F480923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 789 | 355 | 1578 | 65 |
Family's Representative Sequence
| Representative Sequence | 3300048916|Ga0496113_0837235|Ga0496113_0837235_492_698 |
| Length | 68 |
| Sequence | MTTMARSCAICGKVSMGGFNPQSSGMNRVRAHRRYQPNLQPFTIRENGTAVKALVCTRCRRTALKSAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 175 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 195 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 206 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 207 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 213 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 235 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 236 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 237 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 238 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 239 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 240 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 241 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 244 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 245 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 246 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 247 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 248 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 249 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 250 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 295 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 296 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 297 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 298 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 299 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 302 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 303 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 351 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 352 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 353 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.25 |
| Nodule | 0 |
| Rhizoplane | 11.91 |
| Rhizosphere | 85.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496113_0837235 | 3300048916 | Bacteria | 730 |
| 2 | rootH1_10157696 | 3300003323 | Bacteria | 1415 |
| 3 | JGI26145J50221_1028579 | 3300003371 | Unclassified | 563 |
| 4 | Ga0070683_101137033 | 3300005329 | Bacteria | 750 |
| 5 | Ga0070690_100162838 | 3300005330 | Bacteria | 1530 |
| 6 | Ga0068869_100213113 | 3300005334 | Unclassified | 1528 |
| 7 | Ga0068869_100619429 | 3300005334 | Bacteria | 916 |
| 8 | Ga0068869_101949401 | 3300005334 | Bacteria | 527 |
| 9 | Ga0070666_11210312 | 3300005335 | Bacteria | 563 |
| 10 | Ga0070680_101234719 | 3300005336 | Bacteria | 647 |
| 11 | Ga0070680_101879618 | 3300005336 | Bacteria | 519 |
| 12 | Ga0070682_100304562 | 3300005337 | Bacteria | 1171 |
| 13 | Ga0070682_100422191 | 3300005337 | Bacteria | 1014 |
| 14 | Ga0070682_100630603 | 3300005337 | Bacteria | 851 |
| 15 | Ga0070682_100807481 | 3300005337 | Bacteria | 763 |
| 16 | Ga0068868_100303478 | 3300005338 | Bacteria | 1356 |
| 17 | Ga0068868_100343690 | 3300005338 | Bacteria | 1276 |
| 18 | Ga0068868_101748688 | 3300005338 | Bacteria | 587 |
| 19 | Ga0068868_102312409 | 3300005338 | Unclassified | 513 |
| 20 | Ga0070660_101639436 | 3300005339 | Bacteria | 547 |
| 21 | Ga0070689_100329303 | 3300005340 | Bacteria | 1277 |
| 22 | Ga0070689_100703083 | 3300005340 | Unclassified | 883 |
| 23 | Ga0070691_10346454 | 3300005341 | Bacteria | 824 |
| 24 | Ga0070691_10595039 | 3300005341 | Unclassified | 652 |
| 25 | Ga0070687_100506250 | 3300005343 | Bacteria | 814 |
| 26 | Ga0070687_100513956 | 3300005343 | Bacteria | 809 |
| 27 | Ga0070692_10138052 | 3300005345 | Unclassified | 1377 |
| 28 | Ga0070692_11223711 | 3300005345 | Bacteria | 536 |
| 29 | Ga0070668_100119053 | 3300005347 | Bacteria | 2109 |
| 30 | Ga0070668_102036436 | 3300005347 | Unclassified | 530 |
| 31 | Ga0070669_100881687 | 3300005353 | Unclassified | 764 |
| 32 | Ga0070675_100118163 | 3300005354 | Bacteria | 2251 |
| 33 | Ga0070674_100211680 | 3300005356 | Bacteria | 1503 |
| 34 | Ga0070674_100755724 | 3300005356 | Unclassified | 836 |
| 35 | Ga0070674_101908963 | 3300005356 | Bacteria | 540 |
| 36 | Ga0070674_102190320 | 3300005356 | Bacteria | 505 |
| 37 | Ga0070688_100763042 | 3300005365 | Bacteria | 754 |
| 38 | Ga0070659_100645998 | 3300005366 | Bacteria | 912 |
| 39 | Ga0070659_100824095 | 3300005366 | Unclassified | 808 |
| 40 | Ga0070659_101518565 | 3300005366 | Bacteria | 597 |
| 41 | Ga0070659_101622027 | 3300005366 | Unclassified | 578 |
| 42 | Ga0070703_10048661 | 3300005406 | Bacteria | 1347 |
| 43 | Ga0070713_101155793 | 3300005436 | Bacteria | 749 |
| 44 | Ga0070701_10369643 | 3300005438 | Unclassified | 901 |
| 45 | Ga0070701_11229294 | 3300005438 | Bacteria | 533 |
| 46 | Ga0070711_101446082 | 3300005439 | Bacteria | 599 |
| 47 | Ga0070705_100006371 | 3300005440 | Bacteria | 5783 |
| 48 | Ga0070705_100147212 | 3300005440 | Bacteria | 1558 |
| 49 | Ga0070705_100186422 | 3300005440 | Bacteria | 1410 |
| 50 | Ga0070705_100381195 | 3300005440 | Bacteria | 1038 |
| 51 | Ga0070705_100700150 | 3300005440 | Unclassified | 796 |
| 52 | Ga0070705_101506305 | 3300005440 | Unclassified | 564 |
| 53 | Ga0070705_101536020 | 3300005440 | Unclassified | 559 |
| 54 | Ga0070700_100087436 | 3300005441 | Unclassified | 2026 |
| 55 | Ga0070700_101478717 | 3300005441 | Unclassified | 577 |
| 56 | Ga0070694_100251213 | 3300005444 | Bacteria | 1338 |
| 57 | Ga0070694_101032139 | 3300005444 | Bacteria | 683 |
| 58 | Ga0070708_100031785 | 3300005445 | Bacteria | 4572 |
| 59 | Ga0070708_100081050 | 3300005445 | Bacteria | 2938 |
| 60 | Ga0070708_100098081 | 3300005445 | Bacteria | 2680 |
| 61 | Ga0070708_100255794 | 3300005445 | Bacteria | 1646 |
| 62 | Ga0070708_100296970 | 3300005445 | Bacteria | 1521 |
| 63 | Ga0070663_100358897 | 3300005455 | Bacteria | 1182 |
| 64 | Ga0070663_100426467 | 3300005455 | Bacteria | 1089 |
| 65 | Ga0070663_101982048 | 3300005455 | Bacteria | 524 |
| 66 | Ga0070678_100137109 | 3300005456 | Bacteria | 1953 |
| 67 | Ga0070678_100666798 | 3300005456 | Bacteria | 934 |
| 68 | Ga0070678_101901729 | 3300005456 | Unclassified | 562 |
| 69 | Ga0070678_101904831 | 3300005456 | Unclassified | 561 |
| 70 | Ga0070678_102350585 | 3300005456 | Unclassified | 506 |
| 71 | Ga0070662_100360177 | 3300005457 | Unclassified | 1193 |
| 72 | Ga0070662_100667761 | 3300005457 | Bacteria | 878 |
| 73 | Ga0070662_101119165 | 3300005457 | Unclassified | 676 |
| 74 | Ga0070681_10118781 | 3300005458 | Bacteria | 2580 |
| 75 | Ga0070681_11249505 | 3300005458 | Bacteria | 665 |
| 76 | Ga0068867_100177862 | 3300005459 | Bacteria | 1690 |
| 77 | Ga0068867_102076896 | 3300005459 | Bacteria | 538 |
| 78 | Ga0070685_10307305 | 3300005466 | Bacteria | 1070 |
| 79 | Ga0070706_100031239 | 3300005467 | Bacteria | 4911 |
| 80 | Ga0070706_100039807 | 3300005467 | Bacteria | 4338 |
| 81 | Ga0070706_100971455 | 3300005467 | Unclassified | 784 |
| 82 | Ga0070707_100002066 | 3300005468 | Bacteria | 19252 |
| 83 | Ga0070707_100030411 | 3300005468 | Bacteria | 5141 |
| 84 | Ga0070707_100519669 | 3300005468 | Unclassified | 1153 |
| 85 | Ga0070698_100008917 | 3300005471 | Bacteria | 10785 |
| 86 | Ga0070698_100256615 | 3300005471 | Bacteria | 1680 |
| 87 | Ga0070698_100429182 | 3300005471 | Bacteria | 1256 |
| 88 | Ga0070698_100869462 | 3300005471 | Bacteria | 847 |
| 89 | Ga0070698_100950766 | 3300005471 | Bacteria | 806 |
| 90 | Ga0070698_101054227 | 3300005471 | Unclassified | 761 |
| 91 | Ga0070698_101731467 | 3300005471 | Unclassified | 578 |
| 92 | Ga0074259_10302601 | 3300005507 | Bacteria | 501 |
| 93 | Ga0070699_100003085 | 3300005518 | Bacteria | 14766 |
| 94 | Ga0070699_100024566 | 3300005518 | Bacteria | 5194 |
| 95 | Ga0070699_100114487 | 3300005518 | Bacteria | 2369 |
| 96 | Ga0070699_100150701 | 3300005518 | Bacteria | 2057 |
| 97 | Ga0070699_100351520 | 3300005518 | Bacteria | 1328 |
| 98 | Ga0070699_100418613 | 3300005518 | Bacteria | 1212 |
| 99 | Ga0070699_100536288 | 3300005518 | Unclassified | 1065 |
| 100 | Ga0070684_100054257 | 3300005535 | Bacteria | 3492 |
| 101 | Ga0070684_100125386 | 3300005535 | Bacteria | 2313 |
| 102 | Ga0070684_101027147 | 3300005535 | Unclassified | 774 |
| 103 | Ga0070684_101045556 | 3300005535 | Bacteria | 767 |
| 104 | Ga0070684_101138352 | 3300005535 | Unclassified | 734 |
| 105 | Ga0070684_101578850 | 3300005535 | Bacteria | 619 |
| 106 | Ga0070697_100013873 | 3300005536 | Bacteria | 6325 |
| 107 | Ga0070697_100030499 | 3300005536 | Bacteria | 4332 |
| 108 | Ga0070697_100637984 | 3300005536 | Unclassified | 938 |
| 109 | Ga0070697_101188043 | 3300005536 | Bacteria | 680 |
| 110 | Ga0070672_101730801 | 3300005543 | Bacteria | 562 |
| 111 | Ga0070686_100117562 | 3300005544 | Bacteria | 1821 |
| 112 | Ga0070686_100291795 | 3300005544 | Bacteria | 1207 |
| 113 | Ga0070686_101043167 | 3300005544 | Unclassified | 673 |
| 114 | Ga0070695_100014873 | 3300005545 | Bacteria | 4695 |
| 115 | Ga0070695_100215840 | 3300005545 | Bacteria | 1379 |
| 116 | Ga0070696_100063072 | 3300005546 | Bacteria | 2595 |
| 117 | Ga0070696_100142282 | 3300005546 | Bacteria | 1754 |
| 118 | Ga0070696_100233164 | 3300005546 | Bacteria | 1385 |
| 119 | Ga0070696_100340147 | 3300005546 | Bacteria | 1159 |
| 120 | Ga0070665_101424253 | 3300005548 | Unclassified | 702 |
| 121 | Ga0070665_101785379 | 3300005548 | Unclassified | 622 |
| 122 | Ga0070704_100017007 | 3300005549 | Bacteria | 4612 |
| 123 | Ga0070704_100091874 | 3300005549 | Bacteria | 2264 |
| 124 | Ga0070704_100295985 | 3300005549 | Bacteria | 1347 |
| 125 | Ga0068855_100644188 | 3300005563 | Bacteria | 1139 |
| 126 | Ga0068855_100966083 | 3300005563 | Unclassified | 897 |
| 127 | Ga0070664_100303691 | 3300005564 | Bacteria | 1443 |
| 128 | Ga0070664_100604600 | 3300005564 | Bacteria | 1017 |
| 129 | Ga0070664_101438877 | 3300005564 | Unclassified | 652 |
| 130 | Ga0068857_100298241 | 3300005577 | Unclassified | 1485 |
| 131 | Ga0068857_101447239 | 3300005577 | Bacteria | 669 |
| 132 | Ga0068854_100664394 | 3300005578 | Unclassified | 896 |
| 133 | Ga0068854_101783961 | 3300005578 | Unclassified | 564 |
| 134 | Ga0068854_102176524 | 3300005578 | Unclassified | 513 |
| 135 | Ga0068856_101059007 | 3300005614 | Unclassified | 829 |
| 136 | Ga0068856_102255987 | 3300005614 | Bacteria | 553 |
| 137 | Ga0070702_100031503 | 3300005615 | Bacteria | 2903 |
| 138 | Ga0070702_100484524 | 3300005615 | Bacteria | 905 |
| 139 | Ga0070702_100494497 | 3300005615 | Unclassified | 897 |
| 140 | Ga0070702_100572184 | 3300005615 | Unclassified | 842 |
| 141 | Ga0070702_100788537 | 3300005615 | Bacteria | 734 |
| 142 | Ga0068852_100399431 | 3300005616 | Bacteria | 1352 |
| 143 | Ga0068852_101274056 | 3300005616 | Unclassified | 757 |
| 144 | Ga0068852_101391007 | 3300005616 | Bacteria | 724 |
| 145 | Ga0068859_100858088 | 3300005617 | Bacteria | 994 |
| 146 | Ga0068859_100970014 | 3300005617 | Bacteria | 933 |
| 147 | Ga0068864_100524997 | 3300005618 | Bacteria | 1142 |
| 148 | Ga0068864_100869789 | 3300005618 | Bacteria | 889 |
| 149 | Ga0068861_100469974 | 3300005719 | Unclassified | 1131 |
| 150 | Ga0068861_101072892 | 3300005719 | Bacteria | 773 |
| 151 | Ga0068861_101623214 | 3300005719 | Bacteria | 638 |
| 152 | Ga0068870_10592886 | 3300005840 | Bacteria | 752 |
| 153 | Ga0068863_100948821 | 3300005841 | Bacteria | 862 |
| 154 | Ga0068863_101315393 | 3300005841 | Unclassified | 730 |
| 155 | Ga0068858_100564849 | 3300005842 | Bacteria | 1102 |
| 156 | Ga0068860_100068341 | 3300005843 | Bacteria | 3376 |
| 157 | Ga0068860_101124445 | 3300005843 | Bacteria | 805 |
| 158 | Ga0068860_102568742 | 3300005843 | Unclassified | 529 |
| 159 | Ga0068862_100368938 | 3300005844 | Unclassified | 1336 |
| 160 | Ga0068862_100819038 | 3300005844 | Unclassified | 910 |
| 161 | Ga0068862_101639573 | 3300005844 | Unclassified | 651 |
| 162 | Ga0068862_101878556 | 3300005844 | Bacteria | 609 |
| 163 | Ga0081455_10084938 | 3300005937 | Bacteria | 2582 |
| 164 | Ga0081455_10884792 | 3300005937 | Unclassified | 556 |
| 165 | Ga0081539_10002566 | 3300005985 | Bacteria | 25143 |
| 166 | Ga0081539_10010249 | 3300005985 | Bacteria | 7656 |
| 167 | Ga0075365_10458721 | 3300006038 | Bacteria | 900 |
| 168 | Ga0097621_100220658 | 3300006237 | Bacteria | 1652 |
| 169 | Ga0097621_100961684 | 3300006237 | Bacteria | 798 |
| 170 | Ga0097621_102222395 | 3300006237 | Bacteria | 525 |
| 171 | Ga0068871_100389604 | 3300006358 | Bacteria | 1239 |
| 172 | Ga0068871_100889947 | 3300006358 | Bacteria | 825 |
| 173 | Ga0068871_101642960 | 3300006358 | Bacteria | 609 |
| 174 | Ga0075428_100455819 | 3300006844 | Bacteria | 1370 |
| 175 | Ga0075428_101363035 | 3300006844 | Bacteria | 745 |
| 176 | Ga0075433_10972437 | 3300006852 | Unclassified | 740 |
| 177 | Ga0075433_11556299 | 3300006852 | Bacteria | 571 |
| 178 | Ga0075434_100981082 | 3300006871 | Bacteria | 859 |
| 179 | Ga0068865_100992158 | 3300006881 | Bacteria | 735 |
| 180 | Ga0068865_101346016 | 3300006881 | Unclassified | 636 |
| 181 | Ga0097620_100858046 | 3300006931 | Bacteria | 994 |
| 182 | Ga0097620_100970031 | 3300006931 | Bacteria | 933 |
| 183 | Ga0075435_100078495 | 3300007076 | Bacteria | 2708 |
| 184 | Ga0099795_10411904 | 3300007788 | Unclassified | 616 |
| 185 | Ga0105240_11194886 | 3300009093 | Unclassified | 805 |
| 186 | Ga0105240_12619602 | 3300009093 | Bacteria | 521 |
| 187 | Ga0111539_10442144 | 3300009094 | Unclassified | 1514 |
| 188 | Ga0111539_12677273 | 3300009094 | Unclassified | 578 |
| 189 | Ga0111539_13044534 | 3300009094 | Unclassified | 541 |
| 190 | Ga0111539_13376509 | 3300009094 | Unclassified | 514 |
| 191 | Ga0105245_10038106 | 3300009098 | Bacteria | 4276 |
| 192 | Ga0105245_10110314 | 3300009098 | Bacteria | 2558 |
| 193 | Ga0105245_10453387 | 3300009098 | Bacteria | 1291 |
| 194 | Ga0105245_10461604 | 3300009098 | Bacteria | 1280 |
| 195 | Ga0105245_10585721 | 3300009098 | Bacteria | 1140 |
| 196 | Ga0105245_10799268 | 3300009098 | Unclassified | 981 |
| 197 | Ga0105245_10931860 | 3300009098 | Unclassified | 911 |
| 198 | Ga0105247_10268289 | 3300009101 | Bacteria | 1173 |
| 199 | Ga0105247_11089853 | 3300009101 | Unclassified | 629 |
| 200 | Ga0105247_11248700 | 3300009101 | Unclassified | 594 |
| 201 | Ga0114129_10158105 | 3300009147 | Bacteria | 3098 |
| 202 | Ga0114129_11350658 | 3300009147 | Unclassified | 881 |
| 203 | Ga0114129_11650786 | 3300009147 | Unclassified | 783 |
| 204 | Ga0114129_11964261 | 3300009147 | Unclassified | 708 |
| 205 | Ga0105243_10681055 | 3300009148 | Bacteria | 1000 |
| 206 | Ga0105243_11062964 | 3300009148 | Unclassified | 816 |
| 207 | Ga0105243_11465847 | 3300009148 | Bacteria | 705 |
| 208 | Ga0105243_12269359 | 3300009148 | Unclassified | 580 |
| 209 | Ga0105243_12336287 | 3300009148 | Bacteria | 572 |
| 210 | Ga0105243_12749649 | 3300009148 | Bacteria | 532 |
| 211 | Ga0105241_10231991 | 3300009174 | Bacteria | 1556 |
| 212 | Ga0105242_10595362 | 3300009176 | Bacteria | 1067 |
| 213 | Ga0105242_10705201 | 3300009176 | Bacteria | 988 |
| 214 | Ga0105242_11092999 | 3300009176 | Bacteria | 811 |
| 215 | Ga0105242_11242266 | 3300009176 | Bacteria | 766 |
| 216 | Ga0105242_11682104 | 3300009176 | Unclassified | 670 |
| 217 | Ga0105242_11849749 | 3300009176 | Unclassified | 643 |
| 218 | Ga0105242_13142544 | 3300009176 | Unclassified | 512 |
| 219 | Ga0105248_10768422 | 3300009177 | Bacteria | 1087 |
| 220 | Ga0105248_10904260 | 3300009177 | Bacteria | 997 |
| 221 | Ga0105248_11880529 | 3300009177 | Bacteria | 679 |
| 222 | Ga0105248_11956902 | 3300009177 | Bacteria | 666 |
| 223 | Ga0105248_12578717 | 3300009177 | Unclassified | 579 |
| 224 | Ga0105237_11502566 | 3300009545 | Bacteria | 680 |
| 225 | Ga0105237_12069695 | 3300009545 | Unclassified | 578 |
| 226 | Ga0105238_11022022 | 3300009551 | Bacteria | 848 |
| 227 | Ga0105238_12638707 | 3300009551 | Unclassified | 539 |
| 228 | Ga0105249_10436356 | 3300009553 | Bacteria | 1346 |
| 229 | Ga0105249_10994895 | 3300009553 | Bacteria | 907 |
| 230 | Ga0105249_11078593 | 3300009553 | Bacteria | 873 |
| 231 | Ga0105249_11667097 | 3300009553 | Bacteria | 710 |
| 232 | Ga0099796_10221781 | 3300010159 | Unclassified | 775 |
| 233 | Ga0105239_10916678 | 3300010375 | Bacteria | 1006 |
| 234 | Ga0105239_10967373 | 3300010375 | Bacteria | 978 |
| 235 | Ga0105239_11263768 | 3300010375 | Bacteria | 851 |
| 236 | Ga0105239_11473060 | 3300010375 | Bacteria | 786 |
| 237 | Ga0105239_12136590 | 3300010375 | Bacteria | 651 |
| 238 | Ga0105239_12423584 | 3300010375 | Unclassified | 611 |
| 239 | Ga0105246_10634501 | 3300011119 | Unclassified | 928 |
| 240 | Ga0105246_10774859 | 3300011119 | Unclassified | 848 |
| 241 | Ga0105246_11255465 | 3300011119 | Unclassified | 684 |
| 242 | Ga0105246_11454867 | 3300011119 | Unclassified | 642 |
| 243 | Ga0105246_11678034 | 3300011119 | Bacteria | 603 |
| 244 | Ga0157336_1023706 | 3300012477 | Unclassified | 573 |
| 245 | Ga0157373_11057963 | 3300013100 | Unclassified | 607 |
| 246 | Ga0157371_10645750 | 3300013102 | Bacteria | 789 |
| 247 | Ga0157370_11746041 | 3300013104 | Unclassified | 558 |
| 248 | Ga0157374_10409772 | 3300013296 | Unclassified | 1353 |
| 249 | Ga0157374_12917193 | 3300013296 | Unclassified | 505 |
| 250 | Ga0157378_10665108 | 3300013297 | Bacteria | 1058 |
| 251 | Ga0157378_10758128 | 3300013297 | Bacteria | 994 |
| 252 | Ga0157378_10870841 | 3300013297 | Bacteria | 930 |
| 253 | Ga0157378_11101058 | 3300013297 | Bacteria | 831 |
| 254 | Ga0157378_11446281 | 3300013297 | Unclassified | 731 |
| 255 | Ga0163162_10833060 | 3300013306 | Bacteria | 1038 |
| 256 | Ga0163162_13062611 | 3300013306 | Bacteria | 537 |
| 257 | Ga0157372_11483101 | 3300013307 | Bacteria | 781 |
| 258 | Ga0157372_11688326 | 3300013307 | Bacteria | 729 |
| 259 | Ga0157372_11706382 | 3300013307 | Unclassified | 725 |
| 260 | Ga0157375_10025096 | 3300013308 | Bacteria | 5529 |
| 261 | Ga0157375_10937897 | 3300013308 | Bacteria | 1008 |
| 262 | Ga0157375_10972350 | 3300013308 | Bacteria | 990 |
| 263 | Ga0157375_11395445 | 3300013308 | Unclassified | 825 |
| 264 | Ga0163163_10136303 | 3300014325 | Bacteria | 2496 |
| 265 | Ga0163163_10144839 | 3300014325 | Bacteria | 2419 |
| 266 | Ga0163163_10481848 | 3300014325 | Bacteria | 1302 |
| 267 | Ga0163163_10647132 | 3300014325 | Bacteria | 1120 |
| 268 | Ga0163163_11392116 | 3300014325 | Unclassified | 763 |
| 269 | Ga0163163_12442350 | 3300014325 | Unclassified | 581 |
| 270 | Ga0157380_10209863 | 3300014326 | Bacteria | 1734 |
| 271 | Ga0157380_10380833 | 3300014326 | Bacteria | 1331 |
| 272 | Ga0157380_10553070 | 3300014326 | Bacteria | 1129 |
| 273 | Ga0157380_12167743 | 3300014326 | Unclassified | 619 |
| 274 | Ga0157380_12729709 | 3300014326 | Unclassified | 560 |
| 275 | Ga0182008_10158029 | 3300014497 | Bacteria | 1139 |
| 276 | Ga0182008_10410730 | 3300014497 | Bacteria | 729 |
| 277 | Ga0157377_10092905 | 3300014745 | Bacteria | 1785 |
| 278 | Ga0157377_10622289 | 3300014745 | Bacteria | 773 |
| 279 | Ga0157377_10740093 | 3300014745 | Unclassified | 718 |
| 280 | Ga0157379_10084949 | 3300014968 | Bacteria | 2836 |
| 281 | Ga0157379_10242292 | 3300014968 | Bacteria | 1635 |
| 282 | Ga0157379_10516174 | 3300014968 | Bacteria | 1109 |
| 283 | Ga0157379_10688588 | 3300014968 | Bacteria | 959 |
| 284 | Ga0157379_10783477 | 3300014968 | Bacteria | 899 |
| 285 | Ga0157379_11710499 | 3300014968 | Unclassified | 616 |
| 286 | Ga0157376_10209190 | 3300014969 | Bacteria | 1800 |
| 287 | Ga0157376_10478014 | 3300014969 | Bacteria | 1220 |
| 288 | Ga0157376_11427042 | 3300014969 | Viruses | 724 |
| 289 | Ga0163161_10498275 | 3300017792 | Bacteria | 991 |
| 290 | Ga0207653_10241667 | 3300025885 | Unclassified | 690 |
| 291 | Ga0207682_10333845 | 3300025893 | Unclassified | 713 |
| 292 | Ga0207642_10502030 | 3300025899 | Bacteria | 743 |
| 293 | Ga0207688_10061004 | 3300025901 | Bacteria | 2125 |
| 294 | Ga0207688_10428012 | 3300025901 | Unclassified | 823 |
| 295 | Ga0207680_10715607 | 3300025903 | Bacteria | 718 |
| 296 | Ga0207685_10869491 | 3300025905 | Unclassified | 500 |
| 297 | Ga0207645_10414809 | 3300025907 | Unclassified | 907 |
| 298 | Ga0207645_10781250 | 3300025907 | Bacteria | 649 |
| 299 | Ga0207643_10928625 | 3300025908 | Bacteria | 564 |
| 300 | Ga0207684_10015853 | 3300025910 | Bacteria | 6479 |
| 301 | Ga0207684_10281704 | 3300025910 | Bacteria | 1433 |
| 302 | Ga0207707_10733808 | 3300025912 | Unclassified | 827 |
| 303 | Ga0207660_10289694 | 3300025917 | Bacteria | 1302 |
| 304 | Ga0207660_10504640 | 3300025917 | Bacteria | 981 |
| 305 | Ga0207662_10535121 | 3300025918 | Bacteria | 810 |
| 306 | Ga0207662_10843406 | 3300025918 | Bacteria | 647 |
| 307 | Ga0207657_10564807 | 3300025919 | Unclassified | 889 |
| 308 | Ga0207649_11205792 | 3300025920 | Bacteria | 598 |
| 309 | Ga0207652_10077275 | 3300025921 | Bacteria | 2905 |
| 310 | Ga0207652_10209060 | 3300025921 | Bacteria | 1757 |
| 311 | Ga0207646_10003504 | 3300025922 | Bacteria | 17691 |
| 312 | Ga0207646_10009489 | 3300025922 | Bacteria | 9615 |
| 313 | Ga0207646_10027778 | 3300025922 | Bacteria | 5158 |
| 314 | Ga0207646_11052804 | 3300025922 | Unclassified | 717 |
| 315 | Ga0207681_11086841 | 3300025923 | Bacteria | 672 |
| 316 | Ga0207681_11349959 | 3300025923 | Bacteria | 599 |
| 317 | Ga0207650_10148708 | 3300025925 | Bacteria | 1847 |
| 318 | Ga0207650_10550124 | 3300025925 | Bacteria | 968 |
| 319 | Ga0207659_10111281 | 3300025926 | Bacteria | 2082 |
| 320 | Ga0207659_10573130 | 3300025926 | Bacteria | 961 |
| 321 | Ga0207659_11741059 | 3300025926 | Unclassified | 530 |
| 322 | Ga0207659_11886114 | 3300025926 | Unclassified | 507 |
| 323 | Ga0207687_10127984 | 3300025927 | Bacteria | 1910 |
| 324 | Ga0207687_10421492 | 3300025927 | Unclassified | 1102 |
| 325 | Ga0207687_10765920 | 3300025927 | Bacteria | 822 |
| 326 | Ga0207687_11114149 | 3300025927 | Bacteria | 678 |
| 327 | Ga0207690_10568556 | 3300025932 | Bacteria | 923 |
| 328 | Ga0207690_11121596 | 3300025932 | Bacteria | 656 |
| 329 | Ga0207690_11748686 | 3300025932 | Bacteria | 519 |
| 330 | Ga0207690_11815243 | 3300025932 | Unclassified | 509 |
| 331 | Ga0207706_10037897 | 3300025933 | Bacteria | 4278 |
| 332 | Ga0207706_10761475 | 3300025933 | Bacteria | 824 |
| 333 | Ga0207706_10931655 | 3300025933 | Bacteria | 733 |
| 334 | Ga0207686_10319404 | 3300025934 | Bacteria | 1160 |
| 335 | Ga0207686_10469233 | 3300025934 | Bacteria | 971 |
| 336 | Ga0207686_10892392 | 3300025934 | Bacteria | 717 |
| 337 | Ga0207709_11395402 | 3300025935 | Unclassified | 580 |
| 338 | Ga0207670_10108455 | 3300025936 | Bacteria | 1996 |
| 339 | Ga0207669_11446879 | 3300025937 | Bacteria | 586 |
| 340 | Ga0207669_11724940 | 3300025937 | Unclassified | 535 |
| 341 | Ga0207704_10856771 | 3300025938 | Unclassified | 762 |
| 342 | Ga0207704_11385851 | 3300025938 | Bacteria | 602 |
| 343 | Ga0207665_10057653 | 3300025939 | Bacteria | 2624 |
| 344 | Ga0207665_10337439 | 3300025939 | Bacteria | 1135 |
| 345 | Ga0207691_10262981 | 3300025940 | Bacteria | 1487 |
| 346 | Ga0207691_11123067 | 3300025940 | Unclassified | 653 |
| 347 | Ga0207711_10839198 | 3300025941 | Unclassified | 855 |
| 348 | Ga0207711_10974386 | 3300025941 | Unclassified | 787 |
| 349 | Ga0207711_11352268 | 3300025941 | Bacteria | 655 |
| 350 | Ga0207689_10104155 | 3300025942 | Bacteria | 2331 |
| 351 | Ga0207689_10206714 | 3300025942 | Unclassified | 1621 |
| 352 | Ga0207689_11100667 | 3300025942 | Bacteria | 670 |
| 353 | Ga0207689_11749609 | 3300025942 | Unclassified | 514 |
| 354 | Ga0207661_10031692 | 3300025944 | Bacteria | 4088 |
| 355 | Ga0207679_10454835 | 3300025945 | Bacteria | 1136 |
| 356 | Ga0207679_10620512 | 3300025945 | Bacteria | 976 |
| 357 | Ga0207679_11255849 | 3300025945 | Bacteria | 680 |
| 358 | Ga0207679_11427447 | 3300025945 | Unclassified | 635 |
| 359 | Ga0207667_11571450 | 3300025949 | Bacteria | 627 |
| 360 | Ga0207651_10170326 | 3300025960 | Bacteria | 1717 |
| 361 | Ga0207651_11172626 | 3300025960 | Bacteria | 689 |
| 362 | Ga0207651_11249943 | 3300025960 | Bacteria | 667 |
| 363 | Ga0207712_10190025 | 3300025961 | Bacteria | 1620 |
| 364 | Ga0207712_10701817 | 3300025961 | Bacteria | 883 |
| 365 | Ga0207668_10275805 | 3300025972 | Unclassified | 1377 |
| 366 | Ga0207640_10461180 | 3300025981 | Bacteria | 1049 |
| 367 | Ga0207658_10286681 | 3300025986 | Bacteria | 1414 |
| 368 | Ga0207677_10186878 | 3300026023 | Bacteria | 1635 |
| 369 | Ga0207677_10252158 | 3300026023 | Bacteria | 1434 |
| 370 | Ga0207677_11282989 | 3300026023 | Bacteria | 672 |
| 371 | Ga0207703_10282483 | 3300026035 | Bacteria | 1508 |
| 372 | Ga0207703_10335297 | 3300026035 | Bacteria | 1388 |
| 373 | Ga0207678_10358509 | 3300026067 | Unclassified | 1258 |
| 374 | Ga0207678_10359135 | 3300026067 | Bacteria | 1257 |
| 375 | Ga0207678_10632593 | 3300026067 | Bacteria | 939 |
| 376 | Ga0207708_10064142 | 3300026075 | Bacteria | 2806 |
| 377 | Ga0207708_10088150 | 3300026075 | Unclassified | 2390 |
| 378 | Ga0207702_11537786 | 3300026078 | Bacteria | 659 |
| 379 | Ga0207702_12486550 | 3300026078 | Unclassified | 504 |
| 380 | Ga0207641_10749362 | 3300026088 | Bacteria | 964 |
| 381 | Ga0207648_10627129 | 3300026089 | Unclassified | 992 |
| 382 | Ga0207676_10943071 | 3300026095 | Unclassified | 848 |
| 383 | Ga0207674_10291038 | 3300026116 | Unclassified | 1582 |
| 384 | Ga0207674_10541147 | 3300026116 | Bacteria | 1125 |
| 385 | Ga0207675_100056385 | 3300026118 | Unclassified | 3665 |
| 386 | Ga0207675_100165518 | 3300026118 | Bacteria | 2111 |
| 387 | Ga0207675_100380762 | 3300026118 | Bacteria | 1387 |
| 388 | Ga0207675_100407480 | 3300026118 | Bacteria | 1341 |
| 389 | Ga0207683_10236508 | 3300026121 | Bacteria | 1666 |
| 390 | Ga0207683_11035925 | 3300026121 | Unclassified | 762 |
| 391 | Ga0209969_1011693 | 3300027360 | Bacteria | 1262 |
| 392 | Ga0209967_1053449 | 3300027364 | Bacteria | 622 |
| 393 | Ga0209999_1025683 | 3300027543 | Bacteria | 1088 |
| 394 | Ga0209999_1054665 | 3300027543 | Bacteria | 757 |
| 395 | Ga0209982_1038400 | 3300027552 | Bacteria | 761 |
| 396 | Ga0209970_1037555 | 3300027614 | Bacteria | 856 |
| 397 | Ga0210002_1048473 | 3300027617 | Bacteria | 729 |
| 398 | Ga0209971_1015251 | 3300027682 | Bacteria | 1822 |
| 399 | Ga0209998_10025660 | 3300027717 | Bacteria | 1284 |
| 400 | Ga0209974_10007200 | 3300027876 | Bacteria | 3844 |
| 401 | Ga0209974_10024990 | 3300027876 | Bacteria | 1978 |
| 402 | Ga0209974_10124732 | 3300027876 | Unclassified | 915 |
| 403 | Ga0209974_10223285 | 3300027876 | Bacteria | 702 |
| 404 | Ga0207428_10901352 | 3300027907 | Unclassified | 625 |
| 405 | Ga0268266_10336694 | 3300028379 | Bacteria | 1416 |
| 406 | Ga0268266_10860152 | 3300028379 | Bacteria | 877 |
| 407 | Ga0268265_10814442 | 3300028380 | Unclassified | 911 |
| 408 | Ga0268265_11143107 | 3300028380 | Unclassified | 774 |
| 409 | Ga0268265_12322053 | 3300028380 | Unclassified | 543 |
| 410 | Ga0268264_10370062 | 3300028381 | Bacteria | 1369 |
| 411 | Ga0268264_10694729 | 3300028381 | Bacteria | 1010 |
| 412 | Ga0268264_11406036 | 3300028381 | Unclassified | 708 |
| 413 | Ga0265326_10017144 | 3300028558 | Bacteria | 2090 |
| 414 | Ga0265326_10017361 | 3300028558 | Bacteria | 2077 |
| 415 | Ga0265319_1018940 | 3300028563 | Bacteria | 2581 |
| 416 | Ga0265319_1025736 | 3300028563 | Bacteria | 2103 |
| 417 | Ga0265319_1068039 | 3300028563 | Bacteria | 1144 |
| 418 | Ga0265334_10051883 | 3300028573 | Bacteria | 1571 |
| 419 | Ga0265318_10014595 | 3300028577 | Bacteria | 3294 |
| 420 | Ga0265318_10055515 | 3300028577 | Unclassified | 1482 |
| 421 | Ga0265322_10015283 | 3300028654 | Bacteria | 2218 |
| 422 | Ga0265336_10068404 | 3300028666 | Bacteria | 1062 |
| 423 | Ga0265336_10148994 | 3300028666 | Bacteria | 696 |
| 424 | Ga0265338_10081243 | 3300028800 | Bacteria | 2719 |
| 425 | Ga0265324_10029527 | 3300029957 | Bacteria | 1928 |
| 426 | Ga0265324_10029616 | 3300029957 | Bacteria | 1924 |
| 427 | Ga0265330_10021836 | 3300031235 | Bacteria | 2917 |
| 428 | Ga0265332_10068776 | 3300031238 | Bacteria | 1509 |
| 429 | Ga0265328_10056851 | 3300031239 | Bacteria | 1436 |
| 430 | Ga0265320_10006723 | 3300031240 | Bacteria | 7224 |
| 431 | Ga0265320_10190336 | 3300031240 | Unclassified | 918 |
| 432 | Ga0265320_10461507 | 3300031240 | Unclassified | 561 |
| 433 | Ga0265325_10049036 | 3300031241 | Bacteria | 2181 |
| 434 | Ga0265329_10019017 | 3300031242 | Bacteria | 2339 |
| 435 | Ga0265329_10288097 | 3300031242 | Unclassified | 553 |
| 436 | Ga0265340_10007891 | 3300031247 | Bacteria | 5770 |
| 437 | Ga0265339_10032283 | 3300031249 | Bacteria | 2954 |
| 438 | Ga0265339_10143483 | 3300031249 | Bacteria | 1213 |
| 439 | Ga0265331_10178871 | 3300031250 | Bacteria | 958 |
| 440 | Ga0265327_10492069 | 3300031251 | Bacteria | 529 |
| 441 | Ga0265316_10041086 | 3300031344 | Bacteria | 3704 |
| 442 | Ga0307408_100055316 | 3300031548 | Bacteria | 2873 |
| 443 | Ga0307408_100313043 | 3300031548 | Bacteria | 1320 |
| 444 | Ga0265313_10176809 | 3300031595 | Bacteria | 899 |
| 445 | Ga0265314_10008691 | 3300031711 | Bacteria | 8688 |
| 446 | Ga0265314_10238727 | 3300031711 | Bacteria | 1050 |
| 447 | Ga0265314_10572947 | 3300031711 | Bacteria | 585 |
| 448 | Ga0265342_10148793 | 3300031712 | Bacteria | 1301 |
| 449 | Ga0265342_10214278 | 3300031712 | Bacteria | 1040 |
| 450 | Ga0316576_10144964 | 3300031727 | Bacteria | 1788 |
| 451 | Ga0316576_10335011 | 3300031727 | Bacteria | 1127 |
| 452 | Ga0316576_10380568 | 3300031727 | Bacteria | 1048 |
| 453 | Ga0316576_10450811 | 3300031727 | Bacteria | 950 |
| 454 | Ga0316576_10874398 | 3300031727 | Bacteria | 644 |
| 455 | Ga0316576_11249879 | 3300031727 | Unclassified | 523 |
| 456 | Ga0316578_10093808 | 3300031728 | Bacteria | 1795 |
| 457 | Ga0316578_10517890 | 3300031728 | Bacteria | 702 |
| 458 | Ga0316577_10573927 | 3300031733 | Bacteria | 642 |
| 459 | Ga0307413_11170300 | 3300031824 | Bacteria | 667 |
| 460 | Ga0307413_11192463 | 3300031824 | Bacteria | 662 |
| 461 | Ga0307413_11982279 | 3300031824 | Bacteria | 524 |
| 462 | Ga0307410_10337202 | 3300031852 | Bacteria | 1201 |
| 463 | Ga0307406_10699651 | 3300031901 | Bacteria | 846 |
| 464 | Ga0307406_11317025 | 3300031901 | Unclassified | 631 |
| 465 | Ga0307406_11405444 | 3300031901 | Unclassified | 612 |
| 466 | Ga0307407_10078714 | 3300031903 | Bacteria | 1987 |
| 467 | Ga0307407_10284317 | 3300031903 | Bacteria | 1147 |
| 468 | Ga0307412_10149157 | 3300031911 | Bacteria | 1723 |
| 469 | Ga0307409_100186852 | 3300031995 | Bacteria | 1840 |
| 470 | Ga0307409_100454399 | 3300031995 | Bacteria | 1237 |
| 471 | Ga0307409_101030426 | 3300031995 | Bacteria | 842 |
| 472 | Ga0307416_100288728 | 3300032002 | Bacteria | 1622 |
| 473 | Ga0307416_100619905 | 3300032002 | Bacteria | 1164 |
| 474 | Ga0307416_101769185 | 3300032002 | Bacteria | 722 |
| 475 | Ga0307414_11665169 | 3300032004 | Bacteria | 595 |
| 476 | Ga0307411_10607518 | 3300032005 | Bacteria | 941 |
| 477 | Ga0307415_101452896 | 3300032126 | Unclassified | 654 |
| 478 | Ga0316580_10093317 | 3300032139 | Bacteria | 921 |
| 479 | Ga0373959_0148806 | 3300034820 | Unclassified | 591 |
| 480 | Ga0373940_0180769 | 3300035088 | Bacteria | 686 |
| 481 | Ga0373944_0207229 | 3300035089 | Unclassified | 712 |
| 482 | Ga0373939_0264485 | 3300035114 | Bacteria | 674 |
| 483 | Ga0373941_0254542 | 3300035115 | Unclassified | 687 |
| 484 | Ga0373943_0226036 | 3300035170 | Bacteria | 1044 |
| 485 | Ga0373946_0371911 | 3300035171 | Bacteria | 718 |
| 486 | Ga0373942_0189300 | 3300035207 | Unclassified | 678 |
| 487 | Ga0316574_0020968 | 3300035398 | Bacteria | 3874 |
| 488 | Ga0316574_0055699 | 3300035398 | Bacteria | 2472 |
| 489 | Ga0316574_0142067 | 3300035398 | Bacteria | 1547 |
| 490 | Ga0316574_0412510 | 3300035398 | Unclassified | 849 |
| 491 | Ga0316574_0983273 | 3300035398 | Unclassified | 508 |
| 492 | Ga0373933_0333407 | 3300035724 | Unclassified | 984 |
| 493 | Ga0373937_1486402 | 3300036401 | Bacteria | 625 |
| 494 | Ga0373937_2176112 | 3300036401 | Unclassified | 501 |
| 495 | Ga0316582_0933447 | 3300036647 | Unclassified | 593 |
| 496 | Ga0316584_0423752 | 3300036712 | Bacteria | 945 |
| 497 | Ga0373925_0388707 | 3300037068 | Bacteria | 1137 |
| 498 | Ga0373925_0742697 | 3300037068 | Unclassified | 809 |
| 499 | Ga0395898_1848663 | 3300037466 | Unclassified | 525 |
| 500 | Ga0395905_0777443 | 3300037471 | Bacteria | 860 |
| 501 | Ga0395901_0143075 | 3300038443 | Bacteria | 2514 |
| 502 | Ga0395901_0432206 | 3300038443 | Bacteria | 1349 |
| 503 | Ga0436365_1327079 | 3300039437 | Bacteria | 2188 |
| 504 | Ga0439438_021492 | 3300041405 | Bacteria | 1799 |
| 505 | Ga0439465_0088365 | 3300041413 | Unclassified | 1058 |
| 506 | Ga0451789_0323185 | 3300041443 | Bacteria | 633 |
| 507 | Ga0451789_0528683 | 3300041443 | Bacteria | 503 |
| 508 | Ga0451789_0653877 | 3300041443 | Unclassified | 631 |
| 509 | Ga0451791_1265390 | 3300041451 | Unclassified | 554 |
| 510 | Ga0451791_1747616 | 3300041451 | Unclassified | 645 |
| 511 | Ga0451795_0103689 | 3300041456 | Bacteria | 751 |
| 512 | Ga0451795_0972122 | 3300041456 | Unclassified | 627 |
| 513 | Ga0451798_0337047 | 3300041458 | Unclassified | 510 |
| 514 | Ga0451798_0586076 | 3300041458 | Bacteria | 705 |
| 515 | Ga0451800_0357053 | 3300041459 | Bacteria | 598 |
| 516 | Ga0451800_1476927 | 3300041459 | Unclassified | 517 |
| 517 | Ga0451802_1412359 | 3300041460 | Unclassified | 579 |
| 518 | Ga0451807_0662033 | 3300041486 | Unclassified | 561 |
| 519 | Ga0451807_1530479 | 3300041486 | Unclassified | 621 |
| 520 | Ga0451833_1158777 | 3300041491 | Bacteria | 602 |
| 521 | Ga0451835_0733639 | 3300041492 | Unclassified | 654 |
| 522 | Ga0451835_0890026 | 3300041492 | Bacteria | 785 |
| 523 | Ga0451837_0893743 | 3300041494 | Unclassified | 514 |
| 524 | Ga0451845_0609566 | 3300041501 | Bacteria | 1301 |
| 525 | Ga0451847_0301760 | 3300041503 | Bacteria | 707 |
| 526 | Ga0451847_0317160 | 3300041503 | Bacteria | 786 |
| 527 | Ga0451849_0634368 | 3300041505 | Bacteria | 747 |
| 528 | Ga0451851_1235874 | 3300041507 | Unclassified | 635 |
| 529 | Ga0451843_0672467 | 3300041509 | Unclassified | 579 |
| 530 | Ga0451843_0675715 | 3300041509 | Unclassified | 591 |
| 531 | Ga0451853_0270328 | 3300041512 | Unclassified | 687 |
| 532 | Ga0451853_1662311 | 3300041512 | Bacteria | 517 |
| 533 | Ga0451853_1848738 | 3300041512 | Bacteria | 1818 |
| 534 | Ga0451853_2521620 | 3300041512 | Bacteria | 1322 |
| 535 | Ga0450917_015128 | 3300042120 | Bacteria | 650 |
| 536 | Ga0450920_047592 | 3300042122 | Bacteria | 858 |
| 537 | Ga0450920_102510 | 3300042122 | Bacteria | 595 |
| 538 | Ga0450923_072579 | 3300042125 | Bacteria | 765 |
| 539 | Ga0450905_051252 | 3300042142 | Bacteria | 674 |
| 540 | Ga0439446_0061058 | 3300042156 | Bacteria | 1140 |
| 541 | Ga0450908_086170 | 3300042184 | Unclassified | 567 |
| 542 | Ga0439459_0083697 | 3300042438 | Bacteria | 757 |
| 543 | Ga0439459_0155948 | 3300042438 | Unclassified | 600 |
| 544 | Ga0439464_0229469 | 3300042439 | Bacteria | 597 |
| 545 | Ga0451577_0348775 | 3300042876 | Bacteria | 1343 |
| 546 | Ga0453684_0757557 | 3300044712 | Bacteria | 1051 |
| 547 | Ga0453684_1234477 | 3300044712 | Unclassified | 783 |
| 548 | Ga0466967_0447823 | 3300045976 | Bacteria | 1262 |
| 549 | Ga0466967_1588406 | 3300045976 | Bacteria | 651 |
| 550 | Ga0495592_0620619 | 3300046454 | Bacteria | 658 |
| 551 | Ga0495603_0304825 | 3300046455 | Bacteria | 915 |
| 552 | Ga0495603_0884779 | 3300046455 | Unclassified | 508 |
| 553 | Ga0495629_0124149 | 3300046459 | Bacteria | 1799 |
| 554 | Ga0495629_0642939 | 3300046459 | Bacteria | 707 |
| 555 | Ga0495641_0165070 | 3300046461 | Archaea | 991 |
| 556 | Ga0495641_0192280 | 3300046461 | Bacteria | 915 |
| 557 | Ga0495641_0268407 | 3300046461 | Unclassified | 768 |
| 558 | Ga0495651_0067120 | 3300046462 | Bacteria | 2737 |
| 559 | Ga0495653_0126645 | 3300046463 | Bacteria | 1813 |
| 560 | Ga0495582_0435138 | 3300046473 | Bacteria | 757 |
| 561 | Ga0495584_0671863 | 3300046491 | Unclassified | 528 |
| 562 | Ga0495596_0390930 | 3300046500 | Unclassified | 542 |
| 563 | Ga0495596_0441377 | 3300046500 | Unclassified | 508 |
| 564 | Ga0495608_0218738 | 3300046511 | Bacteria | 1196 |
| 565 | Ga0495630_0265796 | 3300046517 | Bacteria | 1310 |
| 566 | Ga0495630_0957584 | 3300046517 | Bacteria | 651 |
| 567 | Ga0495644_0162426 | 3300046523 | Bacteria | 857 |
| 568 | Ga0495644_0431075 | 3300046523 | Unclassified | 524 |
| 569 | Ga0495663_0243622 | 3300046525 | Unclassified | 637 |
| 570 | Ga0495652_0678897 | 3300046529 | Bacteria | 695 |
| 571 | Ga0495654_0347450 | 3300046530 | Bacteria | 597 |
| 572 | Ga0495640_0220985 | 3300046533 | Bacteria | 1195 |
| 573 | Ga0495640_0791784 | 3300046533 | Bacteria | 565 |
| 574 | Ga0495587_0213248 | 3300046536 | Bacteria | 1090 |
| 575 | Ga0495622_0477425 | 3300046557 | Bacteria | 534 |
| 576 | Ga0495668_0778785 | 3300046616 | Unclassified | 530 |
| 577 | Ga0495634_0371101 | 3300046642 | Bacteria | 854 |
| 578 | Ga0495635_0819550 | 3300046663 | Bacteria | 599 |
| 579 | Ga0495588_0725618 | 3300046674 | Bacteria | 520 |
| 580 | Ga0495657_0125762 | 3300046675 | Bacteria | 1611 |
| 581 | Ga0495599_0146317 | 3300046678 | Bacteria | 1465 |
| 582 | Ga0495599_0601896 | 3300046678 | Bacteria | 640 |
| 583 | Ga0495623_0398368 | 3300046679 | Bacteria | 741 |
| 584 | Ga0495646_0621124 | 3300046680 | Unclassified | 548 |
| 585 | Ga0495646_0642063 | 3300046680 | Unclassified | 537 |
| 586 | Ga0495613_0709618 | 3300046689 | Bacteria | 662 |
| 587 | Ga0495624_0445319 | 3300046690 | Bacteria | 776 |
| 588 | Ga0495589_0409515 | 3300046794 | Bacteria | 622 |
| 589 | Ga0495600_0427973 | 3300046809 | Bacteria | 821 |
| 590 | Ga0495600_0953907 | 3300046809 | Bacteria | 504 |
| 591 | Ga0495604_0073110 | 3300047317 | Bacteria | 2589 |
| 592 | Ga0495604_0317637 | 3300047317 | Bacteria | 1042 |
| 593 | Ga0495674_0153246 | 3300047319 | Bacteria | 1932 |
| 594 | Ga0495674_1226604 | 3300047319 | Unclassified | 566 |
| 595 | Ga0495676_0614499 | 3300047321 | Bacteria | 707 |
| 596 | Ga0495680_0123783 | 3300047322 | Bacteria | 1907 |
| 597 | Ga0495680_0766468 | 3300047322 | Bacteria | 633 |
| 598 | Ga0495684_0770904 | 3300047471 | Bacteria | 631 |
| 599 | Ga0495602_0155815 | 3300048088 | Bacteria | 1789 |
| 600 | Ga0495602_0613368 | 3300048088 | Unclassified | 747 |
| 601 | Ga0495615_0124692 | 3300048090 | Bacteria | 748 |
| 602 | Ga0496100_0061762 | 3300048903 | Bacteria | 2470 |
| 603 | Ga0496100_0447553 | 3300048903 | Bacteria | 990 |
| 604 | Ga0496100_1362495 | 3300048903 | Bacteria | 560 |
| 605 | Ga0496100_1540054 | 3300048903 | Bacteria | 525 |
| 606 | Ga0496101_0842647 | 3300048904 | Unclassified | 722 |
| 607 | Ga0496102_0133261 | 3300048905 | Bacteria | 2327 |
| 608 | Ga0496102_0207816 | 3300048905 | Bacteria | 1846 |
| 609 | Ga0496102_0237478 | 3300048905 | Bacteria | 1719 |
| 610 | Ga0496103_0024446 | 3300048906 | Bacteria | 3648 |
| 611 | Ga0496103_0583647 | 3300048906 | Unclassified | 712 |
| 612 | Ga0496103_0872843 | 3300048906 | Bacteria | 565 |
| 613 | Ga0496103_0944352 | 3300048906 | Unclassified | 539 |
| 614 | Ga0496104_0046924 | 3300048907 | Bacteria | 4070 |
| 615 | Ga0496104_0066543 | 3300048907 | Bacteria | 3421 |
| 616 | Ga0496104_0094596 | 3300048907 | Bacteria | 2859 |
| 617 | Ga0496104_0350321 | 3300048907 | Bacteria | 1389 |
| 618 | Ga0496104_0460788 | 3300048907 | Bacteria | 1183 |
| 619 | Ga0496104_0567844 | 3300048907 | Bacteria | 1045 |
| 620 | Ga0496104_1243695 | 3300048907 | Bacteria | 648 |
| 621 | Ga0496104_1323867 | 3300048907 | Bacteria | 623 |
| 622 | Ga0496105_0002597 | 3300048908 | Bacteria | 13140 |
| 623 | Ga0496105_0042239 | 3300048908 | Bacteria | 3758 |
| 624 | Ga0496105_0097668 | 3300048908 | Bacteria | 2426 |
| 625 | Ga0496105_0177621 | 3300048908 | Bacteria | 1744 |
| 626 | Ga0496105_0447079 | 3300048908 | Unclassified | 1021 |
| 627 | Ga0496105_0882560 | 3300048908 | Unclassified | 675 |
| 628 | Ga0496106_0055775 | 3300048909 | Bacteria | 2987 |
| 629 | Ga0496106_0213159 | 3300048909 | Unclassified | 1539 |
| 630 | Ga0496106_0237637 | 3300048909 | Bacteria | 1456 |
| 631 | Ga0496106_0369054 | 3300048909 | Bacteria | 1153 |
| 632 | Ga0496107_0115298 | 3300048910 | Bacteria | 1977 |
| 633 | Ga0496107_0200805 | 3300048910 | Bacteria | 1482 |
| 634 | Ga0496107_0680425 | 3300048910 | Bacteria | 757 |
| 635 | Ga0496107_0749595 | 3300048910 | Unclassified | 717 |
| 636 | Ga0496108_0006839 | 3300048911 | Bacteria | 9228 |
| 637 | Ga0496108_0071246 | 3300048911 | Bacteria | 2932 |
| 638 | Ga0496108_0114365 | 3300048911 | Unclassified | 2310 |
| 639 | Ga0496108_0160962 | 3300048911 | Bacteria | 1940 |
| 640 | Ga0496108_0617352 | 3300048911 | Bacteria | 944 |
| 641 | Ga0496109_0008412 | 3300048912 | Bacteria | 8770 |
| 642 | Ga0496109_0037432 | 3300048912 | Bacteria | 4382 |
| 643 | Ga0496109_0150263 | 3300048912 | Bacteria | 2181 |
| 644 | Ga0496109_0270560 | 3300048912 | Bacteria | 1601 |
| 645 | Ga0496109_0283847 | 3300048912 | Bacteria | 1560 |
| 646 | Ga0496109_0291910 | 3300048912 | Bacteria | 1537 |
| 647 | Ga0496109_0383777 | 3300048912 | Bacteria | 1327 |
| 648 | Ga0496109_0548658 | 3300048912 | Bacteria | 1090 |
| 649 | Ga0496109_0781793 | 3300048912 | Bacteria | 893 |
| 650 | Ga0496109_0789241 | 3300048912 | Unclassified | 888 |
| 651 | Ga0496109_0962294 | 3300048912 | Bacteria | 791 |
| 652 | Ga0496109_1085625 | 3300048912 | Bacteria | 737 |
| 653 | Ga0496109_1570435 | 3300048912 | Bacteria | 592 |
| 654 | Ga0496110_0008071 | 3300048913 | Bacteria | 8451 |
| 655 | Ga0496110_0056181 | 3300048913 | Bacteria | 3464 |
| 656 | Ga0496110_0449310 | 3300048913 | Bacteria | 1175 |
| 657 | Ga0496110_0476183 | 3300048913 | Bacteria | 1137 |
| 658 | Ga0496110_1615089 | 3300048913 | Bacteria | 558 |
| 659 | Ga0496110_1792140 | 3300048913 | Unclassified | 524 |
| 660 | Ga0496111_0013856 | 3300048914 | Bacteria | 5499 |
| 661 | Ga0496111_0025396 | 3300048914 | Bacteria | 4181 |
| 662 | Ga0496111_0065134 | 3300048914 | Bacteria | 2645 |
| 663 | Ga0496111_0395242 | 3300048914 | Bacteria | 1022 |
| 664 | Ga0496111_0494794 | 3300048914 | Archaea | 900 |
| 665 | Ga0496111_0587337 | 3300048914 | Bacteria | 816 |
| 666 | Ga0496112_0017218 | 3300048915 | Bacteria | 6785 |
| 667 | Ga0496112_0175273 | 3300048915 | Bacteria | 2109 |
| 668 | Ga0496112_0465452 | 3300048915 | Bacteria | 1202 |
| 669 | Ga0496112_0496630 | 3300048915 | Bacteria | 1156 |
| 670 | Ga0496112_0660558 | 3300048915 | Bacteria | 975 |
| 671 | Ga0496112_0751515 | 3300048915 | Bacteria | 901 |
| 672 | Ga0496113_0002757 | 3300048916 | Bacteria | 10328 |
| 673 | Ga0496113_0015627 | 3300048916 | Bacteria | 5226 |
| 674 | Ga0496113_0886602 | 3300048916 | Bacteria | 706 |
| 675 | Ga0496113_0980975 | 3300048916 | Bacteria | 666 |
| 676 | Ga0496114_0011503 | 3300048917 | Bacteria | 7075 |
| 677 | Ga0496114_0596139 | 3300048917 | Bacteria | 974 |
| 678 | Ga0496114_0700305 | 3300048917 | Bacteria | 888 |
| 679 | Ga0496114_1557605 | 3300048917 | Bacteria | 549 |
| 680 | Ga0496115_1284343 | 3300048918 | Bacteria | 546 |
| 681 | Ga0501031_0156694 | 3300049568 | Bacteria | 1488 |
| 682 | Ga0501032_0084805 | 3300049569 | Bacteria | 2106 |
| 683 | Ga0501032_0646036 | 3300049569 | Bacteria | 672 |
| 684 | Ga0501033_0047261 | 3300049570 | Bacteria | 3200 |
| 685 | Ga0501036_0045558 | 3300049572 | Bacteria | 3715 |
| 686 | Ga0501036_0839936 | 3300049572 | Bacteria | 755 |
| 687 | Ga0501037_0090686 | 3300049573 | Bacteria | 2210 |
| 688 | Ga0501038_0077983 | 3300049574 | Bacteria | 2796 |
| 689 | Ga0501039_0746748 | 3300049575 | Unclassified | 764 |
| 690 | Ga0501039_1302309 | 3300049575 | Unclassified | 560 |
| 691 | Ga0501040_0011475 | 3300049576 | Bacteria | 5800 |
| 692 | Ga0501041_0030322 | 3300049577 | Bacteria | 3264 |
| 693 | Ga0501042_0083940 | 3300049578 | Bacteria | 2283 |
| 694 | Ga0501042_1447475 | 3300049578 | Bacteria | 501 |
| 695 | Ga0501043_0235243 | 3300049579 | Bacteria | 1414 |
| 696 | Ga0501046_0302650 | 3300049580 | Bacteria | 1167 |
| 697 | Ga0501046_1102224 | 3300049580 | Bacteria | 548 |
| 698 | Ga0501047_1254366 | 3300049581 | Unclassified | 555 |
| 699 | Ga0501048_0083906 | 3300049582 | Bacteria | 2246 |
| 700 | Ga0501067_0096534 | 3300049583 | Bacteria | 1641 |
| 701 | Ga0501067_0123303 | 3300049583 | Bacteria | 1442 |
| 702 | Ga0501068_0009890 | 3300049584 | Bacteria | 5343 |
| 703 | Ga0501068_0027241 | 3300049584 | Bacteria | 3373 |
| 704 | Ga0501068_0345709 | 3300049584 | Unclassified | 956 |
| 705 | Ga0501068_0920330 | 3300049584 | Bacteria | 576 |
| 706 | Ga0501069_0007839 | 3300049585 | Bacteria | 5605 |
| 707 | Ga0501069_0169916 | 3300049585 | Bacteria | 1258 |
| 708 | Ga0501069_0459654 | 3300049585 | Unclassified | 757 |
| 709 | Ga0501070_0025181 | 3300049586 | Bacteria | 4990 |
| 710 | Ga0501070_0843626 | 3300049586 | Bacteria | 717 |
| 711 | Ga0501070_1314007 | 3300049586 | Bacteria | 552 |
| 712 | Ga0501071_0043038 | 3300049587 | Bacteria | 3236 |
| 713 | Ga0501071_0085787 | 3300049587 | Bacteria | 2309 |
| 714 | Ga0501071_0198653 | 3300049587 | Bacteria | 1506 |
| 715 | Ga0501071_0915291 | 3300049587 | Bacteria | 677 |
| 716 | Ga0501072_0348619 | 3300049588 | Bacteria | 1175 |
| 717 | Ga0501072_0492406 | 3300049588 | Unclassified | 970 |
| 718 | Ga0501072_0756852 | 3300049588 | Bacteria | 762 |
| 719 | Ga0501072_1045637 | 3300049588 | Unclassified | 636 |
| 720 | Ga0501073_0029621 | 3300049589 | Bacteria | 3911 |
| 721 | Ga0501073_0051430 | 3300049589 | Bacteria | 2886 |
| 722 | Ga0501073_0507541 | 3300049589 | Bacteria | 834 |
| 723 | Ga0501074_0040186 | 3300049590 | Bacteria | 3388 |
| 724 | Ga0501074_0385887 | 3300049590 | Bacteria | 994 |
| 725 | Ga0501075_0094997 | 3300049591 | Bacteria | 2262 |
| 726 | Ga0501075_0528008 | 3300049591 | Bacteria | 901 |
| 727 | Ga0501075_0919603 | 3300049591 | Bacteria | 665 |
| 728 | Ga0501075_1412366 | 3300049591 | Bacteria | 527 |
| 729 | Ga0501076_0071864 | 3300049592 | Bacteria | 2768 |
| 730 | Ga0501076_0154914 | 3300049592 | Bacteria | 1865 |
| 731 | Ga0501076_0215329 | 3300049592 | Unclassified | 1570 |
| 732 | Ga0501076_1478161 | 3300049592 | Bacteria | 558 |
| 733 | Ga0501076_1579702 | 3300049592 | Bacteria | 538 |
| 734 | Ga0501077_0014809 | 3300049593 | Bacteria | 4901 |
| 735 | Ga0501077_0155022 | 3300049593 | Bacteria | 1454 |
| 736 | Ga0501077_0191277 | 3300049593 | Bacteria | 1300 |
| 737 | Ga0501077_0425674 | 3300049593 | Bacteria | 849 |
| 738 | Ga0501236_126652 | 3300049670 | Unclassified | 523 |
| 739 | Ga0501225_0131801 | 3300049705 | Unclassified | 750 |
| 740 | Ga0501079_0067910 | 3300049741 | Bacteria | 2751 |
| 741 | Ga0501079_0176607 | 3300049741 | Unclassified | 1666 |
| 742 | Ga0501079_0276091 | 3300049741 | Bacteria | 1314 |
| 743 | Ga0501079_0738707 | 3300049741 | Bacteria | 775 |
| 744 | Ga0501080_0014339 | 3300049742 | Bacteria | 7298 |
| 745 | Ga0501080_0622121 | 3300049742 | Bacteria | 957 |
| 746 | Ga0501080_0751720 | 3300049742 | Bacteria | 857 |
| 747 | Ga0501080_1347477 | 3300049742 | Unclassified | 610 |
| 748 | Ga0501081_0024295 | 3300049743 | Bacteria | 4068 |
| 749 | Ga0501081_0300706 | 3300049743 | Bacteria | 1177 |
| 750 | Ga0501083_0072265 | 3300049744 | Bacteria | 2293 |
| 751 | Ga0501083_1044806 | 3300049744 | Unclassified | 532 |
| 752 | Ga0501035_0105606 | 3300049822 | Bacteria | 2469 |
| 753 | Ga0501044_0216183 | 3300049823 | Bacteria | 1869 |
| 754 | Ga0501045_0057888 | 3300049824 | Bacteria | 2836 |
| 755 | Ga0501045_0345524 | 3300049824 | Bacteria | 1107 |
| 756 | Ga0501045_0368453 | 3300049824 | Unclassified | 1069 |
| 757 | Ga0501045_0983932 | 3300049824 | Bacteria | 619 |
| 758 | nmdc:mga0yw44_465037_c1 | 3300050492 | Bacteria | 857 |
| 759 | nmdc:mga05p37_1245361_c1 | 3300050507 | Bacteria | 764 |
| 760 | nmdc:mga08y16_1129424_c1 | 3300050511 | Unclassified | 757 |
| 761 | nmdc:mga08y16_252140_c1 | 3300050511 | Unclassified | 1824 |
| 762 | nmdc:mga0n895_1091858_c1 | 3300050512 | Unclassified | 776 |
| 763 | nmdc:mga0n895_1536026_c1 | 3300050512 | Bacteria | 631 |
| 764 | nmdc:mga0n895_456992_c1 | 3300050512 | Bacteria | 1289 |
| 765 | nmdc:mga0n895_842348_c1 | 3300050512 | Bacteria | 905 |
| 766 | nmdc:mga0a205_208353_c1 | 3300050515 | Bacteria | 1844 |
| 767 | Ga0495601_0097169 | 3300053077 | Bacteria | 1900 |
| 768 | Ga0495601_0176162 | 3300053077 | Bacteria | 1398 |
| 769 | Ga0495601_0328334 | 3300053077 | Bacteria | 996 |
| 770 | Ga0495601_0992660 | 3300053077 | Unclassified | 528 |
| 771 | Ga0495612_0123898 | 3300053078 | Bacteria | 1113 |
| 772 | Ga0495612_0531947 | 3300053078 | Bacteria | 541 |
| 773 | Ga0495595_0098920 | 3300053084 | Bacteria | 1406 |
| 774 | Ga0495595_0152185 | 3300053084 | Bacteria | 1139 |
| 775 | Ga0495619_0085131 | 3300053085 | Bacteria | 2134 |
| 776 | Ga0495619_1072401 | 3300053085 | Bacteria | 537 |
| 777 | Ga0501084_0019085 | 3300054114 | Bacteria | 5710 |
| 778 | Ga0501084_0022038 | 3300054114 | Bacteria | 5314 |
| 779 | Ga0501084_0385044 | 3300054114 | Bacteria | 1185 |
| 780 | Ga0590071_000361 | 3300059421 | Bacteria | 13441 |
| 781 | Ga0590074_013458 | 3300059423 | Bacteria | 1382 |
| 782 | Ga0590075_025319 | 3300059424 | Bacteria | 1491 |
| 783 | Ga0590077_049557 | 3300059426 | Bacteria | 941 |
| 784 | Ga0501082_0015203 | 3300060353 | Bacteria | 6631 |
| 785 | Ga0501082_0300177 | 3300060353 | Bacteria | 1399 |
| 786 | Ga0501082_0785130 | 3300060353 | Bacteria | 833 |
| 787 | Ga0501082_1136965 | 3300060353 | Unclassified | 683 |
| 788 | Ga0501082_1741490 | 3300060353 | Bacteria | 544 |
| 789 | Ga0530510_0100433 | 3300061734 | Bacteria | 2115 |
| 790 | Ga0496113_0837235 | |||
| 791 | rootH1_10157696 | |||
| 792 | JGI26145J50221_1028579 | |||
| 793 | Ga0070683_101137033 | |||
| 794 | Ga0070690_100162838 | |||
| 795 | Ga0068869_100213113 | |||
| 796 | Ga0068869_100619429 | |||
| 797 | Ga0068869_101949401 | |||
| 798 | Ga0070666_11210312 | |||
| 799 | Ga0070680_101234719 | |||
| 800 | Ga0070680_101879618 | |||
| 801 | Ga0070682_100304562 | |||
| 802 | Ga0070682_100422191 | |||
| 803 | Ga0070682_100630603 | |||
| 804 | Ga0070682_100807481 | |||
| 805 | Ga0068868_100303478 | |||
| 806 | Ga0068868_100343690 | |||
| 807 | Ga0068868_101748688 | |||
| 808 | Ga0068868_102312409 | |||
| 809 | Ga0070660_101639436 | |||
| 810 | Ga0070689_100329303 | |||
| 811 | Ga0070689_100703083 | |||
| 812 | Ga0070691_10346454 | |||
| 813 | Ga0070691_10595039 | |||
| 814 | Ga0070687_100506250 | |||
| 815 | Ga0070687_100513956 | |||
| 816 | Ga0070692_10138052 | |||
| 817 | Ga0070692_11223711 | |||
| 818 | Ga0070668_100119053 | |||
| 819 | Ga0070668_102036436 | |||
| 820 | Ga0070669_100881687 | |||
| 821 | Ga0070675_100118163 | |||
| 822 | Ga0070674_100211680 | |||
| 823 | Ga0070674_100755724 | |||
| 824 | Ga0070674_101908963 | |||
| 825 | Ga0070674_102190320 | |||
| 826 | Ga0070688_100763042 | |||
| 827 | Ga0070659_100645998 | |||
| 828 | Ga0070659_100824095 | |||
| 829 | Ga0070659_101518565 | |||
| 830 | Ga0070659_101622027 | |||
| 831 | Ga0070703_10048661 | |||
| 832 | Ga0070713_101155793 | |||
| 833 | Ga0070701_10369643 | |||
| 834 | Ga0070701_11229294 | |||
| 835 | Ga0070711_101446082 | |||
| 836 | Ga0070705_100006371 | |||
| 837 | Ga0070705_100147212 | |||
| 838 | Ga0070705_100186422 | |||
| 839 | Ga0070705_100381195 | |||
| 840 | Ga0070705_100700150 | |||
| 841 | Ga0070705_101506305 | |||
| 842 | Ga0070705_101536020 | |||
| 843 | Ga0070700_100087436 | |||
| 844 | Ga0070700_101478717 | |||
| 845 | Ga0070694_100251213 | |||
| 846 | Ga0070694_101032139 | |||
| 847 | Ga0070708_100031785 | |||
| 848 | Ga0070708_100081050 | |||
| 849 | Ga0070708_100098081 | |||
| 850 | Ga0070708_100255794 | |||
| 851 | Ga0070708_100296970 | |||
| 852 | Ga0070663_100358897 | |||
| 853 | Ga0070663_100426467 | |||
| 854 | Ga0070663_101982048 | |||
| 855 | Ga0070678_100137109 | |||
| 856 | Ga0070678_100666798 | |||
| 857 | Ga0070678_101901729 | |||
| 858 | Ga0070678_101904831 | |||
| 859 | Ga0070678_102350585 | |||
| 860 | Ga0070662_100360177 | |||
| 861 | Ga0070662_100667761 | |||
| 862 | Ga0070662_101119165 | |||
| 863 | Ga0070681_10118781 | |||
| 864 | Ga0070681_11249505 | |||
| 865 | Ga0068867_100177862 | |||
| 866 | Ga0068867_102076896 | |||
| 867 | Ga0070685_10307305 | |||
| 868 | Ga0070706_100031239 | |||
| 869 | Ga0070706_100039807 | |||
| 870 | Ga0070706_100971455 | |||
| 871 | Ga0070707_100002066 | |||
| 872 | Ga0070707_100030411 | |||
| 873 | Ga0070707_100519669 | |||
| 874 | Ga0070698_100008917 | |||
| 875 | Ga0070698_100256615 | |||
| 876 | Ga0070698_100429182 | |||
| 877 | Ga0070698_100869462 | |||
| 878 | Ga0070698_100950766 | |||
| 879 | Ga0070698_101054227 | |||
| 880 | Ga0070698_101731467 | |||
| 881 | Ga0074259_10302601 | |||
| 882 | Ga0070699_100003085 | |||
| 883 | Ga0070699_100024566 | |||
| 884 | Ga0070699_100114487 | |||
| 885 | Ga0070699_100150701 | |||
| 886 | Ga0070699_100351520 | |||
| 887 | Ga0070699_100418613 | |||
| 888 | Ga0070699_100536288 | |||
| 889 | Ga0070684_100054257 | |||
| 890 | Ga0070684_100125386 | |||
| 891 | Ga0070684_101027147 | |||
| 892 | Ga0070684_101045556 | |||
| 893 | Ga0070684_101138352 | |||
| 894 | Ga0070684_101578850 | |||
| 895 | Ga0070697_100013873 | |||
| 896 | Ga0070697_100030499 | |||
| 897 | Ga0070697_100637984 | |||
| 898 | Ga0070697_101188043 | |||
| 899 | Ga0070672_101730801 | |||
| 900 | Ga0070686_100117562 | |||
| 901 | Ga0070686_100291795 | |||
| 902 | Ga0070686_101043167 | |||
| 903 | Ga0070695_100014873 | |||
| 904 | Ga0070695_100215840 | |||
| 905 | Ga0070696_100063072 | |||
| 906 | Ga0070696_100142282 | |||
| 907 | Ga0070696_100233164 | |||
| 908 | Ga0070696_100340147 | |||
| 909 | Ga0070665_101424253 | |||
| 910 | Ga0070665_101785379 | |||
| 911 | Ga0070704_100017007 | |||
| 912 | Ga0070704_100091874 | |||
| 913 | Ga0070704_100295985 | |||
| 914 | Ga0068855_100644188 | |||
| 915 | Ga0068855_100966083 | |||
| 916 | Ga0070664_100303691 | |||
| 917 | Ga0070664_100604600 | |||
| 918 | Ga0070664_101438877 | |||
| 919 | Ga0068857_100298241 | |||
| 920 | Ga0068857_101447239 | |||
| 921 | Ga0068854_100664394 | |||
| 922 | Ga0068854_101783961 | |||
| 923 | Ga0068854_102176524 | |||
| 924 | Ga0068856_101059007 | |||
| 925 | Ga0068856_102255987 | |||
| 926 | Ga0070702_100031503 | |||
| 927 | Ga0070702_100484524 | |||
| 928 | Ga0070702_100494497 | |||
| 929 | Ga0070702_100572184 | |||
| 930 | Ga0070702_100788537 | |||
| 931 | Ga0068852_100399431 | |||
| 932 | Ga0068852_101274056 | |||
| 933 | Ga0068852_101391007 | |||
| 934 | Ga0068859_100858088 | |||
| 935 | Ga0068859_100970014 | |||
| 936 | Ga0068864_100524997 | |||
| 937 | Ga0068864_100869789 | |||
| 938 | Ga0068861_100469974 | |||
| 939 | Ga0068861_101072892 | |||
| 940 | Ga0068861_101623214 | |||
| 941 | Ga0068870_10592886 | |||
| 942 | Ga0068863_100948821 | |||
| 943 | Ga0068863_101315393 | |||
| 944 | Ga0068858_100564849 | |||
| 945 | Ga0068860_100068341 | |||
| 946 | Ga0068860_101124445 | |||
| 947 | Ga0068860_102568742 | |||
| 948 | Ga0068862_100368938 | |||
| 949 | Ga0068862_100819038 | |||
| 950 | Ga0068862_101639573 | |||
| 951 | Ga0068862_101878556 | |||
| 952 | Ga0081455_10084938 | |||
| 953 | Ga0081455_10884792 | |||
| 954 | Ga0081539_10002566 | |||
| 955 | Ga0081539_10010249 | |||
| 956 | Ga0075365_10458721 | |||
| 957 | Ga0097621_100220658 | |||
| 958 | Ga0097621_100961684 | |||
| 959 | Ga0097621_102222395 | |||
| 960 | Ga0068871_100389604 | |||
| 961 | Ga0068871_100889947 | |||
| 962 | Ga0068871_101642960 | |||
| 963 | Ga0075428_100455819 | |||
| 964 | Ga0075428_101363035 | |||
| 965 | Ga0075433_10972437 | |||
| 966 | Ga0075433_11556299 | |||
| 967 | Ga0075434_100981082 | |||
| 968 | Ga0068865_100992158 | |||
| 969 | Ga0068865_101346016 | |||
| 970 | Ga0097620_100858046 | |||
| 971 | Ga0097620_100970031 | |||
| 972 | Ga0075435_100078495 | |||
| 973 | Ga0099795_10411904 | |||
| 974 | Ga0105240_11194886 | |||
| 975 | Ga0105240_12619602 | |||
| 976 | Ga0111539_10442144 | |||
| 977 | Ga0111539_12677273 | |||
| 978 | Ga0111539_13044534 | |||
| 979 | Ga0111539_13376509 | |||
| 980 | Ga0105245_10038106 | |||
| 981 | Ga0105245_10110314 | |||
| 982 | Ga0105245_10453387 | |||
| 983 | Ga0105245_10461604 | |||
| 984 | Ga0105245_10585721 | |||
| 985 | Ga0105245_10799268 | |||
| 986 | Ga0105245_10931860 | |||
| 987 | Ga0105247_10268289 | |||
| 988 | Ga0105247_11089853 | |||
| 989 | Ga0105247_11248700 | |||
| 990 | Ga0114129_10158105 | |||
| 991 | Ga0114129_11350658 | |||
| 992 | Ga0114129_11650786 | |||
| 993 | Ga0114129_11964261 | |||
| 994 | Ga0105243_10681055 | |||
| 995 | Ga0105243_11062964 | |||
| 996 | Ga0105243_11465847 | |||
| 997 | Ga0105243_12269359 | |||
| 998 | Ga0105243_12336287 | |||
| 999 | Ga0105243_12749649 | |||
| 1000 | Ga0105241_10231991 | |||
| 1001 | Ga0105242_10595362 | |||
| 1002 | Ga0105242_10705201 | |||
| 1003 | Ga0105242_11092999 | |||
| 1004 | Ga0105242_11242266 | |||
| 1005 | Ga0105242_11682104 | |||
| 1006 | Ga0105242_11849749 | |||
| 1007 | Ga0105242_13142544 | |||
| 1008 | Ga0105248_10768422 | |||
| 1009 | Ga0105248_10904260 | |||
| 1010 | Ga0105248_11880529 | |||
| 1011 | Ga0105248_11956902 | |||
| 1012 | Ga0105248_12578717 | |||
| 1013 | Ga0105237_11502566 | |||
| 1014 | Ga0105237_12069695 | |||
| 1015 | Ga0105238_11022022 | |||
| 1016 | Ga0105238_12638707 | |||
| 1017 | Ga0105249_10436356 | |||
| 1018 | Ga0105249_10994895 | |||
| 1019 | Ga0105249_11078593 | |||
| 1020 | Ga0105249_11667097 | |||
| 1021 | Ga0099796_10221781 | |||
| 1022 | Ga0105239_10916678 | |||
| 1023 | Ga0105239_10967373 | |||
| 1024 | Ga0105239_11263768 | |||
| 1025 | Ga0105239_11473060 | |||
| 1026 | Ga0105239_12136590 | |||
| 1027 | Ga0105239_12423584 | |||
| 1028 | Ga0105246_10634501 | |||
| 1029 | Ga0105246_10774859 | |||
| 1030 | Ga0105246_11255465 | |||
| 1031 | Ga0105246_11454867 | |||
| 1032 | Ga0105246_11678034 | |||
| 1033 | Ga0157336_1023706 | |||
| 1034 | Ga0157373_11057963 | |||
| 1035 | Ga0157371_10645750 | |||
| 1036 | Ga0157370_11746041 | |||
| 1037 | Ga0157374_10409772 | |||
| 1038 | Ga0157374_12917193 | |||
| 1039 | Ga0157378_10665108 | |||
| 1040 | Ga0157378_10758128 | |||
| 1041 | Ga0157378_10870841 | |||
| 1042 | Ga0157378_11101058 | |||
| 1043 | Ga0157378_11446281 | |||
| 1044 | Ga0163162_10833060 | |||
| 1045 | Ga0163162_13062611 | |||
| 1046 | Ga0157372_11483101 | |||
| 1047 | Ga0157372_11688326 | |||
| 1048 | Ga0157372_11706382 | |||
| 1049 | Ga0157375_10025096 | |||
| 1050 | Ga0157375_10937897 | |||
| 1051 | Ga0157375_10972350 | |||
| 1052 | Ga0157375_11395445 | |||
| 1053 | Ga0163163_10136303 | |||
| 1054 | Ga0163163_10144839 | |||
| 1055 | Ga0163163_10481848 | |||
| 1056 | Ga0163163_10647132 | |||
| 1057 | Ga0163163_11392116 | |||
| 1058 | Ga0163163_12442350 | |||
| 1059 | Ga0157380_10209863 | |||
| 1060 | Ga0157380_10380833 | |||
| 1061 | Ga0157380_10553070 | |||
| 1062 | Ga0157380_12167743 | |||
| 1063 | Ga0157380_12729709 | |||
| 1064 | Ga0182008_10158029 | |||
| 1065 | Ga0182008_10410730 | |||
| 1066 | Ga0157377_10092905 | |||
| 1067 | Ga0157377_10622289 | |||
| 1068 | Ga0157377_10740093 | |||
| 1069 | Ga0157379_10084949 | |||
| 1070 | Ga0157379_10242292 | |||
| 1071 | Ga0157379_10516174 | |||
| 1072 | Ga0157379_10688588 | |||
| 1073 | Ga0157379_10783477 | |||
| 1074 | Ga0157379_11710499 | |||
| 1075 | Ga0157376_10209190 | |||
| 1076 | Ga0157376_10478014 | |||
| 1077 | Ga0157376_11427042 | |||
| 1078 | Ga0163161_10498275 | |||
| 1079 | Ga0207653_10241667 | |||
| 1080 | Ga0207682_10333845 | |||
| 1081 | Ga0207642_10502030 | |||
| 1082 | Ga0207688_10061004 | |||
| 1083 | Ga0207688_10428012 | |||
| 1084 | Ga0207680_10715607 | |||
| 1085 | Ga0207685_10869491 | |||
| 1086 | Ga0207645_10414809 | |||
| 1087 | Ga0207645_10781250 | |||
| 1088 | Ga0207643_10928625 | |||
| 1089 | Ga0207684_10015853 | |||
| 1090 | Ga0207684_10281704 | |||
| 1091 | Ga0207707_10733808 | |||
| 1092 | Ga0207660_10289694 | |||
| 1093 | Ga0207660_10504640 | |||
| 1094 | Ga0207662_10535121 | |||
| 1095 | Ga0207662_10843406 | |||
| 1096 | Ga0207657_10564807 | |||
| 1097 | Ga0207649_11205792 | |||
| 1098 | Ga0207652_10077275 | |||
| 1099 | Ga0207652_10209060 | |||
| 1100 | Ga0207646_10003504 | |||
| 1101 | Ga0207646_10009489 | |||
| 1102 | Ga0207646_10027778 | |||
| 1103 | Ga0207646_11052804 | |||
| 1104 | Ga0207681_11086841 | |||
| 1105 | Ga0207681_11349959 | |||
| 1106 | Ga0207650_10148708 | |||
| 1107 | Ga0207650_10550124 | |||
| 1108 | Ga0207659_10111281 | |||
| 1109 | Ga0207659_10573130 | |||
| 1110 | Ga0207659_11741059 | |||
| 1111 | Ga0207659_11886114 | |||
| 1112 | Ga0207687_10127984 | |||
| 1113 | Ga0207687_10421492 | |||
| 1114 | Ga0207687_10765920 | |||
| 1115 | Ga0207687_11114149 | |||
| 1116 | Ga0207690_10568556 | |||
| 1117 | Ga0207690_11121596 | |||
| 1118 | Ga0207690_11748686 | |||
| 1119 | Ga0207690_11815243 | |||
| 1120 | Ga0207706_10037897 | |||
| 1121 | Ga0207706_10761475 | |||
| 1122 | Ga0207706_10931655 | |||
| 1123 | Ga0207686_10319404 | |||
| 1124 | Ga0207686_10469233 | |||
| 1125 | Ga0207686_10892392 | |||
| 1126 | Ga0207709_11395402 | |||
| 1127 | Ga0207670_10108455 | |||
| 1128 | Ga0207669_11446879 | |||
| 1129 | Ga0207669_11724940 | |||
| 1130 | Ga0207704_10856771 | |||
| 1131 | Ga0207704_11385851 | |||
| 1132 | Ga0207665_10057653 | |||
| 1133 | Ga0207665_10337439 | |||
| 1134 | Ga0207691_10262981 | |||
| 1135 | Ga0207691_11123067 | |||
| 1136 | Ga0207711_10839198 | |||
| 1137 | Ga0207711_10974386 | |||
| 1138 | Ga0207711_11352268 | |||
| 1139 | Ga0207689_10104155 | |||
| 1140 | Ga0207689_10206714 | |||
| 1141 | Ga0207689_11100667 | |||
| 1142 | Ga0207689_11749609 | |||
| 1143 | Ga0207661_10031692 | |||
| 1144 | Ga0207679_10454835 | |||
| 1145 | Ga0207679_10620512 | |||
| 1146 | Ga0207679_11255849 | |||
| 1147 | Ga0207679_11427447 | |||
| 1148 | Ga0207667_11571450 | |||
| 1149 | Ga0207651_10170326 | |||
| 1150 | Ga0207651_11172626 | |||
| 1151 | Ga0207651_11249943 | |||
| 1152 | Ga0207712_10190025 | |||
| 1153 | Ga0207712_10701817 | |||
| 1154 | Ga0207668_10275805 | |||
| 1155 | Ga0207640_10461180 | |||
| 1156 | Ga0207658_10286681 | |||
| 1157 | Ga0207677_10186878 | |||
| 1158 | Ga0207677_10252158 | |||
| 1159 | Ga0207677_11282989 | |||
| 1160 | Ga0207703_10282483 | |||
| 1161 | Ga0207703_10335297 | |||
| 1162 | Ga0207678_10358509 | |||
| 1163 | Ga0207678_10359135 | |||
| 1164 | Ga0207678_10632593 | |||
| 1165 | Ga0207708_10064142 | |||
| 1166 | Ga0207708_10088150 | |||
| 1167 | Ga0207702_11537786 | |||
| 1168 | Ga0207702_12486550 | |||
| 1169 | Ga0207641_10749362 | |||
| 1170 | Ga0207648_10627129 | |||
| 1171 | Ga0207676_10943071 | |||
| 1172 | Ga0207674_10291038 | |||
| 1173 | Ga0207674_10541147 | |||
| 1174 | Ga0207675_100056385 | |||
| 1175 | Ga0207675_100165518 | |||
| 1176 | Ga0207675_100380762 | |||
| 1177 | Ga0207675_100407480 | |||
| 1178 | Ga0207683_10236508 | |||
| 1179 | Ga0207683_11035925 | |||
| 1180 | Ga0209969_1011693 | |||
| 1181 | Ga0209967_1053449 | |||
| 1182 | Ga0209999_1025683 | |||
| 1183 | Ga0209999_1054665 | |||
| 1184 | Ga0209982_1038400 | |||
| 1185 | Ga0209970_1037555 | |||
| 1186 | Ga0210002_1048473 | |||
| 1187 | Ga0209971_1015251 | |||
| 1188 | Ga0209998_10025660 | |||
| 1189 | Ga0209974_10007200 | |||
| 1190 | Ga0209974_10024990 | |||
| 1191 | Ga0209974_10124732 | |||
| 1192 | Ga0209974_10223285 | |||
| 1193 | Ga0207428_10901352 | |||
| 1194 | Ga0268266_10336694 | |||
| 1195 | Ga0268266_10860152 | |||
| 1196 | Ga0268265_10814442 | |||
| 1197 | Ga0268265_11143107 | |||
| 1198 | Ga0268265_12322053 | |||
| 1199 | Ga0268264_10370062 | |||
| 1200 | Ga0268264_10694729 | |||
| 1201 | Ga0268264_11406036 | |||
| 1202 | Ga0265326_10017144 | |||
| 1203 | Ga0265326_10017361 | |||
| 1204 | Ga0265319_1018940 | |||
| 1205 | Ga0265319_1025736 | |||
| 1206 | Ga0265319_1068039 | |||
| 1207 | Ga0265334_10051883 | |||
| 1208 | Ga0265318_10014595 | |||
| 1209 | Ga0265318_10055515 | |||
| 1210 | Ga0265322_10015283 | |||
| 1211 | Ga0265336_10068404 | |||
| 1212 | Ga0265336_10148994 | |||
| 1213 | Ga0265338_10081243 | |||
| 1214 | Ga0265324_10029527 | |||
| 1215 | Ga0265324_10029616 | |||
| 1216 | Ga0265330_10021836 | |||
| 1217 | Ga0265332_10068776 | |||
| 1218 | Ga0265328_10056851 | |||
| 1219 | Ga0265320_10006723 | |||
| 1220 | Ga0265320_10190336 | |||
| 1221 | Ga0265320_10461507 | |||
| 1222 | Ga0265325_10049036 | |||
| 1223 | Ga0265329_10019017 | |||
| 1224 | Ga0265329_10288097 | |||
| 1225 | Ga0265340_10007891 | |||
| 1226 | Ga0265339_10032283 | |||
| 1227 | Ga0265339_10143483 | |||
| 1228 | Ga0265331_10178871 | |||
| 1229 | Ga0265327_10492069 | |||
| 1230 | Ga0265316_10041086 | |||
| 1231 | Ga0307408_100055316 | |||
| 1232 | Ga0307408_100313043 | |||
| 1233 | Ga0265313_10176809 | |||
| 1234 | Ga0265314_10008691 | |||
| 1235 | Ga0265314_10238727 | |||
| 1236 | Ga0265314_10572947 | |||
| 1237 | Ga0265342_10148793 | |||
| 1238 | Ga0265342_10214278 | |||
| 1239 | Ga0316576_10144964 | |||
| 1240 | Ga0316576_10335011 | |||
| 1241 | Ga0316576_10380568 | |||
| 1242 | Ga0316576_10450811 | |||
| 1243 | Ga0316576_10874398 | |||
| 1244 | Ga0316576_11249879 | |||
| 1245 | Ga0316578_10093808 | |||
| 1246 | Ga0316578_10517890 | |||
| 1247 | Ga0316577_10573927 | |||
| 1248 | Ga0307413_11170300 | |||
| 1249 | Ga0307413_11192463 | |||
| 1250 | Ga0307413_11982279 | |||
| 1251 | Ga0307410_10337202 | |||
| 1252 | Ga0307406_10699651 | |||
| 1253 | Ga0307406_11317025 | |||
| 1254 | Ga0307406_11405444 | |||
| 1255 | Ga0307407_10078714 | |||
| 1256 | Ga0307407_10284317 | |||
| 1257 | Ga0307412_10149157 | |||
| 1258 | Ga0307409_100186852 | |||
| 1259 | Ga0307409_100454399 | |||
| 1260 | Ga0307409_101030426 | |||
| 1261 | Ga0307416_100288728 | |||
| 1262 | Ga0307416_100619905 | |||
| 1263 | Ga0307416_101769185 | |||
| 1264 | Ga0307414_11665169 | |||
| 1265 | Ga0307411_10607518 | |||
| 1266 | Ga0307415_101452896 | |||
| 1267 | Ga0316580_10093317 | |||
| 1268 | Ga0373959_0148806 | |||
| 1269 | Ga0373940_0180769 | |||
| 1270 | Ga0373944_0207229 | |||
| 1271 | Ga0373939_0264485 | |||
| 1272 | Ga0373941_0254542 | |||
| 1273 | Ga0373943_0226036 | |||
| 1274 | Ga0373946_0371911 | |||
| 1275 | Ga0373942_0189300 | |||
| 1276 | Ga0316574_0020968 | |||
| 1277 | Ga0316574_0055699 | |||
| 1278 | Ga0316574_0142067 | |||
| 1279 | Ga0316574_0412510 | |||
| 1280 | Ga0316574_0983273 | |||
| 1281 | Ga0373933_0333407 | |||
| 1282 | Ga0373937_1486402 | |||
| 1283 | Ga0373937_2176112 | |||
| 1284 | Ga0316582_0933447 | |||
| 1285 | Ga0316584_0423752 | |||
| 1286 | Ga0373925_0388707 | |||
| 1287 | Ga0373925_0742697 | |||
| 1288 | Ga0395898_1848663 | |||
| 1289 | Ga0395905_0777443 | |||
| 1290 | Ga0395901_0143075 | |||
| 1291 | Ga0395901_0432206 | |||
| 1292 | Ga0436365_1327079 | |||
| 1293 | Ga0439438_021492 | |||
| 1294 | Ga0439465_0088365 | |||
| 1295 | Ga0451789_0323185 | |||
| 1296 | Ga0451789_0528683 | |||
| 1297 | Ga0451789_0653877 | |||
| 1298 | Ga0451791_1265390 | |||
| 1299 | Ga0451791_1747616 | |||
| 1300 | Ga0451795_0103689 | |||
| 1301 | Ga0451795_0972122 | |||
| 1302 | Ga0451798_0337047 | |||
| 1303 | Ga0451798_0586076 | |||
| 1304 | Ga0451800_0357053 | |||
| 1305 | Ga0451800_1476927 | |||
| 1306 | Ga0451802_1412359 | |||
| 1307 | Ga0451807_0662033 | |||
| 1308 | Ga0451807_1530479 | |||
| 1309 | Ga0451833_1158777 | |||
| 1310 | Ga0451835_0733639 | |||
| 1311 | Ga0451835_0890026 | |||
| 1312 | Ga0451837_0893743 | |||
| 1313 | Ga0451845_0609566 | |||
| 1314 | Ga0451847_0301760 | |||
| 1315 | Ga0451847_0317160 | |||
| 1316 | Ga0451849_0634368 | |||
| 1317 | Ga0451851_1235874 | |||
| 1318 | Ga0451843_0672467 | |||
| 1319 | Ga0451843_0675715 | |||
| 1320 | Ga0451853_0270328 | |||
| 1321 | Ga0451853_1662311 | |||
| 1322 | Ga0451853_1848738 | |||
| 1323 | Ga0451853_2521620 | |||
| 1324 | Ga0450917_015128 | |||
| 1325 | Ga0450920_047592 | |||
| 1326 | Ga0450920_102510 | |||
| 1327 | Ga0450923_072579 | |||
| 1328 | Ga0450905_051252 | |||
| 1329 | Ga0439446_0061058 | |||
| 1330 | Ga0450908_086170 | |||
| 1331 | Ga0439459_0083697 | |||
| 1332 | Ga0439459_0155948 | |||
| 1333 | Ga0439464_0229469 | |||
| 1334 | Ga0451577_0348775 | |||
| 1335 | Ga0453684_0757557 | |||
| 1336 | Ga0453684_1234477 | |||
| 1337 | Ga0466967_0447823 | |||
| 1338 | Ga0466967_1588406 | |||
| 1339 | Ga0495592_0620619 | |||
| 1340 | Ga0495603_0304825 | |||
| 1341 | Ga0495603_0884779 | |||
| 1342 | Ga0495629_0124149 | |||
| 1343 | Ga0495629_0642939 | |||
| 1344 | Ga0495641_0165070 | |||
| 1345 | Ga0495641_0192280 | |||
| 1346 | Ga0495641_0268407 | |||
| 1347 | Ga0495651_0067120 | |||
| 1348 | Ga0495653_0126645 | |||
| 1349 | Ga0495582_0435138 | |||
| 1350 | Ga0495584_0671863 | |||
| 1351 | Ga0495596_0390930 | |||
| 1352 | Ga0495596_0441377 | |||
| 1353 | Ga0495608_0218738 | |||
| 1354 | Ga0495630_0265796 | |||
| 1355 | Ga0495630_0957584 | |||
| 1356 | Ga0495644_0162426 | |||
| 1357 | Ga0495644_0431075 | |||
| 1358 | Ga0495663_0243622 | |||
| 1359 | Ga0495652_0678897 | |||
| 1360 | Ga0495654_0347450 | |||
| 1361 | Ga0495640_0220985 | |||
| 1362 | Ga0495640_0791784 | |||
| 1363 | Ga0495587_0213248 | |||
| 1364 | Ga0495622_0477425 | |||
| 1365 | Ga0495668_0778785 | |||
| 1366 | Ga0495634_0371101 | |||
| 1367 | Ga0495635_0819550 | |||
| 1368 | Ga0495588_0725618 | |||
| 1369 | Ga0495657_0125762 | |||
| 1370 | Ga0495599_0146317 | |||
| 1371 | Ga0495599_0601896 | |||
| 1372 | Ga0495623_0398368 | |||
| 1373 | Ga0495646_0621124 | |||
| 1374 | Ga0495646_0642063 | |||
| 1375 | Ga0495613_0709618 | |||
| 1376 | Ga0495624_0445319 | |||
| 1377 | Ga0495589_0409515 | |||
| 1378 | Ga0495600_0427973 | |||
| 1379 | Ga0495600_0953907 | |||
| 1380 | Ga0495604_0073110 | |||
| 1381 | Ga0495604_0317637 | |||
| 1382 | Ga0495674_0153246 | |||
| 1383 | Ga0495674_1226604 | |||
| 1384 | Ga0495676_0614499 | |||
| 1385 | Ga0495680_0123783 | |||
| 1386 | Ga0495680_0766468 | |||
| 1387 | Ga0495684_0770904 | |||
| 1388 | Ga0495602_0155815 | |||
| 1389 | Ga0495602_0613368 | |||
| 1390 | Ga0495615_0124692 | |||
| 1391 | Ga0496100_0061762 | |||
| 1392 | Ga0496100_0447553 | |||
| 1393 | Ga0496100_1362495 | |||
| 1394 | Ga0496100_1540054 | |||
| 1395 | Ga0496101_0842647 | |||
| 1396 | Ga0496102_0133261 | |||
| 1397 | Ga0496102_0207816 | |||
| 1398 | Ga0496102_0237478 | |||
| 1399 | Ga0496103_0024446 | |||
| 1400 | Ga0496103_0583647 | |||
| 1401 | Ga0496103_0872843 | |||
| 1402 | Ga0496103_0944352 | |||
| 1403 | Ga0496104_0046924 | |||
| 1404 | Ga0496104_0066543 | |||
| 1405 | Ga0496104_0094596 | |||
| 1406 | Ga0496104_0350321 | |||
| 1407 | Ga0496104_0460788 | |||
| 1408 | Ga0496104_0567844 | |||
| 1409 | Ga0496104_1243695 | |||
| 1410 | Ga0496104_1323867 | |||
| 1411 | Ga0496105_0002597 | |||
| 1412 | Ga0496105_0042239 | |||
| 1413 | Ga0496105_0097668 | |||
| 1414 | Ga0496105_0177621 | |||
| 1415 | Ga0496105_0447079 | |||
| 1416 | Ga0496105_0882560 | |||
| 1417 | Ga0496106_0055775 | |||
| 1418 | Ga0496106_0213159 | |||
| 1419 | Ga0496106_0237637 | |||
| 1420 | Ga0496106_0369054 | |||
| 1421 | Ga0496107_0115298 | |||
| 1422 | Ga0496107_0200805 | |||
| 1423 | Ga0496107_0680425 | |||
| 1424 | Ga0496107_0749595 | |||
| 1425 | Ga0496108_0006839 | |||
| 1426 | Ga0496108_0071246 | |||
| 1427 | Ga0496108_0114365 | |||
| 1428 | Ga0496108_0160962 | |||
| 1429 | Ga0496108_0617352 | |||
| 1430 | Ga0496109_0008412 | |||
| 1431 | Ga0496109_0037432 | |||
| 1432 | Ga0496109_0150263 | |||
| 1433 | Ga0496109_0270560 | |||
| 1434 | Ga0496109_0283847 | |||
| 1435 | Ga0496109_0291910 | |||
| 1436 | Ga0496109_0383777 | |||
| 1437 | Ga0496109_0548658 | |||
| 1438 | Ga0496109_0781793 | |||
| 1439 | Ga0496109_0789241 | |||
| 1440 | Ga0496109_0962294 | |||
| 1441 | Ga0496109_1085625 | |||
| 1442 | Ga0496109_1570435 | |||
| 1443 | Ga0496110_0008071 | |||
| 1444 | Ga0496110_0056181 | |||
| 1445 | Ga0496110_0449310 | |||
| 1446 | Ga0496110_0476183 | |||
| 1447 | Ga0496110_1615089 | |||
| 1448 | Ga0496110_1792140 | |||
| 1449 | Ga0496111_0013856 | |||
| 1450 | Ga0496111_0025396 | |||
| 1451 | Ga0496111_0065134 | |||
| 1452 | Ga0496111_0395242 | |||
| 1453 | Ga0496111_0494794 | |||
| 1454 | Ga0496111_0587337 | |||
| 1455 | Ga0496112_0017218 | |||
| 1456 | Ga0496112_0175273 | |||
| 1457 | Ga0496112_0465452 | |||
| 1458 | Ga0496112_0496630 | |||
| 1459 | Ga0496112_0660558 | |||
| 1460 | Ga0496112_0751515 | |||
| 1461 | Ga0496113_0002757 | |||
| 1462 | Ga0496113_0015627 | |||
| 1463 | Ga0496113_0886602 | |||
| 1464 | Ga0496113_0980975 | |||
| 1465 | Ga0496114_0011503 | |||
| 1466 | Ga0496114_0596139 | |||
| 1467 | Ga0496114_0700305 | |||
| 1468 | Ga0496114_1557605 | |||
| 1469 | Ga0496115_1284343 | |||
| 1470 | Ga0501031_0156694 | |||
| 1471 | Ga0501032_0084805 | |||
| 1472 | Ga0501032_0646036 | |||
| 1473 | Ga0501033_0047261 | |||
| 1474 | Ga0501036_0045558 | |||
| 1475 | Ga0501036_0839936 | |||
| 1476 | Ga0501037_0090686 | |||
| 1477 | Ga0501038_0077983 | |||
| 1478 | Ga0501039_0746748 | |||
| 1479 | Ga0501039_1302309 | |||
| 1480 | Ga0501040_0011475 | |||
| 1481 | Ga0501041_0030322 | |||
| 1482 | Ga0501042_0083940 | |||
| 1483 | Ga0501042_1447475 | |||
| 1484 | Ga0501043_0235243 | |||
| 1485 | Ga0501046_0302650 | |||
| 1486 | Ga0501046_1102224 | |||
| 1487 | Ga0501047_1254366 | |||
| 1488 | Ga0501048_0083906 | |||
| 1489 | Ga0501067_0096534 | |||
| 1490 | Ga0501067_0123303 | |||
| 1491 | Ga0501068_0009890 | |||
| 1492 | Ga0501068_0027241 | |||
| 1493 | Ga0501068_0345709 | |||
| 1494 | Ga0501068_0920330 | |||
| 1495 | Ga0501069_0007839 | |||
| 1496 | Ga0501069_0169916 | |||
| 1497 | Ga0501069_0459654 | |||
| 1498 | Ga0501070_0025181 | |||
| 1499 | Ga0501070_0843626 | |||
| 1500 | Ga0501070_1314007 | |||
| 1501 | Ga0501071_0043038 | |||
| 1502 | Ga0501071_0085787 | |||
| 1503 | Ga0501071_0198653 | |||
| 1504 | Ga0501071_0915291 | |||
| 1505 | Ga0501072_0348619 | |||
| 1506 | Ga0501072_0492406 | |||
| 1507 | Ga0501072_0756852 | |||
| 1508 | Ga0501072_1045637 | |||
| 1509 | Ga0501073_0029621 | |||
| 1510 | Ga0501073_0051430 | |||
| 1511 | Ga0501073_0507541 | |||
| 1512 | Ga0501074_0040186 | |||
| 1513 | Ga0501074_0385887 | |||
| 1514 | Ga0501075_0094997 | |||
| 1515 | Ga0501075_0528008 | |||
| 1516 | Ga0501075_0919603 | |||
| 1517 | Ga0501075_1412366 | |||
| 1518 | Ga0501076_0071864 | |||
| 1519 | Ga0501076_0154914 | |||
| 1520 | Ga0501076_0215329 | |||
| 1521 | Ga0501076_1478161 | |||
| 1522 | Ga0501076_1579702 | |||
| 1523 | Ga0501077_0014809 | |||
| 1524 | Ga0501077_0155022 | |||
| 1525 | Ga0501077_0191277 | |||
| 1526 | Ga0501077_0425674 | |||
| 1527 | Ga0501236_126652 | |||
| 1528 | Ga0501225_0131801 | |||
| 1529 | Ga0501079_0067910 | |||
| 1530 | Ga0501079_0176607 | |||
| 1531 | Ga0501079_0276091 | |||
| 1532 | Ga0501079_0738707 | |||
| 1533 | Ga0501080_0014339 | |||
| 1534 | Ga0501080_0622121 | |||
| 1535 | Ga0501080_0751720 | |||
| 1536 | Ga0501080_1347477 | |||
| 1537 | Ga0501081_0024295 | |||
| 1538 | Ga0501081_0300706 | |||
| 1539 | Ga0501083_0072265 | |||
| 1540 | Ga0501083_1044806 | |||
| 1541 | Ga0501035_0105606 | |||
| 1542 | Ga0501044_0216183 | |||
| 1543 | Ga0501045_0057888 | |||
| 1544 | Ga0501045_0345524 | |||
| 1545 | Ga0501045_0368453 | |||
| 1546 | Ga0501045_0983932 | |||
| 1547 | nmdc:mga0yw44_465037_c1 | |||
| 1548 | nmdc:mga05p37_1245361_c1 | |||
| 1549 | nmdc:mga08y16_1129424_c1 | |||
| 1550 | nmdc:mga08y16_252140_c1 | |||
| 1551 | nmdc:mga0n895_1091858_c1 | |||
| 1552 | nmdc:mga0n895_1536026_c1 | |||
| 1553 | nmdc:mga0n895_456992_c1 | |||
| 1554 | nmdc:mga0n895_842348_c1 | |||
| 1555 | nmdc:mga0a205_208353_c1 | |||
| 1556 | Ga0495601_0097169 | |||
| 1557 | Ga0495601_0176162 | |||
| 1558 | Ga0495601_0328334 | |||
| 1559 | Ga0495601_0992660 | |||
| 1560 | Ga0495612_0123898 | |||
| 1561 | Ga0495612_0531947 | |||
| 1562 | Ga0495595_0098920 | |||
| 1563 | Ga0495595_0152185 | |||
| 1564 | Ga0495619_0085131 | |||
| 1565 | Ga0495619_1072401 | |||
| 1566 | Ga0501084_0019085 | |||
| 1567 | Ga0501084_0022038 | |||
| 1568 | Ga0501084_0385044 | |||
| 1569 | Ga0590071_000361 | |||
| 1570 | Ga0590074_013458 | |||
| 1571 | Ga0590075_025319 | |||
| 1572 | Ga0590077_049557 | |||
| 1573 | Ga0501082_0015203 | |||
| 1574 | Ga0501082_0300177 | |||
| 1575 | Ga0501082_0785130 | |||
| 1576 | Ga0501082_1136965 | |||
| 1577 | Ga0501082_1741490 | |||
| 1578 | Ga0530510_0100433 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a63-assembly1.cif.gz_1 | cryo-em structure of listeria monocytogenes 50s ribosomal subunit. | 0.8139 | 33 | 58 |
| 6fxc-assembly1.cif.gz_AV | the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus | 0.7889 | 33 | 59 |
| 7q5q-assembly1.cif.gz_B | protein community member oxoglutarate dehydrogenase complex e2 core from c. thermophilum | 0.7687 | 36 | 51 |
| 6s0x-assembly1.cif.gz_V | erythromycin resistant staphylococcus aureus 70s ribosome (delta r88 a89 ul22) in complex with erythromycin. | 0.761 | 31 | 59 |
| 6ddg-assembly1.cif.gz_J | structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 | 0.7201 | 33 | 56 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0W185_35_102_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7314 | 1 | 63 | 3.30.40.10 |
| af_Q8MLR7_686_760_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7091 | 1 | 63 | 3.30.40.10 |
| af_P34514_490_626_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.7084 | 36 | 62 | 3.30.230.130 |
| af_Q8IZQ1_3452_3518_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.706 | 1 | 65 | 3.30.40.10 |
| af_D3ZW40_1096_1174_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6983 | 35 | 65 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381XMZ1-F1-model_v4 | 50S ribosomal protein L28 | 0.8026 | 33 | 64 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7X6WVL2-F1-model_v4 | Large ribosomal subunit protein bL28 | 0.7844 | 32 | 65 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1E5NH76-F1-model_v4 | Uncharacterized protein | 0.7703 | 2 | 63 |
|
| AF-A0A837RZW9-F1-model_v4 | deleted | 0.7512 | 33 | 61 |
|
| AF-A0A7Y3K736-F1-model_v4 | Large ribosomal subunit protein bL28 | 0.7333 | 33 | 61 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |