
| 434 | 3300006358 | Ga0068871_100021047 | Ga0068871_1000210472 | 141 |
| 435 | 3300006358 | Ga0068871_100051771 | Ga0068871_1000517713 | 141 |
| 436 | 3300006358 | Ga0068871_100159179 | Ga0068871_1001591792 | 141 |
| 437 | 3300006358 | Ga0068871_100450349 | Ga0068871_1004503491 | 141 |
| 438 | 3300006844 | Ga0075428_100003681 | Ga0075428_10000368114 | 141 |
| 439 | 3300006844 | Ga0075428_100035723 | Ga0075428_1000357233 | 141 |
| 440 | 3300006844 | Ga0075428_100531066 | Ga0075428_1005310662 | 141 |
| 441 | 3300006844 | Ga0075428_100610036 | Ga0075428_1006100362 | 141 |
| 442 | 3300006844 | Ga0075428_100926858 | Ga0075428_1009268582 | 141 |
| 443 | 3300006846 | Ga0075430_100054073 | Ga0075430_1000540732 | 141 |
| 444 | 3300006846 | Ga0075430_100169372 | Ga0075430_1001693721 | 141 |
| 445 | 3300006846 | Ga0075430_100307069 | Ga0075430_1003070691 | 141 |
| 446 | 3300006846 | Ga0075430_101184670 | Ga0075430_1011846701 | 141 |
| 447 | 3300006847 | Ga0075431_100032939 | Ga0075431_1000329393 | 141 |
| 448 | 3300006852 | Ga0075433_10000073 | Ga0075433_1000007343 | 141 |
| 449 | 3300006852 | Ga0075433_10040245 | Ga0075433_100402454 | 141 |
| 450 | 3300006852 | Ga0075433_10168638 | Ga0075433_101686382 | 141 |
| 451 | 3300006852 | Ga0075433_10250034 | Ga0075433_102500342 | 141 |
| 452 | 3300006852 | Ga0075433_10350541 | Ga0075433_103505413 | 141 |
| 453 | 3300006852 | Ga0075433_10677621 | Ga0075433_106776212 | 141 |
| 454 | 3300006852 | Ga0075433_11265334 | Ga0075433_112653342 | 141 |
| 455 | 3300006871 | Ga0075434_100001311 | Ga0075434_10000131114 | 141 |
| 456 | 3300006871 | Ga0075434_100022086 | Ga0075434_1000220862 | 141 |
| 457 | 3300006871 | Ga0075434_100036222 | Ga0075434_1000362222 | 141 |
| 458 | 3300006871 | Ga0075434_100037538 | Ga0075434_1000375382 | 141 |
| 459 | 3300006871 | Ga0075434_100132287 | Ga0075434_1001322872 | 141 |
| 460 | 3300006871 | Ga0075434_101385548 | Ga0075434_1013855482 | 141 |
| 461 | 3300006880 | Ga0075429_100000215 | Ga0075429_10000021522 | 141 |
| 462 | 3300006880 | Ga0075429_100018873 | Ga0075429_1000188732 | 141 |
| 463 | 3300006880 | Ga0075429_100236193 | Ga0075429_1002361932 | 141 |
| 464 | 3300006881 | Ga0068865_100001852 | Ga0068865_1000018522 | 141 |
| 465 | 3300006881 | Ga0068865_100168591 | Ga0068865_1001685912 | 141 |
| 466 | 3300006881 | Ga0068865_101928325 | Ga0068865_1019283251 | 141 |
| 467 | 3300006914 | Ga0075436_100000482 | Ga0075436_10000048215 | 141 |
| 468 | 3300006914 | Ga0075436_100066008 | Ga0075436_1000660082 | 141 |
| 469 | 3300006914 | Ga0075436_100071991 | Ga0075436_1000719911 | 141 |
| 470 | 3300006914 | Ga0075436_100349046 | Ga0075436_1003490462 | 141 |
| 471 | 3300006914 | Ga0075436_100576912 | Ga0075436_1005769121 | 141 |
| 472 | 3300006931 | Ga0097620_100028446 | Ga0097620_1000284465 | 141 |
| 473 | 3300006931 | Ga0097620_100088055 | Ga0097620_1000880552 | 141 |
| 474 | 3300006931 | Ga0097620_100242081 | Ga0097620_1002420812 | 141 |
| 475 | 3300006931 | Ga0097620_100362429 | Ga0097620_1003624292 | 141 |
| 476 | 3300006931 | Ga0097620_100548231 | Ga0097620_1005482313 | 141 |
| 477 | 3300007076 | Ga0075435_100005423 | Ga0075435_1000054234 | 141 |
| 478 | 3300007076 | Ga0075435_100028232 | Ga0075435_1000282326 | 141 |
| 479 | 3300007076 | Ga0075435_100031014 | Ga0075435_1000310145 | 141 |
| 480 | 3300007076 | Ga0075435_100140957 | Ga0075435_1001409571 | 141 |
| 481 | 3300007076 | Ga0075435_100344822 | Ga0075435_1003448222 | 141 |
| 482 | 3300007788 | Ga0099795_10127966 | Ga0099795_101279662 | 141 |
| 483 | 3300009094 | Ga0111539_10064158 | Ga0111539_100641584 | 141 |
| 484 | 3300009094 | Ga0111539_10178155 | Ga0111539_101781553 | 141 |
| 485 | 3300009094 | Ga0111539_10479040 | Ga0111539_104790403 | 141 |
| 486 | 3300009147 | Ga0114129_10028415 | Ga0114129_100284155 | 141 |
| 487 | 3300009147 | Ga0114129_10098553 | Ga0114129_100985535 | 141 |
| 488 | 3300009147 | Ga0114129_11582188 | Ga0114129_115821882 | 141 |
| 489 | 3300009148 | Ga0105243_10159225 | Ga0105243_101592252 | 141 |
| 490 | 3300009176 | Ga0105242_10410676 | Ga0105242_104106762 | 141 |
| 491 | 3300009177 | Ga0105248_10145718 | Ga0105248_101457183 | 141 |
| 492 | 3300009545 | Ga0105237_10226768 | Ga0105237_102267683 | 141 |
| 493 | 3300009551 | Ga0105238_11051604 | Ga0105238_110516041 | 141 |
| 494 | 3300009553 | Ga0105249_12474405 | Ga0105249_124744051 | 141 |
| 495 | 3300010375 | Ga0105239_10008453 | Ga0105239_100084534 | 141 |
| 496 | 3300011119 | Ga0105246_11998978 | Ga0105246_119989781 | 141 |
| 497 | 3300012476 | Ga0157344_1001832 | Ga0157344_10018323 | 141 |
| 498 | 3300012478 | Ga0157328_1015418 | Ga0157328_10154181 | 141 |
| 499 | 3300013306 | Ga0163162_10234026 | Ga0163162_102340263 | 141 |
| 500 | 3300013306 | Ga0163162_10333896 | Ga0163162_103338962 | 141 |
| 501 | 3300013306 | Ga0163162_12210336 | Ga0163162_122103361 | 141 |
| 502 | 3300013308 | Ga0157375_10118672 | Ga0157375_101186722 | 141 |
| 503 | 3300014745 | Ga0157377_10000545 | Ga0157377_1000054511 | 141 |
| 504 | 3300014968 | Ga0157379_10186631 | Ga0157379_101866312 | 141 |
| 505 | 3300014968 | Ga0157379_10426844 | Ga0157379_104268442 | 141 |
| 506 | 3300014968 | Ga0157379_11668085 | Ga0157379_116680851 | 141 |
| 507 | 3300014969 | Ga0157376_10043024 | Ga0157376_100430242 | 141 |
| 508 | 3300014969 | Ga0157376_10053523 | Ga0157376_100535232 | 141 |
| 509 | 3300014969 | Ga0157376_10156196 | Ga0157376_101561963 | 141 |
| 510 | 3300017792 | Ga0163161_10133898 | Ga0163161_101338982 | 141 |
| 511 | 3300017792 | Ga0163161_10264877 | Ga0163161_102648772 | 141 |
| 512 | 3300020080 | Ga0206350_11406164 | Ga0206350_114061641 | 141 |
| 513 | 3300022467 | Ga0224712_10667778 | Ga0224712_106677781 | 141 |
| 514 | 3300025315 | Ga0207697_10022285 | Ga0207697_100222855 | 141 |
| 515 | 3300025321 | Ga0207656_10257223 | Ga0207656_102572232 | 141 |
| 516 | 3300025885 | Ga0207653_10262401 | Ga0207653_102624011 | 141 |
| 517 | 3300025900 | Ga0207710_10043834 | Ga0207710_100438342 | 141 |
| 518 | 3300025903 | Ga0207680_10584585 | Ga0207680_105845851 | 141 |
| 519 | 3300025905 | Ga0207685_10490033 | Ga0207685_104900331 | 141 |
| 520 | 3300025907 | Ga0207645_10022359 | Ga0207645_100223592 | 141 |
| 521 | 3300025908 | Ga0207643_10000709 | Ga0207643_100007096 | 141 |
| 522 | 3300025910 | Ga0207684_10297680 | Ga0207684_102976802 | 141 |
| 523 | 3300025910 | Ga0207684_10620840 | Ga0207684_106208402 | 141 |
| 524 | 3300025911 | Ga0207654_10140489 | Ga0207654_101404891 | 141 |
| 525 | 3300025917 | Ga0207660_10043580 | Ga0207660_100435802 | 141 |
| 526 | 3300025918 | Ga0207662_10000618 | Ga0207662_1000061822 | 141 |
| 527 | 3300025918 | Ga0207662_10501362 | Ga0207662_105013622 | 141 |
| 528 | 3300025918 | Ga0207662_11152092 | Ga0207662_111520922 | 141 |
| 529 | 3300025920 | Ga0207649_10303221 | Ga0207649_103032212 | 141 |
| 530 | 3300025923 | Ga0207681_10540432 | Ga0207681_105404321 | 141 |
| 531 | 3300025923 | Ga0207681_10713388 | Ga0207681_107133881 | 141 |
| 532 | 3300025925 | Ga0207650_10441236 | Ga0207650_104412362 | 141 |
| 533 | 3300025926 | Ga0207659_10148066 | Ga0207659_101480662 | 141 |
| 534 | 3300025926 | Ga0207659_10163481 | Ga0207659_101634811 | 141 |
| 535 | 3300025926 | Ga0207659_10323415 | Ga0207659_103234152 | 141 |
| 536 | 3300025928 | Ga0207700_10183763 | Ga0207700_101837632 | 141 |
| 537 | 3300025933 | Ga0207706_10135051 | Ga0207706_101350512 | 141 |
| 538 | 3300025933 | Ga0207706_10772357 | Ga0207706_107723572 | 141 |
| 539 | 3300025934 | Ga0207686_10006896 | Ga0207686_100068965 | 141 |
| 540 | 3300025934 | Ga0207686_10692363 | Ga0207686_106923631 | 141 |
| 541 | 3300025936 | Ga0207670_10016562 | Ga0207670_100165625 | 141 |
| 542 | 3300025938 | Ga0207704_10187589 | Ga0207704_101875892 | 141 |
| 543 | 3300025938 | Ga0207704_10637502 | Ga0207704_106375021 | 141 |
| 544 | 3300025938 | Ga0207704_11711013 | Ga0207704_117110131 | 141 |
| 545 | 3300025939 | Ga0207665_10084973 | Ga0207665_100849735 | 141 |
| 546 | 3300025939 | Ga0207665_10315165 | Ga0207665_103151653 | 141 |
| 547 | 3300025940 | Ga0207691_10006466 | Ga0207691_100064662 | 141 |
| 548 | 3300025940 | Ga0207691_10007979 | Ga0207691_100079794 | 141 |
| 549 | 3300025940 | Ga0207691_10184427 | Ga0207691_101844272 | 141 |
| 550 | 3300025940 | Ga0207691_11008885 | Ga0207691_110088851 | 141 |
| 551 | 3300025941 | Ga0207711_10134380 | Ga0207711_101343801 | 141 |
| 552 | 3300025941 | Ga0207711_10271360 | Ga0207711_102713602 | 141 |
| 553 | 3300025941 | Ga0207711_10642241 | Ga0207711_106422411 | 141 |
| 554 | 3300025942 | Ga0207689_10086940 | Ga0207689_100869402 | 141 |
| 555 | 3300025942 | Ga0207689_10114386 | Ga0207689_101143861 | 141 |
| 556 | 3300025942 | Ga0207689_10404098 | Ga0207689_104040981 | 141 |
| 557 | 3300025945 | Ga0207679_10017660 | Ga0207679_100176604 | 141 |
| 558 | 3300025949 | Ga0207667_11178314 | Ga0207667_111783142 | 141 |
| 559 | 3300025960 | Ga0207651_10015836 | Ga0207651_100158362 | 141 |
| 560 | 3300025960 | Ga0207651_10072954 | Ga0207651_100729545 | 141 |
| 561 | 3300025960 | Ga0207651_10166169 | Ga0207651_101661692 | 141 |
| 562 | 3300025960 | Ga0207651_10228337 | Ga0207651_102283372 | 141 |
| 563 | 3300025960 | Ga0207651_10731968 | Ga0207651_107319682 | 141 |
| 564 | 3300025961 | Ga0207712_10245038 | Ga0207712_102450384 | 141 |
| 565 | 3300025961 | Ga0207712_12026801 | Ga0207712_120268011 | 141 |
| 566 | 3300025972 | Ga0207668_10148459 | Ga0207668_101484592 | 141 |
| 567 | 3300025972 | Ga0207668_10681356 | Ga0207668_106813562 | 141 |
| 568 | 3300025981 | Ga0207640_10130985 | Ga0207640_101309852 | 141 |
| 569 | 3300025981 | Ga0207640_11146419 | Ga0207640_111464191 | 141 |
| 570 | 3300025986 | Ga0207658_10217921 | Ga0207658_102179212 | 141 |
| 571 | 3300025986 | Ga0207658_11024477 | Ga0207658_110244771 | 141 |
| 572 | 3300026023 | Ga0207677_10065248 | Ga0207677_100652482 | 141 |
| 573 | 3300026035 | Ga0207703_10990836 | Ga0207703_109908362 | 141 |
| 574 | 3300026067 | Ga0207678_10763403 | Ga0207678_107634032 | 141 |
| 575 | 3300026075 | Ga0207708_10071285 | Ga0207708_100712852 | 141 |
| 576 | 3300026075 | Ga0207708_11826332 | Ga0207708_118263321 | 141 |
| 577 | 3300026078 | Ga0207702_10192989 | Ga0207702_101929893 | 141 |
| 578 | 3300026078 | Ga0207702_10838689 | Ga0207702_108386892 | 141 |
| 579 | 3300026088 | Ga0207641_10012236 | Ga0207641_100122363 | 141 |
| 580 | 3300026088 | Ga0207641_10291046 | Ga0207641_102910462 | 141 |
| 581 | 3300026088 | Ga0207641_10785997 | Ga0207641_107859972 | 141 |
| 582 | 3300026088 | Ga0207641_10973959 | Ga0207641_109739591 | 141 |
| 583 | 3300026088 | Ga0207641_11124798 | Ga0207641_111247981 | 141 |
| 584 | 3300026089 | Ga0207648_10014351 | Ga0207648_100143512 | 141 |
| 585 | 3300026095 | Ga0207676_10780748 | Ga0207676_107807482 | 141 |
| 586 | 3300026118 | Ga0207675_100017050 | Ga0207675_10001705010 | 141 |
| 587 | 3300026118 | Ga0207675_100056084 | Ga0207675_1000560842 | 141 |
| 588 | 3300026118 | Ga0207675_100414116 | Ga0207675_1004141163 | 141 |
| 589 | 3300026118 | Ga0207675_100700063 | Ga0207675_1007000631 | 141 |
| 590 | 3300026121 | Ga0207683_10007997 | Ga0207683_100079973 | 141 |
| 591 | 3300027671 | Ga0209588_1098073 | Ga0209588_10980731 | 141 |
| 592 | 3300027695 | Ga0209966_1063471 | Ga0209966_10634712 | 141 |
| 593 | 3300027876 | Ga0209974_10042165 | Ga0209974_100421652 | 141 |
| 594 | 3300027907 | Ga0207428_10000954 | Ga0207428_1000095426 | 141 |
| 595 | 3300027907 | Ga0207428_10100472 | Ga0207428_101004722 | 141 |
| 596 | 3300027907 | Ga0207428_10146497 | Ga0207428_101464972 | 141 |
| 597 | 3300027907 | Ga0207428_10901134 | Ga0207428_109011341 | 141 |
| 598 | 3300028379 | Ga0268266_10162486 | Ga0268266_101624862 | 141 |
| 599 | 3300028379 | Ga0268266_10646821 | Ga0268266_106468212 | 141 |
| 600 | 3300028380 | Ga0268265_10116552 | Ga0268265_101165522 | 141 |
| 601 | 3300028380 | Ga0268265_10383638 | Ga0268265_103836382 | 141 |
| 602 | 3300028380 | Ga0268265_11051904 | Ga0268265_110519042 | 141 |
| 603 | 3300028381 | Ga0268264_10741028 | Ga0268264_107410282 | 141 |
| 604 | 3300028381 | Ga0268264_11297280 | Ga0268264_112972801 | 141 |
| 605 | 3300031456 | Ga0307513_10219268 | Ga0307513_102192682 | 141 |
| 606 | 3300031548 | Ga0307408_100178391 | Ga0307408_1001783912 | 141 |
| 607 | 3300031731 | Ga0307405_10023672 | Ga0307405_100236722 | 141 |
| 608 | 3300031824 | Ga0307413_10495922 | Ga0307413_104959222 | 141 |
| 609 | 3300031852 | Ga0307410_10299908 | Ga0307410_102999082 | 141 |
| 610 | 3300031852 | Ga0307410_10460347 | Ga0307410_104603471 | 141 |
| 611 | 3300031903 | Ga0307407_10008386 | Ga0307407_100083861 | 141 |
| 612 | 3300031911 | Ga0307412_10019557 | Ga0307412_100195575 | 141 |
| 613 | 3300031995 | Ga0307409_101432426 | Ga0307409_1014324262 | 141 |
| 614 | 3300032002 | Ga0307416_103181633 | Ga0307416_1031816331 | 141 |
| 615 | 3300032005 | Ga0307411_10570407 | Ga0307411_105704072 | 141 |
| 616 | 3300032005 | Ga0307411_10899827 | Ga0307411_108998271 | 141 |
| 617 | 3300032126 | Ga0307415_100006252 | Ga0307415_1000062523 | 141 |
| 618 | 3300032126 | Ga0307415_100414649 | Ga0307415_1004146491 | 141 |
| 619 | 3300034817 | Ga0373948_0040297 | Ga0373948_0040297_453_881 | 141 |
| 620 | 3300034820 | Ga0373959_0009330 | Ga0373959_0009330_782_1207 | 141 |
| 621 | 3300034957 | Ga0373938_0116778 | Ga0373938_0116778_64_495 | 141 |
| 622 | 3300034957 | Ga0373938_0174696 | Ga0373938_0174696_129_554 | 141 |
| 623 | 3300035083 | Ga0373926_0000409 | Ga0373926_0000409_10153_10578 | 141 |
| 624 | 3300035084 | Ga0373928_0025030 | Ga0373928_0025030_547_972 | 141 |
| 625 | 3300035089 | Ga0373944_0003780 | Ga0373944_0003780_661_1086 | 141 |
| 626 | 3300035090 | Ga0373949_0010419 | Ga0373949_0010419_1351_1776 | 141 |
| 627 | 3300035091 | Ga0373951_0074772 | Ga0373951_0074772_283_708 | 141 |
| 628 | 3300035092 | Ga0373952_0041229 | Ga0373952_0041229_287_712 | 141 |
| 629 | 3300035111 | Ga0373923_0168097 | Ga0373923_0168097_507_932 | 141 |
| 630 | 3300035113 | Ga0373936_0004563 | Ga0373936_0004563_1700_2125 | 141 |
| 631 | 3300035116 | Ga0373945_0046583 | Ga0373945_0046583_498_923 | 141 |
| 632 | 3300035119 | Ga0373956_0102621 | Ga0373956_0102621_874_1308 | 141 |
| 633 | 3300035121 | Ga0373960_0271586 | Ga0373960_0271586_160_585 | 141 |
| 634 | 3300035170 | Ga0373943_0022012 | Ga0373943_0022012_1098_1523 | 141 |
| 635 | 3300035171 | Ga0373946_0012659 | Ga0373946_0012659_2081_2506 | 141 |
| 636 | 3300035241 | Ga0373961_0101130 | Ga0373961_0101130_237_662 | 141 |
| 637 | 3300035241 | Ga0373961_0205366 | Ga0373961_0205366_241_666 | 141 |
| 638 | 3300035691 | Ga0373931_0002147 | Ga0373931_0002147_7154_7579 | 141 |
| 639 | 3300035691 | Ga0373931_0016493 | Ga0373931_0016493_891_1322 | 141 |
| 640 | 3300035692 | Ga0373935_0005086 | Ga0373935_0005086_796_1221 | 141 |
| 641 | 3300035692 | Ga0373935_0350572 | Ga0373935_0350572_255_686 | 141 |
| 642 | 3300035695 | Ga0373927_0010646 | Ga0373927_0010646_2927_3358 | 141 |
| 643 | 3300035695 | Ga0373927_0024715 | Ga0373927_0024715_2777_3202 | 141 |
| 644 | 3300035724 | Ga0373933_0208133 | Ga0373933_0208133_567_1001 | 141 |
| 645 | 3300035725 | Ga0373947_0030283 | Ga0373947_0030283_1245_1670 | 141 |
| 646 | 3300036401 | Ga0373937_0150728 | Ga0373937_0150728_1699_2133 | 141 |
| 647 | 3300037068 | Ga0373925_0058011 | Ga0373925_0058011_1753_2178 | 141 |
| 648 | 3300037471 | Ga0395905_0638387 | Ga0395905_0638387_104_529 | 141 |
| 649 | 3300037853 | Ga0436364_0248608 | Ga0436364_0248608_115_543 | 141 |
| 650 | 3300041509 | Ga0451843_1540712 | Ga0451843_1540712_435_869 | 141 |
| 651 | 3300042006 | Ga0439432_021174 | Ga0439432_021174_153_608 | 141 |
| 652 | 3300042010 | Ga0439452_006463 | Ga0439452_006463_110_604 | 141 |
| 653 | 3300042115 | Ga0450911_015214 | Ga0450911_015214_384_893 | 141 |
| 654 | 3300042144 | Ga0450889_012441 | Ga0450889_012441_327_782 | 141 |
| 655 | 3300042157 | Ga0439458_0064658 | Ga0439458_0064658_357_782 | 141 |
| 656 | 3300042185 | Ga0450909_012257 | Ga0450909_012257_75_530 | 141 |
| 657 | 3300042435 | Ga0439434_0275109 | Ga0439434_0275109_48_503 | 141 |
| 658 | 3300044656 | Ga0466969_0081471 | Ga0466969_0081471_39_470 | 141 |
| 659 | 3300044658 | Ga0466972_0097969 | Ga0466972_0097969_190_621 | 141 |
| 660 | 3300044672 | Ga0466982_0000005 | Ga0466982_0000005_288570_289001 | 141 |
| 661 | 3300044673 | Ga0453683_0000529 | Ga0453683_0000529_12533_12991 | 141 |
| 662 | 3300044673 | Ga0453683_0001459 | Ga0453683_0001459_6515_6943 | 141 |
| 663 | 3300044683 | Ga0466965_0056202 | Ga0466965_0056202_1104_1535 | 141 |
| 664 | 3300044706 | Ga0466964_0001996 | Ga0466964_0001996_2950_3381 | 141 |
| 665 | 3300044719 | Ga0466971_0082385 | Ga0466971_0082385_909_1340 | 141 |
| 666 | 3300044735 | Ga0466968_0008146 | Ga0466968_0008146_2016_2447 | 141 |
| 667 | 3300044765 | Ga0466970_0097259 | Ga0466970_0097259_318_749 | 141 |
| 668 | 3300044901 | Ga0466960_0076798 | Ga0466960_0076798_1163_1594 | 141 |
| 669 | 3300045836 | Ga0466958_0395935 | Ga0466958_0395935_289_720 | 141 |
| 670 | 3300046455 | Ga0495603_0000212 | Ga0495603_0000212_10967_11392 | 141 |
| 671 | 3300046472 | Ga0495580_0000358 | Ga0495580_0000358_22566_22991 | 141 |
| 672 | 3300046473 | Ga0495582_0031458 | Ga0495582_0031458_2289_2714 | 141 |
| 673 | 3300046473 | Ga0495582_0046513 | Ga0495582_0046513_937_1368 | 141 |
| 674 | 3300046473 | Ga0495582_0399202 | Ga0495582_0399202_198_626 | 141 |
| 675 | 3300046475 | Ga0495639_0072613 | Ga0495639_0072613_764_1189 | 141 |
| 676 | 3300046515 | Ga0495620_0060550 | Ga0495620_0060550_1127_1561 | 141 |
| 677 | 3300046517 | Ga0495630_0242434 | Ga0495630_0242434_854_1279 | 141 |
| 678 | 3300046517 | Ga0495630_0243415 | Ga0495630_0243415_26_457 | 141 |
| 679 | 3300046526 | Ga0495666_0010152 | Ga0495666_0010152_1115_1540 | 141 |
| 680 | 3300046531 | Ga0495665_0049976 | Ga0495665_0049976_695_1120 | 141 |
| 681 | 3300046535 | Ga0495586_0002478 | Ga0495586_0002478_7495_7920 | 141 |
| 682 | 3300046539 | Ga0495621_0047467 | Ga0495621_0047467_987_1421 | 141 |
| 683 | 3300046674 | Ga0495588_0012162 | Ga0495588_0012162_3491_3916 | 141 |
| 684 | 3300046681 | Ga0495647_0000536 | Ga0495647_0000536_7409_7834 | 141 |
| 685 | 3300046683 | Ga0495658_0005003 | Ga0495658_0005003_2209_2634 | 141 |
| 686 | 3300046683 | Ga0495658_0264285 | Ga0495658_0264285_565_996 | 141 |
| 687 | 3300046690 | Ga0495624_0152777 | Ga0495624_0152777_679_1104 | 141 |
| 688 | 3300047315 | Ga0495581_0081192 | Ga0495581_0081192_616_1041 | 141 |
| 689 | 3300047321 | Ga0495676_0046462 | Ga0495676_0046462_2345_2770 | 141 |
| 690 | 3300048089 | Ga0495614_0058177 | Ga0495614_0058177_164_595 | 141 |
| 691 | 3300048905 | Ga0496102_1089018 | Ga0496102_1089018_61_492 | 141 |
| 692 | 3300048918 | Ga0496115_0370511 | Ga0496115_0370511_391_819 | 141 |
| 693 | 3300048927 | Ga0496124_0968336 | Ga0496124_0968336_17_442 | 141 |
| 694 | 3300049514 | Ga0501291_000266 | Ga0501291_000266_1488_1943 | 141 |
| 695 | 3300049516 | Ga0501293_001210 | Ga0501293_001210_642_1097 | 141 |
| 696 | 3300049517 | Ga0501294_000272 | Ga0501294_000272_4640_5095 | 141 |
| 697 | 3300049518 | Ga0501295_000355 | Ga0501295_000355_2956_3411 | 141 |
| 698 | 3300049519 | Ga0501296_000249 | Ga0501296_000249_641_1096 | 141 |
| 699 | 3300049520 | Ga0501297_000119 | Ga0501297_000119_2797_3252 | 141 |
| 700 | 3300049521 | Ga0501298_000404 | Ga0501298_000404_4690_5145 | 141 |
| 701 | 3300049522 | Ga0501299_002574 | Ga0501299_002574_1937_2392 | 141 |
| 702 | 3300049524 | Ga0501301_000072 | Ga0501301_000072_908_1363 | 141 |
| 703 | 3300049526 | Ga0501303_000190 | Ga0501303_000190_3339_3794 | 141 |
| 704 | 3300049568 | Ga0501031_0060887 | Ga0501031_0060887_423_848 | 141 |
| 705 | 3300049572 | Ga0501036_0090339 | Ga0501036_0090339_1099_1524 | 141 |
| 706 | 3300049572 | Ga0501036_0442168 | Ga0501036_0442168_262_690 | 141 |
| 707 | 3300049573 | Ga0501037_0136629 | Ga0501037_0136629_608_1033 | 141 |
| 708 | 3300049573 | Ga0501037_0183944 | Ga0501037_0183944_37_462 | 141 |
| 709 | 3300049574 | Ga0501038_0046768 | Ga0501038_0046768_609_1037 | 141 |
| 710 | 3300049574 | Ga0501038_0996639 | Ga0501038_0996639_114_554 | 141 |
| 711 | 3300049576 | Ga0501040_0066320 | Ga0501040_0066320_1178_1603 | 141 |
| 712 | 3300049577 | Ga0501041_0056845 | Ga0501041_0056845_491_916 | 141 |
| 713 | 3300049578 | Ga0501042_0099137 | Ga0501042_0099137_1659_2084 | 141 |
| 714 | 3300049578 | Ga0501042_0102625 | Ga0501042_0102625_219_644 | 141 |
| 715 | 3300049578 | Ga0501042_1014448 | Ga0501042_1014448_56_481 | 141 |
| 716 | 3300049579 | Ga0501043_0007404 | Ga0501043_0007404_3620_4048 | 141 |
| 717 | 3300049579 | Ga0501043_0133932 | Ga0501043_0133932_1361_1786 | 141 |
| 718 | 3300049580 | Ga0501046_0045895 | Ga0501046_0045895_182_607 | 141 |
| 719 | 3300049582 | Ga0501048_0402553 | Ga0501048_0402553_139_564 | 141 |
| 720 | 3300049587 | Ga0501071_0025419 | Ga0501071_0025419_3005_3430 | 141 |
| 721 | 3300049588 | Ga0501072_0133466 | Ga0501072_0133466_479_904 | 141 |
| 722 | 3300049590 | Ga0501074_0057730 | Ga0501074_0057730_2304_2729 | 141 |
| 723 | 3300049591 | Ga0501075_0021118 | Ga0501075_0021118_661_1086 | 141 |
| 724 | 3300049592 | Ga0501076_0102105 | Ga0501076_0102105_511_936 | 141 |
| 725 | 3300049592 | Ga0501076_0451345 | Ga0501076_0451345_620_1045 | 141 |
| 726 | 3300049593 | Ga0501077_0007301 | Ga0501077_0007301_5887_6312 | 141 |
| 727 | 3300049651 | Ga0501201_000863 | Ga0501201_000863_1866_2321 | 141 |
| 728 | 3300049653 | Ga0501206_000236 | Ga0501206_000236_4807_5262 | 141 |
| 729 | 3300049660 | Ga0501216_000021 | Ga0501216_000021_9422_9877 | 141 |
| 730 | 3300049661 | Ga0501217_000668 | Ga0501217_000668_1456_1911 | 141 |
| 731 | 3300049665 | Ga0501227_002567 | Ga0501227_002567_3348_3803 | 141 |
| 732 | 3300049669 | Ga0501235_024165 | Ga0501235_024165_712_1167 | 141 |
| 733 | 3300049670 | Ga0501236_000687 | Ga0501236_000687_3075_3530 | 141 |
| 734 | 3300049672 | Ga0501239_004487 | Ga0501239_004487_317_772 | 141 |
| 735 | 3300049675 | Ga0501243_000326 | Ga0501243_000326_1074_1529 | 141 |
| 736 | 3300049676 | Ga0501246_005188 | Ga0501246_005188_399_854 | 141 |
| 737 | 3300049679 | Ga0501249_002439 | Ga0501249_002439_3188_3643 | 141 |
| 738 | 3300049684 | Ga0501255_009031 | Ga0501255_009031_193_648 | 141 |
| 739 | 3300049685 | Ga0501256_010259 | Ga0501256_010259_22_477 | 141 |
| 740 | 3300049686 | Ga0501257_022385 | Ga0501257_022385_522_977 | 141 |
| 741 | 3300049689 | Ga0501260_000007 | Ga0501260_000007_6704_7159 | 141 |
| 742 | 3300049690 | Ga0501261_000142 | Ga0501261_000142_1575_2030 | 141 |
| 743 | 3300049703 | Ga0501219_000423 | Ga0501219_000423_5817_6272 | 141 |
| 744 | 3300049706 | Ga0501229_006934 | Ga0501229_006934_48_503 | 141 |
| 745 | 3300049707 | Ga0501234_000680 | Ga0501234_000680_3932_4387 | 141 |
| 746 | 3300049708 | Ga0501245_000494 | Ga0501245_000494_907_1362 | 141 |
| 747 | 3300049741 | Ga0501079_0087970 | Ga0501079_0087970_1484_1909 | 141 |
| 748 | 3300049742 | Ga0501080_0062340 | Ga0501080_0062340_238_663 | 141 |
| 749 | 3300049743 | Ga0501081_0086840 | Ga0501081_0086840_737_1162 | 141 |
| 750 | 3300049743 | Ga0501081_0211011 | Ga0501081_0211011_274_699 | 141 |
| 751 | 3300049759 | Ga0501262_080416 | Ga0501262_080416_44_499 | 141 |
| 752 | 3300049765 | Ga0501268_001513 | Ga0501268_001513_444_899 | 141 |
| 753 | 3300049766 | Ga0501269_006189 | Ga0501269_006189_88_543 | 141 |
| 754 | 3300049769 | Ga0501272_000934 | Ga0501272_000934_1064_1519 | 141 |
| 755 | 3300049772 | Ga0501275_000840 | Ga0501275_000840_2580_3035 | 141 |
| 756 | 3300049773 | Ga0501276_000212 | Ga0501276_000212_2769_3224 | 141 |
| 757 | 3300049775 | Ga0501279_000060 | Ga0501279_000060_5934_6389 | 141 |
| 758 | 3300049777 | Ga0501281_02357 | Ga0501281_02357_844_1299 | 141 |
| 759 | 3300049778 | Ga0501282_003473 | Ga0501282_003473_88_543 | 141 |
| 760 | 3300049779 | Ga0501283_001137 | Ga0501283_001137_1808_2263 | 141 |
| 761 | 3300049822 | Ga0501035_0008804 | Ga0501035_0008804_4845_5273 | 141 |
| 762 | 3300049822 | Ga0501035_0350978 | Ga0501035_0350978_251_676 | 141 |
| 763 | 3300049823 | Ga0501044_0000384 | Ga0501044_0000384_14348_14776 | 141 |
| 764 | 3300049823 | Ga0501044_0149336 | Ga0501044_0149336_117_542 | 141 |
| 765 | 3300049824 | Ga0501045_0015931 | Ga0501045_0015931_956_1381 | 141 |
| 766 | 3300049824 | Ga0501045_0281768 | Ga0501045_0281768_26_451 | 141 |
| 767 | 3300049850 | Ga0501204_004265 | Ga0501204_004265_1024_1479 | 141 |
| 768 | 3300049851 | Ga0501212_000132 | Ga0501212_000132_2625_3080 | 141 |
| 769 | 3300050491 | nmdc:mga00v17_619917_c1 | nmdc:mga00v17_619917_c1_41_469 | 141 |
| 770 | 3300050507 | nmdc:mga05p37_4059_c1 | nmdc:mga05p37_4059_c1_11001_11426 | 141 |
| 771 | 3300050507 | nmdc:mga05p37_639490_c1 | nmdc:mga05p37_639490_c1_562_987 | 141 |
| 772 | 3300050507 | nmdc:mga05p37_92648_c1 | nmdc:mga05p37_92648_c1_2051_2476 | 141 |
| 773 | 3300050508 | nmdc:mga09592_2836_c1 | nmdc:mga09592_2836_c1_13162_13587 | 141 |
| 774 | 3300050509 | nmdc:mga0qj67_184272_c1 | nmdc:mga0qj67_184272_c1_818_1249 | 141 |
| 775 | 3300050510 | nmdc:mga06r32_786545_c1 | nmdc:mga06r32_786545_c1_443_868 | 141 |
| 776 | 3300050511 | nmdc:mga08y16_126897_c1 | nmdc:mga08y16_126897_c1_1124_1552 | 141 |
| 777 | 3300050511 | nmdc:mga08y16_189928_c1 | nmdc:mga08y16_189928_c1_836_1270 | 141 |
| 778 | 3300050511 | nmdc:mga08y16_2080321_c1 | nmdc:mga08y16_2080321_c1_23_457 | 141 |
| 779 | 3300050511 | nmdc:mga08y16_3676_c1 | nmdc:mga08y16_3676_c1_12530_12955 | 141 |
| 780 | 3300050511 | nmdc:mga08y16_53521_c1 | nmdc:mga08y16_53521_c1_2199_2624 | 141 |
| 781 | 3300050512 | nmdc:mga0n895_10980_c1 | nmdc:mga0n895_10980_c1_3121_3546 | 141 |
| 782 | 3300050512 | nmdc:mga0n895_1154944_c1 | nmdc:mga0n895_1154944_c1_35_460 | 141 |
| 783 | 3300050512 | nmdc:mga0n895_164_c1 | nmdc:mga0n895_164_c1_6197_6622 | 141 |
| 784 | 3300050513 | nmdc:mga0rr50_21387_c1 | nmdc:mga0rr50_21387_c1_2094_2519 | 141 |
| 785 | 3300050513 | nmdc:mga0rr50_299313_c1 | nmdc:mga0rr50_299313_c1_841_1269 | 141 |
| 786 | 3300050513 | nmdc:mga0rr50_79065_c1 | nmdc:mga0rr50_79065_c1_1174_1599 | 141 |
| 787 | 3300050514 | nmdc:mga08x19_28242_c1 | nmdc:mga08x19_28242_c1_1987_2412 | 141 |
| 788 | 3300050514 | nmdc:mga08x19_306992_c1 | nmdc:mga08x19_306992_c1_47_472 | 141 |
| 789 | 3300050514 | nmdc:mga08x19_441389_c1 | nmdc:mga08x19_441389_c1_286_720 | 141 |
| 790 | 3300050515 | nmdc:mga0a205_1332080_c1 | nmdc:mga0a205_1332080_c1_36_461 | 141 |
| 791 | 3300050515 | nmdc:mga0a205_23839_c1 | nmdc:mga0a205_23839_c1_1244_1669 | 141 |
| 792 | 3300050515 | nmdc:mga0a205_429349_c1 | nmdc:mga0a205_429349_c1_10_435 | 141 |
| 793 | 3300050515 | nmdc:mga0a205_58777_c1 | nmdc:mga0a205_58777_c1_1873_2298 | 141 |
| 794 | 3300050515 | nmdc:mga0a205_93_c1 | nmdc:mga0a205_93_c1_4864_5289 | 141 |
| 795 | 3300060353 | Ga0501082_0029705 | Ga0501082_0029705_3652_4077 | 141 |
| 796 | 3300060353 | Ga0501082_0113819 | Ga0501082_0113819_1871_2296 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7917 | 1 | 114 |
| 1s7i-assembly1.cif.gz_A-2 | 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa | 0.7262 | 1 | 114 |
| 2gqq-assembly1.cif.gz_A-2 | crystal structure of e. coli leucine-responsive regulatory protein (lrp) | 0.6778 | 2 | 114 |
| 3znj-assembly3.cif.gz_9 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.6748 | 1 | 114 |
| 3pht-assembly1.cif.gz_B-2 | crystal structure of h74a mutant of helicobacter pylori nikr | 0.6582 | 2 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7917 | 1 | 114 | 3.30.70.1060 |
| 1s7iA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.7262 | 1 | 114 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6656 | 1 | 114 | 3.30.70.1060 |
| 3phtA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 | 0.6641 | 2 | 113 | 3.30.70.1150 |
| af_O07243_108_202_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6465 | 2 | 117 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A852U2G1-F1-model_v4 | YCII-related domain-containing protein | 0.9731 | 1 | 139 |
|
| AF-A0A536M2Z6-F1-model_v4 | YciI family protein | 0.9653 | 1 | 118 |
|
| AF-A0A3C0XB99-F1-model_v4 | deleted | 0.9636 | 1 | 138 |
|
| AF-A0A848JG41-F1-model_v4 | deleted | 0.9598 | 1 | 137 |
|
| AF-A0A085W9M0-F1-model_v4 | PhnB protein | 0.9596 | 18 | 140 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar