F481172

General Info

Members Datasets Scaffolds Average Seq Length
796 309 1592 230

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100179264|Ga0070690_1001792642
Length 255
Sequence VESPKAIFWGYDAFGFLYSCCPMNSGLNGTGLVQIRDVHKYFTRGNERIDVLQGVNLEIPKGDFLALMGPSGSGKTTLLNLMGGLDAPTQGTVDVDGVQVSGLRGSTLSRWRSEHVGFVFQLYNLLPKLTASKNVELPLLLTRLSKSERRERAAIALKVVGLAERSKHYPSQLSGGQEQRVGIARAIVTDPTLLLCDEPTGDLDRKAGDEILDLLQALNRDHGKTIVMVTHDPRAAERARRTLHLDKGVLSGGAS

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
179 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
190 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
195 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
198 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
199 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
202 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
203 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
209 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
289 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
307 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
308 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
309 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 2.51
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 3.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100179264 3300005330 Bacteria 1463
2 Ga0055524_1001969 3300003775 Bacteria 11002
3 Ga0055531_10031061 3300003794 Bacteria 1777
4 Ga0065712_10081513 3300005290 Bacteria 3000
5 Ga0065712_10093661 3300005290 Bacteria 2283
6 Ga0065712_10099721 3300005290 Bacteria 2083
7 Ga0065712_10124477 3300005290 Bacteria 1625
8 Ga0065712_10277215 3300005290 Bacteria 903
9 Ga0065715_10002780 3300005293 Bacteria 4472
10 Ga0065715_10003861 3300005293 Bacteria 3956
11 Ga0065715_10114301 3300005293 Bacteria 2456
12 Ga0065707_10083643 3300005295 Bacteria 8559
13 Ga0065707_10174156 3300005295 Bacteria 1462
14 Ga0070683_100000042 3300005329 Bacteria 115507
15 Ga0070683_100013512 3300005329 Bacteria 7123
16 Ga0070683_100381619 3300005329 Bacteria 1343
17 Ga0070690_100039654 3300005330 Unclassified 2976
18 Ga0070690_100093224 3300005330 Bacteria 1986
19 Ga0070670_100000106 3300005331 Bacteria 77825
20 Ga0070670_100002059 3300005331 Bacteria 16467
21 Ga0070670_100018281 3300005331 Bacteria 6013
22 Ga0070670_100025879 3300005331 Bacteria 5048
23 Ga0070670_100054505 3300005331 Bacteria 3433
24 Ga0070677_10032608 3300005333 Bacteria 2000
25 Ga0070677_10206099 3300005333 Bacteria 952
26 Ga0068869_100331061 3300005334 Bacteria 1237
27 Ga0070666_10010930 3300005335 Bacteria 5688
28 Ga0070666_10021396 3300005335 Bacteria 4193
29 Ga0070680_100246668 3300005336 Bacteria 1510
30 Ga0068868_100002395 3300005338 Bacteria 12978
31 Ga0068868_100034627 3300005338 Unclassified 3899
32 Ga0068868_100035507 3300005338 Bacteria 3854
33 Ga0070660_100145896 3300005339 Bacteria 1901
34 Ga0070689_100062466 3300005340 Bacteria 2898
35 Ga0070689_100100538 3300005340 Bacteria 2288
36 Ga0070689_100111084 3300005340 Bacteria 2180
37 Ga0070689_100134159 3300005340 Bacteria 1987
38 Ga0070689_100203822 3300005340 Bacteria 1616
39 Ga0070689_100330171 3300005340 Bacteria 1275
40 Ga0070687_100021364 3300005343 Bacteria 3041
41 Ga0070687_100152499 3300005343 Bacteria 1358
42 Ga0070661_100006862 3300005344 Bacteria 7854
43 Ga0070661_100018554 3300005344 Bacteria 4948
44 Ga0070661_100026459 3300005344 Unclassified 4173
45 Ga0070661_100139993 3300005344 Bacteria 1823
46 Ga0070692_10052054 3300005345 Bacteria 2131
47 Ga0070692_10103690 3300005345 Bacteria 1563
48 Ga0070669_100000079 3300005353 Bacteria 94181
49 Ga0070669_100000352 3300005353 Bacteria 35915
50 Ga0070669_100046581 3300005353 Unclassified 3162
51 Ga0070669_100122821 3300005353 Bacteria 1984
52 Ga0070675_100000001 3300005354 Bacteria 448137
53 Ga0070675_100004922 3300005354 Bacteria 10185
54 Ga0070675_100006122 3300005354 Bacteria 9226
55 Ga0070675_100007440 3300005354 Bacteria 8457
56 Ga0070675_100039301 3300005354 Bacteria 3861
57 Ga0070675_100051071 3300005354 Bacteria 3397
58 Ga0070675_100076784 3300005354 Bacteria 2779
59 Ga0070675_100245594 3300005354 Bacteria 1565
60 Ga0070675_101065096 3300005354 Bacteria 743
61 Ga0070671_100008925 3300005355 Bacteria 8044
62 Ga0070671_100023335 3300005355 Bacteria 5063
63 Ga0070671_100047563 3300005355 Bacteria 3567
64 Ga0070671_100076777 3300005355 Bacteria 2791
65 Ga0070671_100189869 3300005355 Bacteria 1741
66 Ga0070674_100009971 3300005356 Bacteria 5718
67 Ga0070674_100011051 3300005356 Bacteria 5479
68 Ga0070673_100001367 3300005364 Bacteria 14268
69 Ga0070673_100003205 3300005364 Bacteria 10140
70 Ga0070673_100030373 3300005364 Bacteria 4042
71 Ga0070673_100048961 3300005364 Bacteria 3298
72 Ga0070673_100162097 3300005364 Bacteria 1902
73 Ga0070673_100405764 3300005364 Bacteria 1219
74 Ga0070673_100734867 3300005364 Bacteria 908
75 Ga0070673_100830083 3300005364 Bacteria 855
76 Ga0070688_100019592 3300005365 Bacteria 3922
77 Ga0070688_100022023 3300005365 Bacteria 3729
78 Ga0070659_100203078 3300005366 Bacteria 1632
79 Ga0070659_100304892 3300005366 Bacteria 1329
80 Ga0070667_100004279 3300005367 Bacteria 12054
81 Ga0070667_100029076 3300005367 Unclassified 4603
82 Ga0070701_10194652 3300005438 Bacteria 1195
83 Ga0070705_100017975 3300005440 Bacteria 3697
84 Ga0070700_100014388 3300005441 Bacteria 4468
85 Ga0070700_100280969 3300005441 Bacteria 1207
86 Ga0070700_100461401 3300005441 Bacteria 969
87 Ga0070694_100036289 3300005444 Bacteria 3265
88 Ga0070694_100039392 3300005444 Bacteria 3146
89 Ga0070694_100134705 3300005444 Bacteria 1789
90 Ga0070694_100134819 3300005444 Bacteria 1788
91 Ga0070708_100038536 3300005445 Bacteria 4176
92 Ga0070708_100313409 3300005445 Bacteria 1478
93 Ga0070708_100419031 3300005445 Bacteria 1263
94 Ga0070663_100011394 3300005455 Bacteria 5580
95 Ga0070663_100456886 3300005455 Bacteria 1054
96 Ga0070678_100065053 3300005456 Bacteria 2705
97 Ga0070678_100067758 3300005456 Bacteria 2658
98 Ga0070678_100265209 3300005456 Unclassified 1446
99 Ga0070678_100487521 3300005456 Bacteria 1086
100 Ga0070662_100038244 3300005457 Bacteria 3408
101 Ga0070662_100087624 3300005457 Bacteria 2331
102 Ga0068867_100007126 3300005459 Bacteria 7899
103 Ga0068867_100374948 3300005459 Bacteria 1194
104 Ga0070685_10141030 3300005466 Bacteria 1517
105 Ga0070706_100400914 3300005467 Bacteria 1277
106 Ga0070706_100606663 3300005467 Bacteria 1017
107 Ga0070706_100825146 3300005467 Bacteria 858
108 Ga0070707_100178740 3300005468 Bacteria 2069
109 Ga0070698_100034086 3300005471 Bacteria 5273
110 Ga0070699_100057487 3300005518 Bacteria 3369
111 Ga0070684_100003804 3300005535 Bacteria 11405
112 Ga0070684_100077166 3300005535 Bacteria 2942
113 Ga0070684_100189633 3300005535 Bacteria 1870
114 Ga0070684_100371093 3300005535 Bacteria 1317
115 Ga0070684_100650251 3300005535 Unclassified 981
116 Ga0070697_100330236 3300005536 Bacteria 1314
117 Ga0068853_100750185 3300005539 Bacteria 933
118 Ga0070672_100033785 3300005543 Bacteria 3876
119 Ga0070672_100063535 3300005543 Bacteria 2915
120 Ga0070672_100077528 3300005543 Bacteria 2658
121 Ga0070672_100112066 3300005543 Bacteria 2225
122 Ga0070672_100128677 3300005543 Unclassified 2079
123 Ga0070672_100166012 3300005543 Bacteria 1834
124 Ga0070672_100228134 3300005543 Bacteria 1564
125 Ga0070672_100305002 3300005543 Bacteria 1350
126 Ga0070686_100009135 3300005544 Bacteria 5560
127 Ga0070686_100013113 3300005544 Bacteria 4733
128 Ga0070686_100047589 3300005544 Bacteria 2712
129 Ga0070695_100038227 3300005545 Bacteria 3027
130 Ga0070696_100458069 3300005546 Bacteria 1008
131 Ga0070665_100010796 3300005548 Bacteria 9237
132 Ga0070665_100098357 3300005548 Bacteria 2931
133 Ga0070665_100125791 3300005548 Bacteria 2566
134 Ga0070665_100379039 3300005548 Bacteria 1422
135 Ga0070704_100013442 3300005549 Bacteria 5081
136 Ga0070704_100075239 3300005549 Bacteria 2466
137 Ga0070704_100191979 3300005549 Bacteria 1642
138 Ga0070704_100266210 3300005549 Bacteria 1414
139 Ga0070704_100332067 3300005549 Bacteria 1277
140 Ga0070664_100000148 3300005564 Bacteria 48402
141 Ga0070664_100037016 3300005564 Bacteria 4101
142 Ga0070664_100043063 3300005564 Bacteria 3809
143 Ga0070664_100048355 3300005564 Bacteria 3594
144 Ga0070664_100057923 3300005564 Bacteria 3295
145 Ga0070664_100613017 3300005564 Bacteria 1010
146 Ga0068857_100072447 3300005577 Bacteria 3070
147 Ga0068857_100310021 3300005577 Bacteria 1456
148 Ga0068854_100007288 3300005578 Bacteria 7066
149 Ga0068854_100020349 3300005578 Bacteria 4488
150 Ga0070702_100092341 3300005615 Bacteria 1838
151 Ga0068852_100246464 3300005616 Bacteria 1710
152 Ga0068852_100288671 3300005616 Bacteria 1584
153 Ga0068852_100401027 3300005616 Unclassified 1349
154 Ga0068852_100567444 3300005616 Bacteria 1136
155 Ga0068859_100000730 3300005617 Bacteria 33081
156 Ga0068859_100001253 3300005617 Bacteria 25918
157 Ga0068859_100004160 3300005617 Bacteria 14782
158 Ga0068859_100019164 3300005617 Bacteria 6872
159 Ga0068859_100048438 3300005617 Unclassified 4269
160 Ga0068859_100115166 3300005617 Bacteria 2753
161 Ga0068859_100576696 3300005617 Bacteria 1219
162 Ga0068864_100001111 3300005618 Bacteria 22488
163 Ga0068864_100059716 3300005618 Bacteria 3300
164 Ga0068864_100235921 3300005618 Bacteria 1693
165 Ga0068861_100035542 3300005719 Bacteria 3691
166 Ga0068861_100041140 3300005719 Bacteria 3461
167 Ga0068861_100393482 3300005719 Bacteria 1228
168 Ga0068870_10230756 3300005840 Bacteria 1138
169 Ga0068863_100001362 3300005841 Bacteria 24306
170 Ga0068863_100010302 3300005841 Bacteria 9083
171 Ga0068863_100037072 3300005841 Bacteria 4643
172 Ga0068863_100058745 3300005841 Bacteria 3639
173 Ga0068863_100081935 3300005841 Bacteria 3057
174 Ga0068858_100012237 3300005842 Bacteria 8090
175 Ga0068858_100020020 3300005842 Bacteria 6257
176 Ga0068858_100087658 3300005842 Bacteria 2895
177 Ga0068858_100320404 3300005842 Bacteria 1481
178 Ga0068858_100539558 3300005842 Bacteria 1129
179 Ga0068860_100052578 3300005843 Unclassified 3874
180 Ga0068860_100144875 3300005843 Bacteria 2285
181 Ga0068860_100156576 3300005843 Bacteria 2196
182 Ga0068862_100005826 3300005844 Bacteria 10270
183 Ga0068862_100038990 3300005844 Bacteria 4033
184 Ga0068862_100048126 3300005844 Bacteria 3640
185 Ga0068862_100083158 3300005844 Bacteria 2780
186 Ga0068862_100453834 3300005844 Bacteria 1209
187 Ga0068862_100689333 3300005844 Bacteria 989
188 Ga0075365_10397150 3300006038 Bacteria 973
189 Ga0075364_10012696 3300006051 Bacteria 5162
190 Ga0075364_10161518 3300006051 Bacteria 1512
191 Ga0075364_10261403 3300006051 Bacteria 1176
192 Ga0075362_10000313 3300006177 Bacteria 13796
193 Ga0075367_10306023 3300006178 Bacteria 1001
194 Ga0075366_10014167 3300006195 Bacteria 4551
195 Ga0075366_10023155 3300006195 Bacteria 3618
196 Ga0097621_100004376 3300006237 Bacteria 9826
197 Ga0097621_100157055 3300006237 Bacteria 1953
198 Ga0097621_100158962 3300006237 Bacteria 1941
199 Ga0097621_100280449 3300006237 Unclassified 1467
200 Ga0097621_100334987 3300006237 Bacteria 1343
201 Ga0097621_100709217 3300006237 Bacteria 927
202 Ga0097621_100864447 3300006237 Bacteria 841
203 Ga0075370_10006516 3300006353 Bacteria 5876
204 Ga0075370_10007605 3300006353 Bacteria 5526
205 Ga0075370_10248759 3300006353 Bacteria 1053
206 Ga0068871_100007126 3300006358 Bacteria 7971
207 Ga0068871_100042839 3300006358 Bacteria 3636
208 Ga0068871_100082573 3300006358 Bacteria 2665
209 Ga0068871_100147982 3300006358 Bacteria 2001
210 Ga0068871_100164251 3300006358 Bacteria 1900
211 Ga0075428_100000037 3300006844 Bacteria 105391
212 Ga0075428_100018816 3300006844 Bacteria 7636
213 Ga0075428_100020380 3300006844 Bacteria 7343
214 Ga0075428_100029147 3300006844 Bacteria 6108
215 Ga0075428_100034386 3300006844 Bacteria 5590
216 Ga0075428_100045009 3300006844 Bacteria 4849
217 Ga0075428_100217069 3300006844 Bacteria 2066
218 Ga0075428_100356603 3300006844 Unclassified 1569
219 Ga0075430_100005281 3300006846 Bacteria 10896
220 Ga0075431_100027919 3300006847 Bacteria 5792
221 Ga0075431_100034807 3300006847 Bacteria 5187
222 Ga0075431_100141648 3300006847 Bacteria 2478
223 Ga0075431_100188169 3300006847 Bacteria 2116
224 Ga0075431_100273616 3300006847 Bacteria 1711
225 Ga0075431_100371551 3300006847 Bacteria 1435
226 Ga0075431_100793222 3300006847 Bacteria 921
227 Ga0075433_10042971 3300006852 Bacteria 3922
228 Ga0075433_10056218 3300006852 Bacteria 3436
229 Ga0075433_10291328 3300006852 Bacteria 1446
230 Ga0075433_10358165 3300006852 Bacteria 1289
231 Ga0075434_100008145 3300006871 Bacteria 9718
232 Ga0075434_100095802 3300006871 Bacteria 2973
233 Ga0075434_100122000 3300006871 Bacteria 2622
234 Ga0075434_100213462 3300006871 Bacteria 1950
235 Ga0075434_100531960 3300006871 Bacteria 1196
236 Ga0075429_100055286 3300006880 Bacteria 3454
237 Ga0075429_100079981 3300006880 Bacteria 2849
238 Ga0075429_100646318 3300006880 Bacteria 927
239 Ga0075429_100780411 3300006880 Bacteria 837
240 Ga0068865_100120591 3300006881 Bacteria 1949
241 Ga0068865_100174080 3300006881 Bacteria 1652
242 Ga0068865_100185931 3300006881 Bacteria 1603
243 Ga0068865_100321465 3300006881 Bacteria 1245
244 Ga0068865_100459870 3300006881 Bacteria 1054
245 Ga0097620_100000730 3300006931 Bacteria 33081
246 Ga0097620_100001253 3300006931 Bacteria 25918
247 Ga0097620_100004160 3300006931 Bacteria 14782
248 Ga0097620_100019164 3300006931 Bacteria 6872
249 Ga0097620_100048437 3300006931 Unclassified 4269
250 Ga0097620_100115169 3300006931 Bacteria 2753
251 Ga0097620_100576724 3300006931 Bacteria 1219
252 Ga0075435_100002073 3300007076 Bacteria 13146
253 Ga0075435_100029137 3300007076 Bacteria 4332
254 Ga0075435_100214336 3300007076 Bacteria 1634
255 Ga0075435_100338579 3300007076 Bacteria 1289
256 Ga0105251_10108087 3300009011 Bacteria 1268
257 Ga0105244_10036238 3300009036 Bacteria 2585
258 Ga0105240_10704064 3300009093 Bacteria 1102
259 Ga0111539_10000009 3300009094 Bacteria 375223
260 Ga0111539_10000903 3300009094 Bacteria 38809
261 Ga0111539_10001488 3300009094 Bacteria 31294
262 Ga0111539_10003033 3300009094 Bacteria 22262
263 Ga0111539_10011244 3300009094 Bacteria 11245
264 Ga0111539_10012029 3300009094 Bacteria 10853
265 Ga0111539_10031342 3300009094 Bacteria 6458
266 Ga0111539_10032600 3300009094 Bacteria 6325
267 Ga0111539_10039368 3300009094 Bacteria 5699
268 Ga0111539_10068398 3300009094 Bacteria 4193
269 Ga0111539_10169126 3300009094 Bacteria 2554
270 Ga0111539_10256734 3300009094 Bacteria 2035
271 Ga0111539_10335215 3300009094 Bacteria 1761
272 Ga0111539_10725762 3300009094 Bacteria 1157
273 Ga0111539_10754500 3300009094 Bacteria 1132
274 Ga0111539_11331442 3300009094 Bacteria 833
275 Ga0105245_10044929 3300009098 Bacteria 3944
276 Ga0105245_10353971 3300009098 Bacteria 1456
277 Ga0114129_10003220 3300009147 Bacteria 22906
278 Ga0114129_10006116 3300009147 Bacteria 17071
279 Ga0114129_10027070 3300009147 Bacteria 8119
280 Ga0114129_10111060 3300009147 Bacteria 3783
281 Ga0114129_10396635 3300009147 Bacteria 1819
282 Ga0114129_10532161 3300009147 Bacteria 1531
283 Ga0114129_10746439 3300009147 Bacteria 1253
284 Ga0105243_10483302 3300009148 Bacteria 1169
285 Ga0105243_10648206 3300009148 Bacteria 1023
286 Ga0105242_10266104 3300009176 Bacteria 1551
287 Ga0105242_10317172 3300009176 Bacteria 1428
288 Ga0105242_10389523 3300009176 Bacteria 1297
289 Ga0105248_10000871 3300009177 Bacteria 33809
290 Ga0105248_10002102 3300009177 Bacteria 22067
291 Ga0105248_10093407 3300009177 Bacteria 3388
292 Ga0105248_10158107 3300009177 Bacteria 2557
293 Ga0105248_10160789 3300009177 Bacteria 2533
294 Ga0105248_10614648 3300009177 Bacteria 1226
295 Ga0105249_10000496 3300009553 Bacteria 36369
296 Ga0105249_10057297 3300009553 Bacteria 3569
297 Ga0105249_10405464 3300009553 Bacteria 1394
298 Ga0105239_10064374 3300010375 Bacteria 4025
299 Ga0105239_10473946 3300010375 Bacteria 1422
300 Ga0157319_1000003 3300012497 Bacteria 397199
301 Ga0157369_10000242 3300013105 Bacteria 75791
302 Ga0157374_10159996 3300013296 Bacteria 2193
303 Ga0157374_10404307 3300013296 Bacteria 1363
304 Ga0157374_10452733 3300013296 Bacteria 1285
305 Ga0157374_10472867 3300013296 Bacteria 1256
306 Ga0163162_10001234 3300013306 Bacteria 23888
307 Ga0163162_10015719 3300013306 Bacteria 7396
308 Ga0163162_10307719 3300013306 Bacteria 1717
309 Ga0163162_10874120 3300013306 Bacteria 1013
310 Ga0157375_10000079 3300013308 Bacteria 97385
311 Ga0157375_10000800 3300013308 Bacteria 27590
312 Ga0157375_10001681 3300013308 Bacteria 19042
313 Ga0157375_10047704 3300013308 Bacteria 4185
314 Ga0157375_10098239 3300013308 Bacteria 3004
315 Ga0157375_10219470 3300013308 Bacteria 2060
316 Ga0157375_10224430 3300013308 Bacteria 2038
317 Ga0163163_10002587 3300014325 Bacteria 15326
318 Ga0163163_10007336 3300014325 Bacteria 9724
319 Ga0163163_10009037 3300014325 Bacteria 8877
320 Ga0163163_10009686 3300014325 Bacteria 8620
321 Ga0163163_10016511 3300014325 Bacteria 6864
322 Ga0163163_10026534 3300014325 Bacteria 5539
323 Ga0163163_10202628 3300014325 Bacteria 2033
324 Ga0157380_10007242 3300014326 Bacteria 7868
325 Ga0157380_10007698 3300014326 Bacteria 7666
326 Ga0157380_10014305 3300014326 Bacteria 5805
327 Ga0157380_10028557 3300014326 Bacteria 4255
328 Ga0157380_10164562 3300014326 Bacteria 1931
329 Ga0157380_10182367 3300014326 Bacteria 1846
330 Ga0157380_10248903 3300014326 Bacteria 1607
331 Ga0157380_10299528 3300014326 Bacteria 1480
332 Ga0157380_10370381 3300014326 Bacteria 1348
333 Ga0157377_10014878 3300014745 Bacteria 3969
334 Ga0157379_10000641 3300014968 Bacteria 28223
335 Ga0157379_10010897 3300014968 Bacteria 7925
336 Ga0157376_10000013 3300014969 Bacteria 304287
337 Ga0157376_10163660 3300014969 Bacteria 2019
338 Ga0157376_10333447 3300014969 Bacteria 1446
339 Ga0157376_10337148 3300014969 Bacteria 1439
340 Ga0163161_10179772 3300017792 Bacteria 1621
341 Ga0163161_10623757 3300017792 Unclassified 891
342 Ga0209256_1000675 3300025299 Bacteria 46128
343 Ga0209257_1018212 3300025304 Bacteria 2717
344 Ga0207697_10005451 3300025315 Bacteria 5916
345 Ga0207697_10019761 3300025315 Bacteria 2759
346 Ga0207655_1048297 3300025728 Bacteria 1748
347 Ga0207682_10047779 3300025893 Bacteria 1763
348 Ga0207642_10294384 3300025899 Bacteria 938
349 Ga0207688_10013023 3300025901 Bacteria 4523
350 Ga0207688_10223547 3300025901 Bacteria 1135
351 Ga0207680_10004493 3300025903 Bacteria 6618
352 Ga0207680_10019383 3300025903 Bacteria 3637
353 Ga0207680_10060696 3300025903 Bacteria 2303
354 Ga0207680_10067438 3300025903 Bacteria 2204
355 Ga0207680_10582676 3300025903 Bacteria 800
356 Ga0207647_10044949 3300025904 Bacteria 2757
357 Ga0207645_10008258 3300025907 Bacteria 7278
358 Ga0207645_10209631 3300025907 Bacteria 1283
359 Ga0207645_10215956 3300025907 Bacteria 1264
360 Ga0207643_10121273 3300025908 Bacteria 1549
361 Ga0207684_10198667 3300025910 Bacteria 1730
362 Ga0207660_10215351 3300025917 Bacteria 1505
363 Ga0207662_10009917 3300025918 Bacteria 5255
364 Ga0207662_10123462 3300025918 Bacteria 1626
365 Ga0207649_10003486 3300025920 Bacteria 8594
366 Ga0207649_10071689 3300025920 Bacteria 2214
367 Ga0207649_10122147 3300025920 Unclassified 1757
368 Ga0207646_10269307 3300025922 Bacteria 1540
369 Ga0207681_10000057 3300025923 Bacteria 104729
370 Ga0207681_10072641 3300025923 Bacteria 2404
371 Ga0207681_10078701 3300025923 Bacteria 2321
372 Ga0207681_10252365 3300025923 Bacteria 1378
373 Ga0207650_10000165 3300025925 Bacteria 80255
374 Ga0207650_10005623 3300025925 Bacteria 8562
375 Ga0207650_10006899 3300025925 Bacteria 7744
376 Ga0207650_10017945 3300025925 Bacteria 4959
377 Ga0207650_10029209 3300025925 Bacteria 3961
378 Ga0207650_10121412 3300025925 Bacteria 2035
379 Ga0207650_10207584 3300025925 Bacteria 1572
380 Ga0207650_10320173 3300025925 Bacteria 1270
381 Ga0207659_10000004 3300025926 Bacteria 476977
382 Ga0207659_10000354 3300025926 Bacteria 27376
383 Ga0207659_10026495 3300025926 Bacteria 3912
384 Ga0207659_10038555 3300025926 Bacteria 3325
385 Ga0207659_10049798 3300025926 Bacteria 2973
386 Ga0207659_10161888 3300025926 Bacteria 1758
387 Ga0207659_10189713 3300025926 Bacteria 1635
388 Ga0207659_10311778 3300025926 Bacteria 1296
389 Ga0207687_10308184 3300025927 Bacteria 1277
390 Ga0207644_10008669 3300025931 Bacteria 6652
391 Ga0207644_10010812 3300025931 Bacteria 6024
392 Ga0207690_10105033 3300025932 Bacteria 2025
393 Ga0207706_10030693 3300025933 Bacteria 4793
394 Ga0207706_10144003 3300025933 Bacteria 2097
395 Ga0207706_10145922 3300025933 Bacteria 2081
396 Ga0207706_10284333 3300025933 Bacteria 1442
397 Ga0207686_10408273 3300025934 Bacteria 1036
398 Ga0207670_10046884 3300025936 Bacteria 2874
399 Ga0207670_10241877 3300025936 Bacteria 1391
400 Ga0207669_10013739 3300025937 Bacteria 4035
401 Ga0207669_10097410 3300025937 Bacteria 1934
402 Ga0207669_10273282 3300025937 Bacteria 1270
403 Ga0207669_10356995 3300025937 Bacteria 1131
404 Ga0207669_10365107 3300025937 Bacteria 1120
405 Ga0207669_10645508 3300025937 Bacteria 865
406 Ga0207704_10102249 3300025938 Bacteria 1913
407 Ga0207704_10276360 3300025938 Bacteria 1274
408 Ga0207704_10390982 3300025938 Bacteria 1094
409 Ga0207691_10001855 3300025940 Bacteria 20651
410 Ga0207691_10004774 3300025940 Bacteria 13109
411 Ga0207691_10021118 3300025940 Bacteria 6151
412 Ga0207691_10042877 3300025940 Bacteria 4171
413 Ga0207691_10046970 3300025940 Unclassified 3965
414 Ga0207691_10156953 3300025940 Bacteria 1998
415 Ga0207691_10302596 3300025940 Bacteria 1374
416 Ga0207691_10324092 3300025940 Bacteria 1321
417 Ga0207711_10002301 3300025941 Bacteria 17135
418 Ga0207711_10046122 3300025941 Bacteria 3723
419 Ga0207711_10063848 3300025941 Unclassified 3180
420 Ga0207711_10220346 3300025941 Bacteria 1735
421 Ga0207711_10330588 3300025941 Bacteria 1409
422 Ga0207689_10015764 3300025942 Bacteria 6398
423 Ga0207689_10343926 3300025942 Bacteria 1239
424 Ga0207689_10380307 3300025942 Bacteria 1175
425 Ga0207661_10000002 3300025944 Bacteria 816104
426 Ga0207661_10002465 3300025944 Bacteria 12712
427 Ga0207679_10001834 3300025945 Bacteria 13220
428 Ga0207679_10006162 3300025945 Bacteria 7577
429 Ga0207679_10013725 3300025945 Bacteria 5312
430 Ga0207679_10017709 3300025945 Bacteria 4758
431 Ga0207679_10039123 3300025945 Bacteria 3385
432 Ga0207679_10096003 3300025945 Bacteria 2305
433 Ga0207651_10001825 3300025960 Bacteria 9920
434 Ga0207651_10008182 3300025960 Bacteria 5632
435 Ga0207651_10025366 3300025960 Bacteria 3683
436 Ga0207651_10031371 3300025960 Unclassified 3396
437 Ga0207651_10049926 3300025960 Bacteria 2838
438 Ga0207651_10791916 3300025960 Bacteria 840
439 Ga0207712_10015782 3300025961 Bacteria 4879
440 Ga0207712_10087131 3300025961 Bacteria 2289
441 Ga0207712_10556880 3300025961 Bacteria 987
442 Ga0207640_10036047 3300025981 Bacteria 3102
443 Ga0207640_10430501 3300025981 Bacteria 1082
444 Ga0207658_10029190 3300025986 Unclassified 3892
445 Ga0207658_10044430 3300025986 Bacteria 3235
446 Ga0207658_10058794 3300025986 Unclassified 2862
447 Ga0207658_10128286 3300025986 Bacteria 2033
448 Ga0207677_10000216 3300026023 Bacteria 45897
449 Ga0207677_10036668 3300026023 Bacteria 3198
450 Ga0207677_10587423 3300026023 Unclassified 976
451 Ga0207703_10024164 3300026035 Bacteria 4782
452 Ga0207703_10060506 3300026035 Bacteria 3097
453 Ga0207703_10268977 3300026035 Bacteria 1543
454 Ga0207678_10014697 3300026067 Bacteria 6888
455 Ga0207678_10308873 3300026067 Bacteria 1359
456 Ga0207708_10001705 3300026075 Bacteria 16254
457 Ga0207708_10016438 3300026075 Bacteria 5564
458 Ga0207708_10294205 3300026075 Bacteria 1319
459 Ga0207708_10315368 3300026075 Bacteria 1275
460 Ga0207641_10004263 3300026088 Bacteria 12444
461 Ga0207641_10012780 3300026088 Bacteria 6882
462 Ga0207641_10047796 3300026088 Bacteria 3610
463 Ga0207641_10094690 3300026088 Unclassified 2619
464 Ga0207648_10006098 3300026089 Bacteria 12021
465 Ga0207648_10064088 3300026089 Bacteria 3203
466 Ga0207648_10342950 3300026089 Bacteria 1345
467 Ga0207648_10501003 3300026089 Bacteria 1111
468 Ga0207676_10003402 3300026095 Bacteria 11242
469 Ga0207676_10032125 3300026095 Bacteria 3953
470 Ga0207676_10219134 3300026095 Bacteria 1693
471 Ga0207676_10219756 3300026095 Bacteria 1691
472 Ga0207674_10163710 3300026116 Bacteria 2178
473 Ga0207675_100007017 3300026118 Bacteria 10648
474 Ga0207675_100020921 3300026118 Bacteria 6099
475 Ga0207675_100035297 3300026118 Bacteria 4664
476 Ga0207675_100102252 3300026118 Bacteria 2700
477 Ga0207683_10030381 3300026121 Bacteria 4681
478 Ga0207683_10212868 3300026121 Unclassified 1759
479 Ga0207683_10493135 3300026121 Bacteria 1131
480 Ga0207698_10324118 3300026142 Bacteria 1444
481 Ga0207698_10511056 3300026142 Bacteria 1171
482 Ga0207698_10599292 3300026142 Bacteria 1086
483 Ga0209974_10078087 3300027876 Bacteria 1136
484 Ga0207428_10000005 3300027907 Bacteria 520045
485 Ga0207428_10000568 3300027907 Bacteria 43738
486 Ga0207428_10004204 3300027907 Bacteria 13791
487 Ga0207428_10024582 3300027907 Bacteria 5058
488 Ga0207428_10092841 3300027907 Bacteria 2342
489 Ga0207428_10436492 3300027907 Bacteria 956
490 Ga0268266_10024012 3300028379 Bacteria 5188
491 Ga0268266_10024657 3300028379 Bacteria 5118
492 Ga0268266_10097764 3300028379 Bacteria 2582
493 Ga0268265_10055591 3300028380 Bacteria 3008
494 Ga0268265_10345994 3300028380 Bacteria 1356
495 Ga0268265_10570033 3300028380 Bacteria 1077
496 Ga0268264_10065596 3300028381 Unclassified 3060
497 Ga0268264_10225872 3300028381 Bacteria 1726
498 Ga0268264_10356186 3300028381 Bacteria 1394
499 Ga0268264_10511824 3300028381 Bacteria 1172
500 Ga0268264_10512851 3300028381 Bacteria 1171
501 Ga0265334_10000017 3300028573 Bacteria 147461
502 Ga0265334_10041821 3300028573 Bacteria 1789
503 Ga0265323_10024447 3300028653 Bacteria 2296
504 Ga0265323_10100680 3300028653 Bacteria 957
505 Ga0265338_10065636 3300028800 Bacteria 3146
506 Ga0265338_10090248 3300028800 Bacteria 2536
507 Ga0265320_10008212 3300031240 Bacteria 6408
508 Ga0265325_10087697 3300031241 Bacteria 1538
509 Ga0265325_10173465 3300031241 Bacteria 1008
510 Ga0265339_10272784 3300031249 Bacteria 813
511 Ga0307513_10079143 3300031456 Bacteria 3397
512 Ga0307408_100022502 3300031548 Bacteria 4284
513 Ga0307408_100163139 3300031548 Bacteria 1772
514 Ga0265313_10000022 3300031595 Bacteria 144838
515 Ga0265342_10145098 3300031712 Bacteria 1322
516 Ga0316576_10006774 3300031727 Bacteria 7161
517 Ga0316576_10504323 3300031727 Bacteria 890
518 Ga0316578_10005535 3300031728 Bacteria 6138
519 Ga0307405_10174177 3300031731 Bacteria 1538
520 Ga0316577_10006137 3300031733 Bacteria 6332
521 Ga0307413_10311487 3300031824 Bacteria 1198
522 Ga0307410_10053961 3300031852 Bacteria 2722
523 Ga0307412_10517839 3300031911 Bacteria 996
524 Ga0307409_100013922 3300031995 Bacteria 5204
525 Ga0307409_100091946 3300031995 Bacteria 2488
526 Ga0307409_100424037 3300031995 Bacteria 1277
527 Ga0307409_100810867 3300031995 Bacteria 944
528 Ga0307416_100089111 3300032002 Bacteria 2640
529 Ga0307416_100094423 3300032002 Bacteria 2579
530 Ga0307416_100567833 3300032002 Bacteria 1210
531 Ga0307414_10074166 3300032004 Bacteria 2464
532 Ga0307414_10074714 3300032004 Bacteria 2457
533 Ga0307411_10300791 3300032005 Bacteria 1286
534 Ga0307411_10509601 3300032005 Bacteria 1019
535 Ga0307415_100033726 3300032126 Bacteria 3325
536 Ga0307415_100243839 3300032126 Bacteria 1455
537 Ga0373930_0012746 3300034816 Bacteria 1539
538 Ga0373958_0059899 3300034819 Bacteria 823
539 Ga0373941_0059942 3300035115 Bacteria 1236
540 Ga0373957_0243558 3300035120 Bacteria 756
541 Ga0373955_0128080 3300035172 Bacteria 1480
542 Ga0373942_0028317 3300035207 Bacteria 1464
543 Ga0373931_0023167 3300035691 Bacteria 3134
544 Ga0373931_0032552 3300035691 Bacteria 2698
545 Ga0373931_0138970 3300035691 Bacteria 1405
546 Ga0373931_0275113 3300035691 Bacteria 1032
547 Ga0373927_0000003 3300035695 Bacteria 480348
548 Ga0373933_0142146 3300035724 Bacteria 1516
549 Ga0373947_0072245 3300035725 Bacteria 2118
550 Ga0373937_0013564 3300036401 Bacteria 7180
551 Ga0373937_0020595 3300036401 Bacteria 5912
552 Ga0373937_0281186 3300036401 Bacteria 1571
553 Ga0373937_0389684 3300036401 Bacteria 1322
554 Ga0373937_0414719 3300036401 Bacteria 1278
555 Ga0373937_0796327 3300036401 Bacteria 893
556 Ga0316582_0454069 3300036647 Bacteria 883
557 Ga0436365_1577364 3300039437 Bacteria 1306
558 Ga0439439_0030178 3300041406 Bacteria 1378
559 Ga0439453_0037390 3300041408 Bacteria 941
560 Ga0451807_1856419 3300041486 Bacteria 2573
561 Ga0451853_0964787 3300041512 Bacteria 1160
562 Ga0439433_0003363 3300041999 Bacteria 3428
563 Ga0439443_017857 3300042003 Bacteria 1095
564 Ga0439445_0005455 3300042004 Bacteria 2899
565 Ga0439449_0085024 3300042007 Bacteria 1167
566 Ga0439454_000320 3300042011 Bacteria 3615
567 Ga0439462_0013654 3300042015 Bacteria 2083
568 Ga0450920_004981 3300042122 Bacteria 2351
569 Ga0450923_013751 3300042125 Bacteria 1491
570 Ga0450890_002413 3300042127 Bacteria 2573
571 Ga0450891_009103 3300042129 Bacteria 913
572 Ga0450910_023820 3300042147 Bacteria 937
573 Ga0439446_0041151 3300042156 Bacteria 1361
574 Ga0450908_013985 3300042184 Bacteria 1446
575 Ga0439434_0021455 3300042435 Bacteria 1940
576 Ga0439434_0023446 3300042435 Bacteria 1859
577 Ga0439435_0008748 3300042436 Bacteria 2356
578 Ga0439435_0010796 3300042436 Bacteria 2178
579 Ga0439435_0045987 3300042436 Bacteria 1235
580 Ga0439444_0062535 3300042437 Bacteria 780
581 Ga0439459_0000956 3300042438 Bacteria 4089
582 Ga0439460_0043810 3300042461 Bacteria 1323
583 Ga0451577_0117122 3300042876 Bacteria 2386
584 Ga0451577_0119951 3300042876 Bacteria 2356
585 Ga0451577_0200736 3300042876 Bacteria 1800
586 Ga0466972_0000761 3300044658 Bacteria 15355
587 Ga0453683_0002405 3300044673 Bacteria 14587
588 Ga0466963_0168562 3300044694 Bacteria 1526
589 Ga0453684_0224882 3300044712 Bacteria 2171
590 Ga0466970_0000395 3300044765 Bacteria 21174
591 Ga0451576_0286892 3300045051 Bacteria 1721
592 Ga0451576_0573836 3300045051 Bacteria 1185
593 Ga0466967_0411990 3300045976 Bacteria 1316
594 Ga0495592_0097221 3300046454 Unclassified 2103
595 Ga0495629_0088266 3300046459 Unclassified 2163
596 Ga0495638_0027130 3300046460 Bacteria 3709
597 Ga0495653_0021717 3300046463 Bacteria 5197
598 Ga0495580_0209635 3300046472 Bacteria 1341
599 Ga0495639_0146008 3300046475 Bacteria 1139
600 Ga0495662_0120649 3300046476 Bacteria 1287
601 Ga0495664_0090131 3300046477 Bacteria 1844
602 Ga0495630_0271195 3300046517 Bacteria 1296
603 Ga0495630_0343836 3300046517 Bacteria 1142
604 Ga0495663_0104911 3300046525 Bacteria 934
605 Ga0495586_0046163 3300046535 Bacteria 2349
606 Ga0495621_0016551 3300046539 Bacteria 2369
607 Ga0495621_0038637 3300046539 Bacteria 1666
608 Ga0495645_0305369 3300046543 Bacteria 1038
609 Ga0495667_0000608 3300046559 Bacteria 22865
610 Ga0495634_0047086 3300046642 Bacteria 2907
611 Ga0495625_0257403 3300046660 Bacteria 1131
612 Ga0495588_0002127 3300046674 Bacteria 8492
613 Ga0495657_0051670 3300046675 Bacteria 2759
614 Ga0495613_0033719 3300046689 Bacteria 3802
615 Ga0495613_0049988 3300046689 Bacteria 3084
616 Ga0495613_0154417 3300046689 Bacteria 1636
617 Ga0495581_0179712 3300047315 Bacteria 1237
618 Ga0495636_0005933 3300047318 Bacteria 4794
619 Ga0495674_0061417 3300047319 Bacteria 3275
620 Ga0495674_0146670 3300047319 Bacteria 1981
621 Ga0495684_0167312 3300047471 Bacteria 1637
622 Ga0496101_0030320 3300048904 Bacteria 3790
623 Ga0496102_0039221 3300048905 Bacteria 4279
624 Ga0496103_0041591 3300048906 Bacteria 2826
625 Ga0496104_0019742 3300048907 Bacteria 6170
626 Ga0496104_0049688 3300048907 Bacteria 3955
627 Ga0496104_0227608 3300048907 Bacteria 1777
628 Ga0496105_0019256 3300048908 Bacteria 5504
629 Ga0496108_0004765 3300048911 Bacteria 10936
630 Ga0496108_0411139 3300048911 Bacteria 1182
631 Ga0496109_0002159 3300048912 Bacteria 16355
632 Ga0496109_0349488 3300048912 Bacteria 1397
633 Ga0496109_0450305 3300048912 Bacteria 1216
634 Ga0496110_0005001 3300048913 Bacteria 10359
635 Ga0496110_0511020 3300048913 Bacteria 1093
636 Ga0496112_0008524 3300048915 Bacteria 9185
637 Ga0496112_0170467 3300048915 Bacteria 2142
638 Ga0496114_0000887 3300048917 Bacteria 22393
639 Ga0496114_0144428 3300048917 Bacteria 2062
640 Ga0496114_0911465 3300048917 Bacteria 760
641 Ga0496117_0038598 3300048920 Bacteria 3536
642 Ga0496118_0000081 3300048921 Bacteria 188525
643 Ga0496119_0019622 3300048922 Bacteria 4967
644 Ga0496120_0001425 3300048923 Bacteria 28835
645 Ga0496121_0139496 3300048924 Bacteria 1801
646 Ga0501032_0022553 3300049569 Bacteria 4363
647 Ga0501033_0196083 3300049570 Bacteria 1444
648 Ga0501033_0538791 3300049570 Bacteria 805
649 Ga0501034_0137613 3300049571 Bacteria 2422
650 Ga0501034_0540365 3300049571 Bacteria 1075
651 Ga0501036_0007622 3300049572 Bacteria 8834
652 Ga0501036_0020175 3300049572 Bacteria 5597
653 Ga0501036_0307513 3300049572 Bacteria 1325
654 Ga0501037_0024369 3300049573 Bacteria 4475
655 Ga0501037_0304797 3300049573 Bacteria 1105
656 Ga0501037_0322986 3300049573 Bacteria 1068
657 Ga0501038_0026213 3300049574 Bacteria 5192
658 Ga0501038_0110184 3300049574 Bacteria 2281
659 Ga0501038_0277144 3300049574 Bacteria 1321
660 Ga0501039_0047974 3300049575 Bacteria 3301
661 Ga0501039_0052637 3300049575 Bacteria 3149
662 Ga0501039_0212431 3300049575 Bacteria 1521
663 Ga0501040_0058482 3300049576 Bacteria 2647
664 Ga0501040_0087737 3300049576 Bacteria 2160
665 Ga0501041_0002625 3300049577 Bacteria 10251
666 Ga0501041_0022490 3300049577 Bacteria 3775
667 Ga0501041_0226775 3300049577 Bacteria 1173
668 Ga0501042_0058335 3300049578 Bacteria 2755
669 Ga0501042_0375327 3300049578 Bacteria 1029
670 Ga0501042_0391775 3300049578 Bacteria 1006
671 Ga0501043_0001782 3300049579 Bacteria 18506
672 Ga0501043_0048649 3300049579 Bacteria 3333
673 Ga0501043_0095041 3300049579 Bacteria 2343
674 Ga0501043_0393769 3300049579 Bacteria 1047
675 Ga0501046_0086054 3300049580 Bacteria 2423
676 Ga0501046_0098898 3300049580 Bacteria 2240
677 Ga0501047_0000865 3300049581 Bacteria 30926
678 Ga0501047_0356991 3300049581 Bacteria 1298
679 Ga0501047_0387992 3300049581 Bacteria 1230
680 Ga0501048_0020667 3300049582 Bacteria 4826
681 Ga0501048_0102687 3300049582 Bacteria 2017
682 Ga0501048_0122736 3300049582 Bacteria 1836
683 Ga0501067_0043573 3300049583 Bacteria 2492
684 Ga0501068_0010418 3300049584 Bacteria 5224
685 Ga0501069_0006934 3300049585 Bacteria 5922
686 Ga0501070_0024792 3300049586 Bacteria 5031
687 Ga0501070_0112546 3300049586 Bacteria 2249
688 Ga0501070_0142573 3300049586 Bacteria 1978
689 Ga0501070_0761630 3300049586 Bacteria 762
690 Ga0501071_0029562 3300049587 Bacteria 3869
691 Ga0501071_0497378 3300049587 Bacteria 935
692 Ga0501071_0554476 3300049587 Bacteria 883
693 Ga0501072_0014179 3300049588 Bacteria 6107
694 Ga0501072_0019383 3300049588 Bacteria 5258
695 Ga0501072_0064923 3300049588 Bacteria 2878
696 Ga0501072_0477287 3300049588 Bacteria 987
697 Ga0501072_0506492 3300049588 Bacteria 955
698 Ga0501073_0065028 3300049589 Bacteria 2543
699 Ga0501073_0095526 3300049589 Bacteria 2064
700 Ga0501073_0106015 3300049589 Bacteria 1950
701 Ga0501075_0003759 3300049591 Bacteria 10195
702 Ga0501075_0095428 3300049591 Bacteria 2257
703 Ga0501075_0185268 3300049591 Bacteria 1588
704 Ga0501075_0674818 3300049591 Bacteria 788
705 Ga0501076_0000962 3300049592 Bacteria 18840
706 Ga0501076_0139731 3300049592 Bacteria 1967
707 Ga0501076_0454294 3300049592 Bacteria 1055
708 Ga0501076_0462467 3300049592 Bacteria 1045
709 Ga0501076_0526783 3300049592 Bacteria 974
710 Ga0501079_0004334 3300049741 Bacteria 10529
711 Ga0501079_0047107 3300049741 Bacteria 3326
712 Ga0501080_0083953 3300049742 Bacteria 2959
713 Ga0501080_0426684 3300049742 Bacteria 1190
714 Ga0501080_0474637 3300049742 Bacteria 1119
715 Ga0501080_0557207 3300049742 Bacteria 1020
716 Ga0501081_0001658 3300049743 Bacteria 13780
717 Ga0501081_0643858 3300049743 Bacteria 794
718 Ga0501083_0001802 3300049744 Bacteria 14660
719 Ga0501083_0011137 3300049744 Bacteria 6313
720 Ga0501083_0012210 3300049744 Bacteria 6011
721 Ga0501083_0255741 3300049744 Bacteria 1140
722 Ga0501083_0400883 3300049744 Bacteria 892
723 Ga0501045_0026758 3300049824 Bacteria 4152
724 Ga0501045_0271496 3300049824 Bacteria 1263
725 Ga0501045_0301509 3300049824 Bacteria 1192
726 nmdc:mga03683_892_c1 3300050489 Bacteria 8582
727 nmdc:mga03n38_165751_c1 3300050490 Bacteria 1122
728 nmdc:mga00v17_2680_c1 3300050491 Bacteria 9132
729 nmdc:mga00v17_62875_c1 3300050491 Bacteria 2285
730 nmdc:mga0yw44_440032_c1 3300050492 Bacteria 883
731 nmdc:mga0k408_2394_c1 3300050493 Bacteria 9974
732 nmdc:mga0k408_3448_c1 3300050493 Bacteria 2593
733 nmdc:mga0k408_46825_c1 3300050493 Bacteria 2498
734 nmdc:mga06z11_384201_c1 3300050494 Bacteria 844
735 nmdc:mga04h51_12745_c1 3300050495 Bacteria 2367
736 nmdc:mga07m45_111507_c1 3300050496 Bacteria 1576
737 nmdc:mga07m45_245953_c1 3300050496 Bacteria 1041
738 nmdc:mga07m45_96768_c1 3300050496 Bacteria 1694
739 nmdc:mga05p37_11087_c1 3300050507 Bacteria 9192
740 nmdc:mga05p37_18046_c1 3300050507 Bacteria 8523
741 nmdc:mga05p37_19797_c1 3300050507 Bacteria 8142
742 nmdc:mga05p37_259068_c1 3300050507 Bacteria 2082
743 nmdc:mga05p37_3545_c1 3300050507 Bacteria 18216
744 nmdc:mga09592_207770_c1 3300050508 Bacteria 1696
745 nmdc:mga09592_40435_c1 3300050508 Bacteria 3917
746 nmdc:mga09592_59727_c1 3300050508 Bacteria 3223
747 nmdc:mga09592_91244_c1 3300050508 Bacteria 2603
748 nmdc:mga0qj67_55945_c1 3300050509 Bacteria 3126
749 nmdc:mga0qj67_9396_c1 3300050509 Bacteria 7275
750 nmdc:mga06r32_154161_c1 3300050510 Bacteria 2277
751 nmdc:mga06r32_308080_c1 3300050510 Bacteria 1569
752 nmdc:mga06r32_388030_c1 3300050510 Bacteria 1379
753 nmdc:mga06r32_425506_c1 3300050510 Bacteria 1309
754 nmdc:mga06r32_590246_c1 3300050510 Bacteria 1082
755 nmdc:mga06r32_69217_c1 3300050510 Bacteria 3410
756 nmdc:mga08y16_110973_c1 3300050511 Bacteria 2855
757 nmdc:mga08y16_136005_c1 3300050511 Bacteria 2554
758 nmdc:mga08y16_205847_c1 3300050511 Bacteria 2039
759 nmdc:mga08y16_2143_c1 3300050511 Bacteria 20249
760 nmdc:mga08y16_27240_c1 3300050511 Bacteria 6022
761 nmdc:mga08y16_273571_c1 3300050511 Bacteria 1743
762 nmdc:mga08y16_4721_c1 3300050511 Bacteria 14202
763 nmdc:mga08y16_530028_c1 3300050511 Bacteria 1194
764 nmdc:mga08y16_734061_c1 3300050511 Bacteria 985
765 nmdc:mga08y16_764157_c1 3300050511 Bacteria 962
766 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
767 nmdc:mga0n895_12303_c1 3300050512 Bacteria 7670
768 nmdc:mga0n895_38507_c1 3300050512 Bacteria 4633
769 nmdc:mga0n895_399911_c1 3300050512 Bacteria 1389
770 nmdc:mga0n895_44349_c1 3300050512 Bacteria 4336
771 nmdc:mga0n895_542302_c1 3300050512 Bacteria 1169
772 nmdc:mga0n895_7442_c1 3300050512 Bacteria 9395
773 nmdc:mga0rr50_101822_c1 3300050513 Bacteria 2258
774 nmdc:mga0rr50_198186_c1 3300050513 Bacteria 1649
775 nmdc:mga0rr50_6394_c1 3300050513 Bacteria 7166
776 nmdc:mga0a205_10361_c1 3300050515 Bacteria 8567
777 nmdc:mga0a205_181447_c1 3300050515 Bacteria 1999
778 nmdc:mga0a205_24010_c1 3300050515 Bacteria 5789
779 nmdc:mga0a205_319546_c1 3300050515 Bacteria 1424
780 nmdc:mga0a205_334112_c1 3300050515 Bacteria 1385
781 Ga0495601_0267660 3300053077 Bacteria 1115
782 Ga0495595_0025157 3300053084 Bacteria 2636
783 Ga0495619_0050696 3300053085 Bacteria 2741
784 Ga0501084_0008882 3300054114 Bacteria 8314
785 Ga0501084_0009049 3300054114 Bacteria 8239
786 Ga0501084_0009934 3300054114 Bacteria 7868
787 Ga0501084_0382260 3300054114 Bacteria 1190
788 Ga0501082_0000427 3300060353 Bacteria 37290
789 Ga0501082_0066095 3300060353 Bacteria 3113
790 Ga0501082_0153743 3300060353 Bacteria 1999
791 Ga0501082_0637408 3300060353 Bacteria 932
792 Ga0530510_0006502 3300061734 Bacteria 8136
793 Ga0530510_0006569 3300061734 Bacteria 8105
794 2525556562 2524614729 Bacteria 3091755
795 2630649791 2627854209 Bacteria 3093011
796 2886850252 2886848708 Bacteria 5632523
797 Ga0070690_100179264
798 Ga0055524_1001969
799 Ga0055531_10031061
800 Ga0065712_10081513
801 Ga0065712_10093661
802 Ga0065712_10099721
803 Ga0065712_10124477
804 Ga0065712_10277215
805 Ga0065715_10002780
806 Ga0065715_10003861
807 Ga0065715_10114301
808 Ga0065707_10083643
809 Ga0065707_10174156
810 Ga0070683_100000042
811 Ga0070683_100013512
812 Ga0070683_100381619
813 Ga0070690_100039654
814 Ga0070690_100093224
815 Ga0070670_100000106
816 Ga0070670_100002059
817 Ga0070670_100018281
818 Ga0070670_100025879
819 Ga0070670_100054505
820 Ga0070677_10032608
821 Ga0070677_10206099
822 Ga0068869_100331061
823 Ga0070666_10010930
824 Ga0070666_10021396
825 Ga0070680_100246668
826 Ga0068868_100002395
827 Ga0068868_100034627
828 Ga0068868_100035507
829 Ga0070660_100145896
830 Ga0070689_100062466
831 Ga0070689_100100538
832 Ga0070689_100111084
833 Ga0070689_100134159
834 Ga0070689_100203822
835 Ga0070689_100330171
836 Ga0070687_100021364
837 Ga0070687_100152499
838 Ga0070661_100006862
839 Ga0070661_100018554
840 Ga0070661_100026459
841 Ga0070661_100139993
842 Ga0070692_10052054
843 Ga0070692_10103690
844 Ga0070669_100000079
845 Ga0070669_100000352
846 Ga0070669_100046581
847 Ga0070669_100122821
848 Ga0070675_100000001
849 Ga0070675_100004922
850 Ga0070675_100006122
851 Ga0070675_100007440
852 Ga0070675_100039301
853 Ga0070675_100051071
854 Ga0070675_100076784
855 Ga0070675_100245594
856 Ga0070675_101065096
857 Ga0070671_100008925
858 Ga0070671_100023335
859 Ga0070671_100047563
860 Ga0070671_100076777
861 Ga0070671_100189869
862 Ga0070674_100009971
863 Ga0070674_100011051
864 Ga0070673_100001367
865 Ga0070673_100003205
866 Ga0070673_100030373
867 Ga0070673_100048961
868 Ga0070673_100162097
869 Ga0070673_100405764
870 Ga0070673_100734867
871 Ga0070673_100830083
872 Ga0070688_100019592
873 Ga0070688_100022023
874 Ga0070659_100203078
875 Ga0070659_100304892
876 Ga0070667_100004279
877 Ga0070667_100029076
878 Ga0070701_10194652
879 Ga0070705_100017975
880 Ga0070700_100014388
881 Ga0070700_100280969
882 Ga0070700_100461401
883 Ga0070694_100036289
884 Ga0070694_100039392
885 Ga0070694_100134705
886 Ga0070694_100134819
887 Ga0070708_100038536
888 Ga0070708_100313409
889 Ga0070708_100419031
890 Ga0070663_100011394
891 Ga0070663_100456886
892 Ga0070678_100065053
893 Ga0070678_100067758
894 Ga0070678_100265209
895 Ga0070678_100487521
896 Ga0070662_100038244
897 Ga0070662_100087624
898 Ga0068867_100007126
899 Ga0068867_100374948
900 Ga0070685_10141030
901 Ga0070706_100400914
902 Ga0070706_100606663
903 Ga0070706_100825146
904 Ga0070707_100178740
905 Ga0070698_100034086
906 Ga0070699_100057487
907 Ga0070684_100003804
908 Ga0070684_100077166
909 Ga0070684_100189633
910 Ga0070684_100371093
911 Ga0070684_100650251
912 Ga0070697_100330236
913 Ga0068853_100750185
914 Ga0070672_100033785
915 Ga0070672_100063535
916 Ga0070672_100077528
917 Ga0070672_100112066
918 Ga0070672_100128677
919 Ga0070672_100166012
920 Ga0070672_100228134
921 Ga0070672_100305002
922 Ga0070686_100009135
923 Ga0070686_100013113
924 Ga0070686_100047589
925 Ga0070695_100038227
926 Ga0070696_100458069
927 Ga0070665_100010796
928 Ga0070665_100098357
929 Ga0070665_100125791
930 Ga0070665_100379039
931 Ga0070704_100013442
932 Ga0070704_100075239
933 Ga0070704_100191979
934 Ga0070704_100266210
935 Ga0070704_100332067
936 Ga0070664_100000148
937 Ga0070664_100037016
938 Ga0070664_100043063
939 Ga0070664_100048355
940 Ga0070664_100057923
941 Ga0070664_100613017
942 Ga0068857_100072447
943 Ga0068857_100310021
944 Ga0068854_100007288
945 Ga0068854_100020349
946 Ga0070702_100092341
947 Ga0068852_100246464
948 Ga0068852_100288671
949 Ga0068852_100401027
950 Ga0068852_100567444
951 Ga0068859_100000730
952 Ga0068859_100001253
953 Ga0068859_100004160
954 Ga0068859_100019164
955 Ga0068859_100048438
956 Ga0068859_100115166
957 Ga0068859_100576696
958 Ga0068864_100001111
959 Ga0068864_100059716
960 Ga0068864_100235921
961 Ga0068861_100035542
962 Ga0068861_100041140
963 Ga0068861_100393482
964 Ga0068870_10230756
965 Ga0068863_100001362
966 Ga0068863_100010302
967 Ga0068863_100037072
968 Ga0068863_100058745
969 Ga0068863_100081935
970 Ga0068858_100012237
971 Ga0068858_100020020
972 Ga0068858_100087658
973 Ga0068858_100320404
974 Ga0068858_100539558
975 Ga0068860_100052578
976 Ga0068860_100144875
977 Ga0068860_100156576
978 Ga0068862_100005826
979 Ga0068862_100038990
980 Ga0068862_100048126
981 Ga0068862_100083158
982 Ga0068862_100453834
983 Ga0068862_100689333
984 Ga0075365_10397150
985 Ga0075364_10012696
986 Ga0075364_10161518
987 Ga0075364_10261403
988 Ga0075362_10000313
989 Ga0075367_10306023
990 Ga0075366_10014167
991 Ga0075366_10023155
992 Ga0097621_100004376
993 Ga0097621_100157055
994 Ga0097621_100158962
995 Ga0097621_100280449
996 Ga0097621_100334987
997 Ga0097621_100709217
998 Ga0097621_100864447
999 Ga0075370_10006516
1000 Ga0075370_10007605
1001 Ga0075370_10248759
1002 Ga0068871_100007126
1003 Ga0068871_100042839
1004 Ga0068871_100082573
1005 Ga0068871_100147982
1006 Ga0068871_100164251
1007 Ga0075428_100000037
1008 Ga0075428_100018816
1009 Ga0075428_100020380
1010 Ga0075428_100029147
1011 Ga0075428_100034386
1012 Ga0075428_100045009
1013 Ga0075428_100217069
1014 Ga0075428_100356603
1015 Ga0075430_100005281
1016 Ga0075431_100027919
1017 Ga0075431_100034807
1018 Ga0075431_100141648
1019 Ga0075431_100188169
1020 Ga0075431_100273616
1021 Ga0075431_100371551
1022 Ga0075431_100793222
1023 Ga0075433_10042971
1024 Ga0075433_10056218
1025 Ga0075433_10291328
1026 Ga0075433_10358165
1027 Ga0075434_100008145
1028 Ga0075434_100095802
1029 Ga0075434_100122000
1030 Ga0075434_100213462
1031 Ga0075434_100531960
1032 Ga0075429_100055286
1033 Ga0075429_100079981
1034 Ga0075429_100646318
1035 Ga0075429_100780411
1036 Ga0068865_100120591
1037 Ga0068865_100174080
1038 Ga0068865_100185931
1039 Ga0068865_100321465
1040 Ga0068865_100459870
1041 Ga0097620_100000730
1042 Ga0097620_100001253
1043 Ga0097620_100004160
1044 Ga0097620_100019164
1045 Ga0097620_100048437
1046 Ga0097620_100115169
1047 Ga0097620_100576724
1048 Ga0075435_100002073
1049 Ga0075435_100029137
1050 Ga0075435_100214336
1051 Ga0075435_100338579
1052 Ga0105251_10108087
1053 Ga0105244_10036238
1054 Ga0105240_10704064
1055 Ga0111539_10000009
1056 Ga0111539_10000903
1057 Ga0111539_10001488
1058 Ga0111539_10003033
1059 Ga0111539_10011244
1060 Ga0111539_10012029
1061 Ga0111539_10031342
1062 Ga0111539_10032600
1063 Ga0111539_10039368
1064 Ga0111539_10068398
1065 Ga0111539_10169126
1066 Ga0111539_10256734
1067 Ga0111539_10335215
1068 Ga0111539_10725762
1069 Ga0111539_10754500
1070 Ga0111539_11331442
1071 Ga0105245_10044929
1072 Ga0105245_10353971
1073 Ga0114129_10003220
1074 Ga0114129_10006116
1075 Ga0114129_10027070
1076 Ga0114129_10111060
1077 Ga0114129_10396635
1078 Ga0114129_10532161
1079 Ga0114129_10746439
1080 Ga0105243_10483302
1081 Ga0105243_10648206
1082 Ga0105242_10266104
1083 Ga0105242_10317172
1084 Ga0105242_10389523
1085 Ga0105248_10000871
1086 Ga0105248_10002102
1087 Ga0105248_10093407
1088 Ga0105248_10158107
1089 Ga0105248_10160789
1090 Ga0105248_10614648
1091 Ga0105249_10000496
1092 Ga0105249_10057297
1093 Ga0105249_10405464
1094 Ga0105239_10064374
1095 Ga0105239_10473946
1096 Ga0157319_1000003
1097 Ga0157369_10000242
1098 Ga0157374_10159996
1099 Ga0157374_10404307
1100 Ga0157374_10452733
1101 Ga0157374_10472867
1102 Ga0163162_10001234
1103 Ga0163162_10015719
1104 Ga0163162_10307719
1105 Ga0163162_10874120
1106 Ga0157375_10000079
1107 Ga0157375_10000800
1108 Ga0157375_10001681
1109 Ga0157375_10047704
1110 Ga0157375_10098239
1111 Ga0157375_10219470
1112 Ga0157375_10224430
1113 Ga0163163_10002587
1114 Ga0163163_10007336
1115 Ga0163163_10009037
1116 Ga0163163_10009686
1117 Ga0163163_10016511
1118 Ga0163163_10026534
1119 Ga0163163_10202628
1120 Ga0157380_10007242
1121 Ga0157380_10007698
1122 Ga0157380_10014305
1123 Ga0157380_10028557
1124 Ga0157380_10164562
1125 Ga0157380_10182367
1126 Ga0157380_10248903
1127 Ga0157380_10299528
1128 Ga0157380_10370381
1129 Ga0157377_10014878
1130 Ga0157379_10000641
1131 Ga0157379_10010897
1132 Ga0157376_10000013
1133 Ga0157376_10163660
1134 Ga0157376_10333447
1135 Ga0157376_10337148
1136 Ga0163161_10179772
1137 Ga0163161_10623757
1138 Ga0209256_1000675
1139 Ga0209257_1018212
1140 Ga0207697_10005451
1141 Ga0207697_10019761
1142 Ga0207655_1048297
1143 Ga0207682_10047779
1144 Ga0207642_10294384
1145 Ga0207688_10013023
1146 Ga0207688_10223547
1147 Ga0207680_10004493
1148 Ga0207680_10019383
1149 Ga0207680_10060696
1150 Ga0207680_10067438
1151 Ga0207680_10582676
1152 Ga0207647_10044949
1153 Ga0207645_10008258
1154 Ga0207645_10209631
1155 Ga0207645_10215956
1156 Ga0207643_10121273
1157 Ga0207684_10198667
1158 Ga0207660_10215351
1159 Ga0207662_10009917
1160 Ga0207662_10123462
1161 Ga0207649_10003486
1162 Ga0207649_10071689
1163 Ga0207649_10122147
1164 Ga0207646_10269307
1165 Ga0207681_10000057
1166 Ga0207681_10072641
1167 Ga0207681_10078701
1168 Ga0207681_10252365
1169 Ga0207650_10000165
1170 Ga0207650_10005623
1171 Ga0207650_10006899
1172 Ga0207650_10017945
1173 Ga0207650_10029209
1174 Ga0207650_10121412
1175 Ga0207650_10207584
1176 Ga0207650_10320173
1177 Ga0207659_10000004
1178 Ga0207659_10000354
1179 Ga0207659_10026495
1180 Ga0207659_10038555
1181 Ga0207659_10049798
1182 Ga0207659_10161888
1183 Ga0207659_10189713
1184 Ga0207659_10311778
1185 Ga0207687_10308184
1186 Ga0207644_10008669
1187 Ga0207644_10010812
1188 Ga0207690_10105033
1189 Ga0207706_10030693
1190 Ga0207706_10144003
1191 Ga0207706_10145922
1192 Ga0207706_10284333
1193 Ga0207686_10408273
1194 Ga0207670_10046884
1195 Ga0207670_10241877
1196 Ga0207669_10013739
1197 Ga0207669_10097410
1198 Ga0207669_10273282
1199 Ga0207669_10356995
1200 Ga0207669_10365107
1201 Ga0207669_10645508
1202 Ga0207704_10102249
1203 Ga0207704_10276360
1204 Ga0207704_10390982
1205 Ga0207691_10001855
1206 Ga0207691_10004774
1207 Ga0207691_10021118
1208 Ga0207691_10042877
1209 Ga0207691_10046970
1210 Ga0207691_10156953
1211 Ga0207691_10302596
1212 Ga0207691_10324092
1213 Ga0207711_10002301
1214 Ga0207711_10046122
1215 Ga0207711_10063848
1216 Ga0207711_10220346
1217 Ga0207711_10330588
1218 Ga0207689_10015764
1219 Ga0207689_10343926
1220 Ga0207689_10380307
1221 Ga0207661_10000002
1222 Ga0207661_10002465
1223 Ga0207679_10001834
1224 Ga0207679_10006162
1225 Ga0207679_10013725
1226 Ga0207679_10017709
1227 Ga0207679_10039123
1228 Ga0207679_10096003
1229 Ga0207651_10001825
1230 Ga0207651_10008182
1231 Ga0207651_10025366
1232 Ga0207651_10031371
1233 Ga0207651_10049926
1234 Ga0207651_10791916
1235 Ga0207712_10015782
1236 Ga0207712_10087131
1237 Ga0207712_10556880
1238 Ga0207640_10036047
1239 Ga0207640_10430501
1240 Ga0207658_10029190
1241 Ga0207658_10044430
1242 Ga0207658_10058794
1243 Ga0207658_10128286
1244 Ga0207677_10000216
1245 Ga0207677_10036668
1246 Ga0207677_10587423
1247 Ga0207703_10024164
1248 Ga0207703_10060506
1249 Ga0207703_10268977
1250 Ga0207678_10014697
1251 Ga0207678_10308873
1252 Ga0207708_10001705
1253 Ga0207708_10016438
1254 Ga0207708_10294205
1255 Ga0207708_10315368
1256 Ga0207641_10004263
1257 Ga0207641_10012780
1258 Ga0207641_10047796
1259 Ga0207641_10094690
1260 Ga0207648_10006098
1261 Ga0207648_10064088
1262 Ga0207648_10342950
1263 Ga0207648_10501003
1264 Ga0207676_10003402
1265 Ga0207676_10032125
1266 Ga0207676_10219134
1267 Ga0207676_10219756
1268 Ga0207674_10163710
1269 Ga0207675_100007017
1270 Ga0207675_100020921
1271 Ga0207675_100035297
1272 Ga0207675_100102252
1273 Ga0207683_10030381
1274 Ga0207683_10212868
1275 Ga0207683_10493135
1276 Ga0207698_10324118
1277 Ga0207698_10511056
1278 Ga0207698_10599292
1279 Ga0209974_10078087
1280 Ga0207428_10000005
1281 Ga0207428_10000568
1282 Ga0207428_10004204
1283 Ga0207428_10024582
1284 Ga0207428_10092841
1285 Ga0207428_10436492
1286 Ga0268266_10024012
1287 Ga0268266_10024657
1288 Ga0268266_10097764
1289 Ga0268265_10055591
1290 Ga0268265_10345994
1291 Ga0268265_10570033
1292 Ga0268264_10065596
1293 Ga0268264_10225872
1294 Ga0268264_10356186
1295 Ga0268264_10511824
1296 Ga0268264_10512851
1297 Ga0265334_10000017
1298 Ga0265334_10041821
1299 Ga0265323_10024447
1300 Ga0265323_10100680
1301 Ga0265338_10065636
1302 Ga0265338_10090248
1303 Ga0265320_10008212
1304 Ga0265325_10087697
1305 Ga0265325_10173465
1306 Ga0265339_10272784
1307 Ga0307513_10079143
1308 Ga0307408_100022502
1309 Ga0307408_100163139
1310 Ga0265313_10000022
1311 Ga0265342_10145098
1312 Ga0316576_10006774
1313 Ga0316576_10504323
1314 Ga0316578_10005535
1315 Ga0307405_10174177
1316 Ga0316577_10006137
1317 Ga0307413_10311487
1318 Ga0307410_10053961
1319 Ga0307412_10517839
1320 Ga0307409_100013922
1321 Ga0307409_100091946
1322 Ga0307409_100424037
1323 Ga0307409_100810867
1324 Ga0307416_100089111
1325 Ga0307416_100094423
1326 Ga0307416_100567833
1327 Ga0307414_10074166
1328 Ga0307414_10074714
1329 Ga0307411_10300791
1330 Ga0307411_10509601
1331 Ga0307415_100033726
1332 Ga0307415_100243839
1333 Ga0373930_0012746
1334 Ga0373958_0059899
1335 Ga0373941_0059942
1336 Ga0373957_0243558
1337 Ga0373955_0128080
1338 Ga0373942_0028317
1339 Ga0373931_0023167
1340 Ga0373931_0032552
1341 Ga0373931_0138970
1342 Ga0373931_0275113
1343 Ga0373927_0000003
1344 Ga0373933_0142146
1345 Ga0373947_0072245
1346 Ga0373937_0013564
1347 Ga0373937_0020595
1348 Ga0373937_0281186
1349 Ga0373937_0389684
1350 Ga0373937_0414719
1351 Ga0373937_0796327
1352 Ga0316582_0454069
1353 Ga0436365_1577364
1354 Ga0439439_0030178
1355 Ga0439453_0037390
1356 Ga0451807_1856419
1357 Ga0451853_0964787
1358 Ga0439433_0003363
1359 Ga0439443_017857
1360 Ga0439445_0005455
1361 Ga0439449_0085024
1362 Ga0439454_000320
1363 Ga0439462_0013654
1364 Ga0450920_004981
1365 Ga0450923_013751
1366 Ga0450890_002413
1367 Ga0450891_009103
1368 Ga0450910_023820
1369 Ga0439446_0041151
1370 Ga0450908_013985
1371 Ga0439434_0021455
1372 Ga0439434_0023446
1373 Ga0439435_0008748
1374 Ga0439435_0010796
1375 Ga0439435_0045987
1376 Ga0439444_0062535
1377 Ga0439459_0000956
1378 Ga0439460_0043810
1379 Ga0451577_0117122
1380 Ga0451577_0119951
1381 Ga0451577_0200736
1382 Ga0466972_0000761
1383 Ga0453683_0002405
1384 Ga0466963_0168562
1385 Ga0453684_0224882
1386 Ga0466970_0000395
1387 Ga0451576_0286892
1388 Ga0451576_0573836
1389 Ga0466967_0411990
1390 Ga0495592_0097221
1391 Ga0495629_0088266
1392 Ga0495638_0027130
1393 Ga0495653_0021717
1394 Ga0495580_0209635
1395 Ga0495639_0146008
1396 Ga0495662_0120649
1397 Ga0495664_0090131
1398 Ga0495630_0271195
1399 Ga0495630_0343836
1400 Ga0495663_0104911
1401 Ga0495586_0046163
1402 Ga0495621_0016551
1403 Ga0495621_0038637
1404 Ga0495645_0305369
1405 Ga0495667_0000608
1406 Ga0495634_0047086
1407 Ga0495625_0257403
1408 Ga0495588_0002127
1409 Ga0495657_0051670
1410 Ga0495613_0033719
1411 Ga0495613_0049988
1412 Ga0495613_0154417
1413 Ga0495581_0179712
1414 Ga0495636_0005933
1415 Ga0495674_0061417
1416 Ga0495674_0146670
1417 Ga0495684_0167312
1418 Ga0496101_0030320
1419 Ga0496102_0039221
1420 Ga0496103_0041591
1421 Ga0496104_0019742
1422 Ga0496104_0049688
1423 Ga0496104_0227608
1424 Ga0496105_0019256
1425 Ga0496108_0004765
1426 Ga0496108_0411139
1427 Ga0496109_0002159
1428 Ga0496109_0349488
1429 Ga0496109_0450305
1430 Ga0496110_0005001
1431 Ga0496110_0511020
1432 Ga0496112_0008524
1433 Ga0496112_0170467
1434 Ga0496114_0000887
1435 Ga0496114_0144428
1436 Ga0496114_0911465
1437 Ga0496117_0038598
1438 Ga0496118_0000081
1439 Ga0496119_0019622
1440 Ga0496120_0001425
1441 Ga0496121_0139496
1442 Ga0501032_0022553
1443 Ga0501033_0196083
1444 Ga0501033_0538791
1445 Ga0501034_0137613
1446 Ga0501034_0540365
1447 Ga0501036_0007622
1448 Ga0501036_0020175
1449 Ga0501036_0307513
1450 Ga0501037_0024369
1451 Ga0501037_0304797
1452 Ga0501037_0322986
1453 Ga0501038_0026213
1454 Ga0501038_0110184
1455 Ga0501038_0277144
1456 Ga0501039_0047974
1457 Ga0501039_0052637
1458 Ga0501039_0212431
1459 Ga0501040_0058482
1460 Ga0501040_0087737
1461 Ga0501041_0002625
1462 Ga0501041_0022490
1463 Ga0501041_0226775
1464 Ga0501042_0058335
1465 Ga0501042_0375327
1466 Ga0501042_0391775
1467 Ga0501043_0001782
1468 Ga0501043_0048649
1469 Ga0501043_0095041
1470 Ga0501043_0393769
1471 Ga0501046_0086054
1472 Ga0501046_0098898
1473 Ga0501047_0000865
1474 Ga0501047_0356991
1475 Ga0501047_0387992
1476 Ga0501048_0020667
1477 Ga0501048_0102687
1478 Ga0501048_0122736
1479 Ga0501067_0043573
1480 Ga0501068_0010418
1481 Ga0501069_0006934
1482 Ga0501070_0024792
1483 Ga0501070_0112546
1484 Ga0501070_0142573
1485 Ga0501070_0761630
1486 Ga0501071_0029562
1487 Ga0501071_0497378
1488 Ga0501071_0554476
1489 Ga0501072_0014179
1490 Ga0501072_0019383
1491 Ga0501072_0064923
1492 Ga0501072_0477287
1493 Ga0501072_0506492
1494 Ga0501073_0065028
1495 Ga0501073_0095526
1496 Ga0501073_0106015
1497 Ga0501075_0003759
1498 Ga0501075_0095428
1499 Ga0501075_0185268
1500 Ga0501075_0674818
1501 Ga0501076_0000962
1502 Ga0501076_0139731
1503 Ga0501076_0454294
1504 Ga0501076_0462467
1505 Ga0501076_0526783
1506 Ga0501079_0004334
1507 Ga0501079_0047107
1508 Ga0501080_0083953
1509 Ga0501080_0426684
1510 Ga0501080_0474637
1511 Ga0501080_0557207
1512 Ga0501081_0001658
1513 Ga0501081_0643858
1514 Ga0501083_0001802
1515 Ga0501083_0011137
1516 Ga0501083_0012210
1517 Ga0501083_0255741
1518 Ga0501083_0400883
1519 Ga0501045_0026758
1520 Ga0501045_0271496
1521 Ga0501045_0301509
1522 nmdc:mga03683_892_c1
1523 nmdc:mga03n38_165751_c1
1524 nmdc:mga00v17_2680_c1
1525 nmdc:mga00v17_62875_c1
1526 nmdc:mga0yw44_440032_c1
1527 nmdc:mga0k408_2394_c1
1528 nmdc:mga0k408_3448_c1
1529 nmdc:mga0k408_46825_c1
1530 nmdc:mga06z11_384201_c1
1531 nmdc:mga04h51_12745_c1
1532 nmdc:mga07m45_111507_c1
1533 nmdc:mga07m45_245953_c1
1534 nmdc:mga07m45_96768_c1
1535 nmdc:mga05p37_11087_c1
1536 nmdc:mga05p37_18046_c1
1537 nmdc:mga05p37_19797_c1
1538 nmdc:mga05p37_259068_c1
1539 nmdc:mga05p37_3545_c1
1540 nmdc:mga09592_207770_c1
1541 nmdc:mga09592_40435_c1
1542 nmdc:mga09592_59727_c1
1543 nmdc:mga09592_91244_c1
1544 nmdc:mga0qj67_55945_c1
1545 nmdc:mga0qj67_9396_c1
1546 nmdc:mga06r32_154161_c1
1547 nmdc:mga06r32_308080_c1
1548 nmdc:mga06r32_388030_c1
1549 nmdc:mga06r32_425506_c1
1550 nmdc:mga06r32_590246_c1
1551 nmdc:mga06r32_69217_c1
1552 nmdc:mga08y16_110973_c1
1553 nmdc:mga08y16_136005_c1
1554 nmdc:mga08y16_205847_c1
1555 nmdc:mga08y16_2143_c1
1556 nmdc:mga08y16_27240_c1
1557 nmdc:mga08y16_273571_c1
1558 nmdc:mga08y16_4721_c1
1559 nmdc:mga08y16_530028_c1
1560 nmdc:mga08y16_734061_c1
1561 nmdc:mga08y16_764157_c1
1562 nmdc:mga08y16_9_c1
1563 nmdc:mga0n895_12303_c1
1564 nmdc:mga0n895_38507_c1
1565 nmdc:mga0n895_399911_c1
1566 nmdc:mga0n895_44349_c1
1567 nmdc:mga0n895_542302_c1
1568 nmdc:mga0n895_7442_c1
1569 nmdc:mga0rr50_101822_c1
1570 nmdc:mga0rr50_198186_c1
1571 nmdc:mga0rr50_6394_c1
1572 nmdc:mga0a205_10361_c1
1573 nmdc:mga0a205_181447_c1
1574 nmdc:mga0a205_24010_c1
1575 nmdc:mga0a205_319546_c1
1576 nmdc:mga0a205_334112_c1
1577 Ga0495601_0267660
1578 Ga0495595_0025157
1579 Ga0495619_0050696
1580 Ga0501084_0008882
1581 Ga0501084_0009049
1582 Ga0501084_0009934
1583 Ga0501084_0382260
1584 Ga0501082_0000427
1585 Ga0501082_0066095
1586 Ga0501082_0153743
1587 Ga0501082_0637408
1588 Ga0530510_0006502
1589 Ga0530510_0006569
1590 2525556562
1591 2630649791
1592 2886850252

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

201

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9738 2 227
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9728 2 224
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9728 2 227
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9725 5 224
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9701 4 225
ID Description Score Start End Superfamily
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9768 4 224 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9746 1 226 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9742 31 226 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9738 2 227 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9727 2 224 3.40.50.300
ID Description Score Start End GO Terms
AF-H8FG51-F1-model_v4 deleted 0.9984 1 205
AF-A0A437SP63-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9925 74 224 GO:0005524
GO:0016887
AF-A0A1V4HEF9-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9923 5 224 GO:0005524
GO:0016887
AF-A0A3N5M7J6-F1-model_v4 ABC transporter ATP-binding protein 0.9895 5 182 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-T1ADX9-F1-model_v4 ABC transporter ATP-binding protein 0.9873 57 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map