F480914

General Info

Members Datasets Scaffolds Average Seq Length
789 536 620 138

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0110002|Ga0436361_0110002_299_793
Length 164
Sequence LIILFGQSSSSSFNEHKETSTMTTKLDKILYTAHAHTTGGRDGRSVSDDGLLDVKLAVPKVMGGXXXATNPEQLFAAGYSACFMGALKHVAGAKKLPVPADASIDASVSIGPIPQGFGIAAKLVVNLPGMDRGTAQELVHAAHQVCPYSNATRGNIEVELVLGQ

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
8 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
9 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
10 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
11 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
12 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
13 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
14 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
15 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
16 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
17 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
18 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
19 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
20 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
21 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
22 2643221647 Streptomyces sp. Root369 Isolate Unclassified
23 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
24 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
25 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
26 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
27 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
28 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
29 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
30 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
31 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
32 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
33 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
34 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
35 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
36 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
37 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
38 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
39 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
40 2808606448 Streptomyces sp. 193411 Isolate Unclassified
41 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
42 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
43 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
44 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
45 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
46 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
47 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
48 2862574272 Streptomyces sp. AcE210 Isolate Nodule
49 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
50 2867369537 Streptomyces sp. Z26 Isolate Unclassified
51 2867428634 Streptomyces sp. RP5T Isolate Unclassified
52 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
53 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
54 2884411467 Dyella sp. AD56 Isolate Rhizosphere
55 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
56 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
57 2904504865 Serratia marcescens 1822 Isolate Unclassified
58 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
59 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
60 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
61 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
62 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
63 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
64 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
65 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
66 2919150387 Rahnella aceris 1817 Isolate Unclassified
67 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
68 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
69 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
70 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
71 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
72 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
73 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
74 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
75 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
76 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
77 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
78 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
79 2927143783 Rahnella sp. 2050 Isolate Unclassified
80 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
81 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
82 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
83 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
84 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
85 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
86 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
87 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
88 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
89 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
90 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
91 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
92 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
93 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
94 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
95 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
96 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
97 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
98 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
99 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
100 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
101 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
102 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
103 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
104 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
105 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
106 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
107 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
108 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
109 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
110 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
111 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
112 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
113 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
114 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
115 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
116 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
117 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
118 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
119 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
120 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
121 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
122 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
123 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
124 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
125 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
126 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
127 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
128 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
129 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
130 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
131 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
132 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
133 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
134 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
135 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
136 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
137 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
138 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
139 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
140 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
141 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
142 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
143 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
144 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
145 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
146 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
147 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
148 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
149 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
150 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
151 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
152 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
153 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
154 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
155 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
156 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
157 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
158 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
159 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
160 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
161 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
162 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
163 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
164 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
165 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
166 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
167 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
168 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
169 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
170 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
171 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
172 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
173 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
174 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
175 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
176 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
177 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
178 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
179 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
180 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
181 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
182 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
183 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
184 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
185 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
186 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
187 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
188 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
189 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
190 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
192 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
193 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
194 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
195 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
196 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
197 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
198 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
199 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
200 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
201 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
202 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
203 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
204 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
205 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
206 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
207 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
208 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
209 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
210 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
211 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
212 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
213 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
214 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
215 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
216 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
217 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
218 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
219 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
220 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
221 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
222 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
223 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
224 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
225 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
226 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
227 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
228 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
229 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
230 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
231 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
232 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
233 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
234 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
235 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
236 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
237 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
238 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
239 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
240 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
241 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
242 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
243 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
244 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
245 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
246 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
247 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
248 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
249 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
250 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
251 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
252 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
258 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
259 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
261 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
262 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
263 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
266 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
267 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
268 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
269 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
271 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
272 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
273 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
275 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
276 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
277 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
302 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
304 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
308 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
309 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
310 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
311 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
312 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
313 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
314 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
315 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
316 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
317 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
318 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
319 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
320 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
321 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
322 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
323 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
324 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
325 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
326 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
327 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
328 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
329 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
330 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
331 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
332 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
333 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
334 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
335 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
336 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
337 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
338 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
339 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
340 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
341 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
342 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
343 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
344 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
345 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
346 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
347 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
348 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
349 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
350 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
351 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
352 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
353 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
354 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
355 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
356 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
357 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
358 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
359 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
360 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
361 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
362 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
363 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
364 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
365 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
366 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
367 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
368 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
369 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
370 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
371 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
372 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
373 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
374 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
375 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
376 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
377 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
378 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
379 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
380 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
381 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
382 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
383 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
384 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
385 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
386 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
387 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
388 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
389 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
390 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
391 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
392 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
393 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
394 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
395 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
396 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
397 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
398 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
399 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
400 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
401 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
402 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
403 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
404 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
405 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
406 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
407 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
408 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
409 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
410 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
411 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
412 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
413 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
414 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
415 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
416 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
417 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
418 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
419 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
420 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
421 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
422 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
423 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
424 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
425 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
426 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
427 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
428 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
429 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
430 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
431 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
432 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
433 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
434 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
435 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
436 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
437 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
438 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
439 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
440 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
441 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
442 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
443 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
444 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
445 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
446 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
447 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
448 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
449 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
450 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
451 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
452 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
453 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
454 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
455 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
456 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
457 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
458 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
459 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
460 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
461 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
462 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
463 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
464 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
465 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
466 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
467 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
468 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
469 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
470 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
471 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
477 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
484 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
485 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
486 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
487 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
491 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
495 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
496 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
497 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
498 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
499 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
502 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
503 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
504 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
505 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
506 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
507 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
508 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
509 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
510 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
511 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
512 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
513 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
514 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
515 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
516 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
517 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
518 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
519 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
520 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
521 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
522 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
523 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
524 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
525 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
526 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
527 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
528 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
529 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
530 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
531 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
532 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
533 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
534 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
535 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
536 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.79
Metatranscriptomes 2.79
Isolates 21.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 11.03
Nodule 12.55
Rhizoplane 3.68
Rhizosphere 53.99
Stem 0
Stem Tuber 0
Unclassified 18.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8876843 2162886011 Bacteria 1243
2 JGI24740J21852_10077636 3300001979 Bacteria 876
3 JGI24739J22299_10097718 3300001989 Bacteria 888
4 JGI24735J21928_10168173 3300002067 Bacteria 634
5 JGI25162J39368_1000007 3300002737 Bacteria 403947
6 JGI25162J39368_1000156 3300002737 Bacteria 75086
7 JGI25162J39368_1000530 3300002737 Bacteria 28422
8 JGI25157J39369_1000416 3300002741 Bacteria 28420
9 JGI25157J39369_1025406 3300002741 Bacteria 691
10 JGI25163J39215_1000355 3300002771 Bacteria 15077
11 JGI25163J39215_1000410 3300002771 Bacteria 13470
12 JGI25164J39214_1000010 3300002772 Bacteria 288863
13 JGI25164J39214_1000016 3300002772 Bacteria 202035
14 JGI25164J39214_1000086 3300002772 Bacteria 91769
15 JGI25152J39213_1000753 3300002773 Bacteria 16470
16 JGI25165J46597_1000144 3300003214 Bacteria 117624
17 rootH1_10011106 3300003316 Bacteria 12110
18 rootH1_10069576 3300003316 Bacteria 3292
19 rootH2_10013512 3300003320 Bacteria 47156
20 rootH2_10127174 3300003320 Bacteria 4107
21 rootL2_10005527 3300003322 Bacteria 1060
22 rootL2_10184212 3300003322 Bacteria 1770
23 JGI25160J50197_1017719 3300003354 Bacteria 2246
24 Ga0007410J51695_1067624 3300003574 Bacteria 546
25 Ga0006562J51391_1122768 3300003578 Bacteria 7238
26 Ga0055538_1000006 3300003751 Bacteria 403947
27 Ga0055538_1001173 3300003751 Bacteria 5541
28 Ga0055539_1000010 3300003752 Bacteria 403947
29 Ga0055539_1002514 3300003752 Bacteria 2764
30 Ga0055533_1000013 3300003756 Bacteria 403947
31 Ga0055533_1001064 3300003756 Bacteria 7893
32 Ga0055525_1000015 3300003759 Bacteria 403947
33 Ga0055527_1000048 3300003760 Bacteria 105299
34 Ga0055535_1000061 3300003761 Bacteria 117624
35 Ga0055535_1000332 3300003761 Bacteria 47601
36 Ga0055542_1000099 3300003762 Bacteria 117624
37 Ga0055542_1000118 3300003762 Bacteria 105368
38 Ga0055529_1000117 3300003763 Bacteria 117613
39 Ga0055529_1000132 3300003763 Bacteria 105368
40 Ga0055526_1000052 3300003771 Bacteria 116035
41 Ga0055528_1009303 3300003790 Bacteria 4116
42 Ga0055541_1000007 3300003841 Bacteria 403947
43 Ga0058692_1003357 3300003856 Bacteria 4962
44 Ga0058692_1006983 3300003856 Bacteria 3038
45 Ga0058863_11838688 3300004799 Bacteria 503
46 Ga0065704_10000667 3300005289 Bacteria 21743
47 Ga0065712_10077379 3300005290 Bacteria 3506
48 Ga0070670_100818626 3300005331 Bacteria 842
49 Ga0070666_10010973 3300005335 Bacteria 5678
50 Ga0070666_10078590 3300005335 Bacteria 2252
51 Ga0070666_10088537 3300005335 Bacteria 2124
52 Ga0070682_101066449 3300005337 Bacteria 674
53 Ga0070689_100159811 3300005340 Bacteria 1821
54 Ga0070689_100520927 3300005340 Bacteria 1021
55 Ga0070661_101132704 3300005344 Bacteria 653
56 Ga0070668_100185435 3300005347 Bacteria 1702
57 Ga0070668_100235864 3300005347 Bacteria 1514
58 Ga0070669_101055809 3300005353 Bacteria 698
59 Ga0070671_100302571 3300005355 Bacteria 1362
60 Ga0070671_100824561 3300005355 Bacteria 808
61 Ga0070667_100489063 3300005367 Bacteria 1127
62 Ga0070667_101511148 3300005367 Bacteria 631
63 Ga0070708_100985904 3300005445 Bacteria 790
64 Ga0070663_100060627 3300005455 Bacteria 2722
65 Ga0070678_100393614 3300005456 Bacteria 1202
66 Ga0070698_101998190 3300005471 Bacteria 533
67 Ga0070684_101076715 3300005535 Bacteria 755
68 Ga0068853_100298879 3300005539 Bacteria 1487
69 Ga0070672_100322727 3300005543 Bacteria 1313
70 Ga0070665_100000039 3300005548 Bacteria 306063
71 Ga0070665_100019619 3300005548 Bacteria 6786
72 Ga0070665_100144455 3300005548 Bacteria 2383
73 Ga0070665_100587746 3300005548 Bacteria 1126
74 Ga0068856_100021657 3300005614 Bacteria 6247
75 Ga0068861_101840943 3300005719 Bacteria 601
76 Ga0068860_100015862 3300005843 Bacteria 7354
77 Ga0081538_10018400 3300005981 Bacteria 5248
78 Ga0081540_1149897 3300005983 Bacteria 922
79 Ga0075365_10053112 3300006038 Bacteria 2682
80 Ga0075367_10001212 3300006178 Bacteria 10827
81 Ga0075367_10096604 3300006178 Bacteria 1802
82 Ga0075366_10000464 3300006195 Bacteria 18904
83 Ga0075428_101170016 3300006844 Bacteria 811
84 Ga0079104_1000041 3300006946 Bacteria 186297
85 Ga0079104_1000059 3300006946 Bacteria 162642
86 Ga0079104_1067889 3300006946 Bacteria 754
87 Ga0099826_10037622 3300006948 Bacteria 3410
88 Ga0099826_10187612 3300006948 Bacteria 1144
89 Ga0099795_10317407 3300007788 Bacteria 689
90 Ga0105251_10011873 3300009011 Bacteria 4948
91 Ga0105244_10000026 3300009036 Bacteria 216056
92 Ga0105244_10013663 3300009036 Bacteria 4732
93 Ga0105244_10099122 3300009036 Bacteria 1427
94 Ga0105250_10000020 3300009092 Bacteria 242010
95 Ga0105250_10000889 3300009092 Bacteria 17674
96 Ga0105250_10028687 3300009092 Bacteria 2241
97 Ga0105240_10330618 3300009093 Bacteria 1734
98 Ga0105243_10389996 3300009148 Bacteria 1291
99 Ga0105243_10504680 3300009148 Bacteria 1147
100 Ga0105243_10616934 3300009148 Bacteria 1046
101 Ga0105243_10756424 3300009148 Bacteria 953
102 Ga0105243_11760697 3300009148 Bacteria 650
103 Ga0105248_10130002 3300009177 Bacteria 2841
104 Ga0105237_10005375 3300009545 Bacteria 14480
105 Ga0105237_10006004 3300009545 Bacteria 13591
106 Ga0105238_10328717 3300009551 Bacteria 1515
107 Ga0105249_10098735 3300009553 Bacteria 2743
108 Ga0105249_11381764 3300009553 Bacteria 776
109 Ga0105033_102309 3300009986 Bacteria 1580
110 Ga0105239_10000694 3300010375 Bacteria 47928
111 Ga0105246_10015842 3300011119 Bacteria 4767
112 Ga0157371_10000044 3300013102 Bacteria 194689
113 Ga0157370_10014800 3300013104 Bacteria 7962
114 Ga0157369_10000184 3300013105 Bacteria 86626
115 Ga0157369_11087195 3300013105 Bacteria 818
116 Ga0163162_10241183 3300013306 Bacteria 1938
117 Ga0157372_10000189 3300013307 Bacteria 68006
118 Ga0157372_10179084 3300013307 Bacteria 2454
119 Ga0163163_11092296 3300014325 Bacteria 861
120 Ga0182008_10167580 3300014497 Bacteria 1108
121 Ga0157379_10322539 3300014968 Bacteria 1410
122 Ga0182006_1000098 3300015261 Bacteria 101707
123 Ga0182007_10000138 3300015262 Bacteria 50255
124 Ga0182007_10052483 3300015262 Bacteria 1344
125 Ga0182007_10279545 3300015262 Bacteria 607
126 Ga0182005_1004265 3300015265 Bacteria 4659
127 Ga0163161_10138706 3300017792 Bacteria 1840
128 Ga0197907_10522073 3300020069 Bacteria 532
129 Ga0206356_11258162 3300020070 Bacteria 526
130 Ga0206350_10081943 3300020080 Bacteria 566
131 Ga0213872_10000272 3300021361 Bacteria 44319
132 Ga0213872_10000648 3300021361 Bacteria 26347
133 Ga0213872_10036234 3300021361 Bacteria 2255
134 Ga0213872_10139719 3300021361 Bacteria 1063
135 Ga0224712_10399955 3300022467 Bacteria 655
136 Ga0209760_100034 3300025207 Bacteria 135933
137 Ga0209760_100602 3300025207 Bacteria 6210
138 Ga0209784_100022 3300025224 Bacteria 403999
139 Ga0209784_100043 3300025224 Bacteria 217823
140 Ga0209566_100021 3300025225 Bacteria 403999
141 Ga0209674_100038 3300025226 Bacteria 403999
142 Ga0209674_101087 3300025226 Bacteria 8072
143 Ga0209672_100017 3300025228 Bacteria 514236
144 Ga0209672_103498 3300025228 Bacteria 3225
145 Ga0209563_100042 3300025230 Bacteria 403999
146 Ga0207427_100027 3300025231 Bacteria 403999
147 Ga0207427_100087 3300025231 Bacteria 140098
148 Ga0209437_100049 3300025233 Bacteria 403999
149 Ga0209437_100173 3300025233 Bacteria 140098
150 Ga0209258_100038 3300025242 Bacteria 398959
151 Ga0209258_100092 3300025242 Bacteria 226544
152 Ga0207425_1045076 3300025245 Bacteria 826
153 Ga0209646_1001268 3300025246 Bacteria 7138
154 Ga0209026_1000112 3300025250 Bacteria 140098
155 Ga0209026_1004529 3300025250 Bacteria 4089
156 Ga0209677_100025 3300025253 Bacteria 403999
157 Ga0209677_105835 3300025253 Bacteria 3099
158 Ga0209148_1000009 3300025254 Bacteria 1395625
159 Ga0209148_1000047 3300025254 Bacteria 434369
160 Ga0209759_1000335 3300025256 Bacteria 61951
161 Ga0209759_1001510 3300025256 Bacteria 12822
162 Ga0209129_1000021 3300025258 Bacteria 445018
163 Ga0209129_1001529 3300025258 Bacteria 12772
164 Ga0209233_1000179 3300025261 Bacteria 140518
165 Ga0209233_1002834 3300025261 Bacteria 6221
166 Ga0209565_1028525 3300025263 Bacteria 1102
167 Ga0209455_1000032 3300025272 Bacteria 514243
168 Ga0209455_1000056 3300025272 Bacteria 349821
169 Ga0209673_1002499 3300025273 Bacteria 12641
170 Ga0209130_1020681 3300025284 Bacteria 1500
171 Ga0209025_1030865 3300025294 Bacteria 2552
172 Ga0209564_1000026 3300025295 Bacteria 519154
173 Ga0209564_1042997 3300025295 Bacteria 1190
174 Ga0209256_1003962 3300025299 Bacteria 9737
175 Ga0207426_1000447 3300025302 Bacteria 66140
176 Ga0209051_1109207 3300025303 Bacteria 725
177 Ga0207696_1000036 3300025711 Bacteria 337736
178 Ga0207696_1000952 3300025711 Bacteria 17674
179 Ga0207655_1000057 3300025728 Bacteria 273598
180 Ga0207655_1009713 3300025728 Bacteria 5938
181 Ga0207655_1190615 3300025728 Bacteria 619
182 Ga0207680_10182261 3300025903 Bacteria 1421
183 Ga0207647_10035575 3300025904 Bacteria 3172
184 Ga0207695_10041030 3300025913 Bacteria 4954
185 Ga0207695_10097450 3300025913 Bacteria 2942
186 Ga0207695_10235320 3300025913 Bacteria 1734
187 Ga0207671_10010811 3300025914 Bacteria 7488
188 Ga0207671_10021302 3300025914 Bacteria 4919
189 Ga0207694_10408381 3300025924 Bacteria 1130
190 Ga0207650_10355902 3300025925 Bacteria 1205
191 Ga0207644_10044010 3300025931 Bacteria 3170
192 Ga0207706_10527718 3300025933 Bacteria 1018
193 Ga0207709_10263245 3300025935 Bacteria 1265
194 Ga0207709_10362769 3300025935 Bacteria 1097
195 Ga0207709_11357771 3300025935 Bacteria 588
196 Ga0207670_10093082 3300025936 Bacteria 2135
197 Ga0207670_10249139 3300025936 Bacteria 1372
198 Ga0207691_10303032 3300025940 Bacteria 1372
199 Ga0207711_10450966 3300025941 Bacteria 1197
200 Ga0207712_10499502 3300025961 Bacteria 1040
201 Ga0207668_10067600 3300025972 Bacteria 2538
202 Ga0207668_10221301 3300025972 Bacteria 1520
203 Ga0207640_10009445 3300025981 Bacteria 5463
204 Ga0207640_10181159 3300025981 Bacteria 1580
205 Ga0207658_10532041 3300025986 Bacteria 1050
206 Ga0207639_10155501 3300026041 Bacteria 1920
207 Ga0207678_10010608 3300026067 Bacteria 8094
208 Ga0207678_10125542 3300026067 Bacteria 2189
209 Ga0207702_10000735 3300026078 Bacteria 35012
210 Ga0207675_100919751 3300026118 Bacteria 891
211 Ga0207683_10414943 3300026121 Bacteria 1239
212 Ga0207698_10663320 3300026142 Bacteria 1034
213 Ga0209281_1000065 3300027111 Bacteria 285579
214 Ga0209281_1000073 3300027111 Bacteria 269036
215 Ga0209371_1000027 3300027312 Bacteria 448853
216 Ga0209371_1000029 3300027312 Bacteria 424797
217 Ga0209371_1002330 3300027312 Bacteria 10804
218 Ga0209371_1002899 3300027312 Bacteria 8982
219 Ga0209371_1004460 3300027312 Bacteria 6074
220 Ga0209371_1008023 3300027312 Bacteria 3573
221 Ga0209371_1011748 3300027312 Bacteria 2579
222 Ga0209282_1386447 3300027666 Bacteria 556
223 Ga0209813_10010049 3300027866 Bacteria 2436
224 Ga0268266_10000122 3300028379 Bacteria 154684
225 Ga0268266_10029190 3300028379 Bacteria 4689
226 Ga0268266_10071928 3300028379 Bacteria 2998
227 Ga0268266_10453072 3300028379 Bacteria 1220
228 Ga0268266_11010259 3300028379 Bacteria 805
229 Ga0268264_11970966 3300028381 Bacteria 593
230 Ga0307517_10018067 3300028786 Bacteria 9142
231 Ga0307515_10001581 3300028794 Bacteria 50851
232 Ga0307515_10003726 3300028794 Bacteria 31986
233 Ga0307515_10017589 3300028794 Bacteria 13003
234 Ga0268256_1000032 3300030500 Bacteria 424603
235 Ga0268256_1000045 3300030500 Bacteria 330053
236 Ga0268256_1002609 3300030500 Bacteria 8982
237 Ga0268256_1010980 3300030500 Bacteria 2901
238 Ga0268256_1012447 3300030500 Bacteria 2630
239 Ga0268256_1012808 3300030500 Bacteria 2574
240 Ga0268256_1043777 3300030500 Bacteria 985
241 Ga0307511_10001316 3300030521 Bacteria 26369
242 Ga0307512_10002993 3300030522 Bacteria 20370
243 Ga0307512_10190795 3300030522 Bacteria 1131
244 Ga0265330_10000043 3300031235 Bacteria 116829
245 Ga0265332_10000018 3300031238 Bacteria 224913
246 Ga0265320_10130058 3300031240 Bacteria 1144
247 Ga0265325_10005641 3300031241 Bacteria 7700
248 Ga0265340_10005465 3300031247 Bacteria 7057
249 Ga0265327_10000543 3300031251 Bacteria 64532
250 Ga0265316_10278470 3300031344 Bacteria 1223
251 Ga0307513_10000034 3300031456 Bacteria 185012
252 Ga0307513_10124813 3300031456 Bacteria 2533
253 Ga0307513_10540278 3300031456 Bacteria 879
254 Ga0307509_10002843 3300031507 Bacteria 27421
255 Ga0307509_10018435 3300031507 Bacteria 8003
256 Ga0307509_10207284 3300031507 Bacteria 1789
257 Ga0307408_100000084 3300031548 Bacteria 104461
258 Ga0307408_100000147 3300031548 Bacteria 78134
259 Ga0307408_101932684 3300031548 Bacteria 566
260 Ga0307408_102055208 3300031548 Bacteria 550
261 Ga0307508_10003227 3300031616 Bacteria 16668
262 Ga0307508_10008978 3300031616 Bacteria 9211
263 Ga0307508_10130127 3300031616 Bacteria 2120
264 Ga0307508_10208079 3300031616 Bacteria 1557
265 Ga0307514_10001452 3300031649 Bacteria 28909
266 Ga0307514_10057412 3300031649 Bacteria 2981
267 Ga0307514_10149419 3300031649 Bacteria 1571
268 Ga0307514_10168437 3300031649 Bacteria 1436
269 Ga0265314_10000126 3300031711 Bacteria 116852
270 Ga0265314_10028287 3300031711 Bacteria 4181
271 Ga0265314_10363289 3300031711 Bacteria 793
272 Ga0307516_10000057 3300031730 Bacteria 122512
273 Ga0307516_10000181 3300031730 Bacteria 81531
274 Ga0307516_10007700 3300031730 Bacteria 12325
275 Ga0307516_10088306 3300031730 Bacteria 2933
276 Ga0307516_10724411 3300031730 Bacteria 653
277 Ga0307518_10081297 3300031838 Bacteria 2339
278 Ga0307518_10417860 3300031838 Bacteria 737
279 Ga0307518_10488345 3300031838 Bacteria 640
280 Ga0307518_10509710 3300031838 Bacteria 615
281 Ga0307410_11083404 3300031852 Bacteria 694
282 Ga0307406_10000067 3300031901 Bacteria 58110
283 Ga0307412_10002443 3300031911 Bacteria 10338
284 Ga0307412_10004361 3300031911 Bacteria 7888
285 Ga0307409_102007565 3300031995 Bacteria 608
286 Ga0307507_10005088 3300033179 Bacteria 22118
287 Ga0307507_10010180 3300033179 Bacteria 12247
288 Ga0307507_10268688 3300033179 Bacteria 1080
289 Ga0307510_10011357 3300033180 Bacteria 10578
290 Ga0307510_10019193 3300033180 Bacteria 8022
291 Ga0307510_10093916 3300033180 Bacteria 2828
292 Ga0307510_10139353 3300033180 Bacteria 2073
293 Ga0307510_10155435 3300033180 Bacteria 1895
294 Ga0307510_10168661 3300033180 Bacteria 1772
295 Ga0307510_10190751 3300033180 Bacteria 1598
296 Ga0373962_0100559 3300035242 Bacteria 901
297 Ga0373937_1718746 3300036401 Bacteria 574
298 Ga0395899_0000046 3300037312 Bacteria 242486
299 Ga0395899_0113770 3300037312 Bacteria 1943
300 Ga0395900_0000034 3300037418 Bacteria 258846
301 Ga0395900_0114757 3300037418 Bacteria 2764
302 Ga0395898_0000081 3300037466 Bacteria 242472
303 Ga0395898_0350506 3300037466 Bacteria 1408
304 Ga0395905_0014252 3300037471 Bacteria 7595
305 Ga0395905_0103259 3300037471 Bacteria 2676
306 Ga0395901_0037160 3300038443 Bacteria 5037
307 Ga0395901_0075549 3300038443 Bacteria 3514
308 Ga0395901_0187345 3300038443 Bacteria 2170
309 Ga0436365_1817978 3300039437 Bacteria 842
310 Ga0436361_0110002 3300039447 Bacteria 927
311 Ga0436361_0214541 3300039447 Bacteria 41289
312 Ga0436361_0393634 3300039447 Bacteria 4074
313 Ga0436361_0882194 3300039447 Bacteria 13185
314 Ga0436361_1195197 3300039447 Bacteria 3343
315 Ga0436363_1410686 3300039450 Bacteria 2086
316 Ga0436362_0067749 3300039453 Bacteria 538
317 Ga0439436_0000003 3300041404 Bacteria 186684
318 Ga0439436_0024379 3300041404 Bacteria 1786
319 Ga0439439_0010007 3300041406 Bacteria 2263
320 Ga0439439_0058213 3300041406 Bacteria 1023
321 Ga0451790_47954 3300041444 Bacteria 510
322 Ga0451791_1192668 3300041451 Bacteria 1063
323 Ga0451797_0926805 3300041453 Bacteria 742
324 Ga0451800_0849643 3300041459 Bacteria 653
325 Ga0451807_0084414 3300041486 Bacteria 780
326 Ga0451807_0359962 3300041486 Bacteria 821
327 Ga0451833_1362901 3300041491 Bacteria 806
328 Ga0451846_05427 3300041502 Bacteria 675
329 Ga0451846_46678 3300041502 Bacteria 544
330 Ga0451847_1002177 3300041503 Bacteria 770
331 Ga0451849_0438339 3300041505 Bacteria 523
332 Ga0451849_0500776 3300041505 Bacteria 940
333 Ga0451851_0733926 3300041507 Bacteria 1187
334 Ga0451843_0213834 3300041509 Bacteria 947
335 Ga0451853_1657403 3300041512 Bacteria 2259
336 Ga0451853_1935799 3300041512 Bacteria 683
337 Ga0451853_2748623 3300041512 Bacteria 2741
338 Ga0439433_0012549 3300041999 Bacteria 1859
339 Ga0439449_0011840 3300042007 Bacteria 3279
340 Ga0439449_0148722 3300042007 Bacteria 873
341 Ga0439450_176428 3300042008 Bacteria 567
342 Ga0439452_000012 3300042010 Bacteria 412478
343 Ga0439452_000490 3300042010 Bacteria 21873
344 Ga0439456_002153 3300042013 Bacteria 3963
345 Ga0439457_000067 3300042014 Bacteria 22551
346 Ga0439457_019977 3300042014 Bacteria 1487
347 Ga0450894_002002 3300042131 Bacteria 2805
348 Ga0450896_000634 3300042133 Bacteria 3830
349 Ga0450898_008488 3300042134 Bacteria 1622
350 Ga0450899_002987 3300042135 Bacteria 1822
351 Ga0450900_013256 3300042136 Bacteria 1087
352 Ga0450906_012125 3300042145 Bacteria 1601
353 Ga0439458_0022738 3300042157 Bacteria 1458
354 Ga0450908_003370 3300042184 Bacteria 3101
355 Ga0439464_0022588 3300042439 Bacteria 1734
356 Ga0466969_0204604 3300044656 Bacteria 900
357 Ga0466972_0012227 3300044658 Bacteria 4315
358 Ga0466965_0096541 3300044683 Bacteria 1508
359 Ga0466966_0001878 3300044684 Bacteria 13626
360 Ga0466966_0031611 3300044684 Bacteria 3432
361 Ga0466961_0004232 3300044693 Bacteria 8985
362 Ga0466961_0111414 3300044693 Bacteria 1721
363 Ga0466963_0001367 3300044694 Bacteria 13054
364 Ga0466964_0019206 3300044706 Bacteria 2626
365 Ga0466968_0047531 3300044735 Bacteria 1825
366 Ga0466970_0007491 3300044765 Bacteria 5474
367 Ga0466957_0020204 3300044842 Bacteria 3918
368 Ga0466960_0058579 3300044901 Bacteria 1882
369 Ga0466959_0009824 3300045049 Bacteria 6817
370 Ga0466959_0017138 3300045049 Bacteria 5305
371 Ga0466959_1081050 3300045049 Bacteria 533
372 Ga0466958_0699304 3300045836 Bacteria 660
373 Ga0466958_0812018 3300045836 Bacteria 610
374 Ga0466958_1047114 3300045836 Bacteria 532
375 Ga0466967_0140803 3300045976 Bacteria 2247
376 Ga0466967_0199482 3300045976 Bacteria 1894
377 Ga0466967_0795008 3300045976 Bacteria 939
378 Ga0495592_0832913 3300046454 Bacteria 546
379 Ga0495603_0002581 3300046455 Bacteria 10685
380 Ga0495590_0026478 3300046457 Bacteria 2036
381 Ga0495629_0006477 3300046459 Bacteria 8676
382 Ga0495629_0067998 3300046459 Bacteria 2486
383 Ga0495638_0019580 3300046460 Bacteria 4477
384 Ga0495638_0056363 3300046460 Bacteria 2439
385 Ga0495651_0024350 3300046462 Bacteria 4710
386 Ga0495650_0000039 3300046471 Bacteria 375501
387 Ga0495580_0206998 3300046472 Bacteria 1350
388 Ga0495639_0139416 3300046475 Bacteria 1165
389 Ga0495662_0001236 3300046476 Bacteria 12587
390 Ga0495662_0039489 3300046476 Bacteria 2280
391 Ga0495664_0003532 3300046477 Bacteria 8524
392 Ga0495594_0718323 3300046499 Bacteria 564
393 Ga0495607_0027452 3300046501 Bacteria 3519
394 Ga0495606_0000044 3300046507 Bacteria 212802
395 Ga0495606_0001207 3300046507 Bacteria 36311
396 Ga0495610_0001740 3300046512 Bacteria 19069
397 Ga0495610_0001877 3300046512 Bacteria 18149
398 Ga0495618_0065293 3300046514 Bacteria 2313
399 Ga0495620_0259627 3300046515 Bacteria 662
400 Ga0495628_0035900 3300046516 Bacteria 3982
401 Ga0495630_0028167 3300046517 Bacteria 4174
402 Ga0495632_0308621 3300046519 Bacteria 700
403 Ga0495637_0150738 3300046520 Bacteria 877
404 Ga0495643_0496885 3300046522 Bacteria 525
405 Ga0495648_0041907 3300046524 Bacteria 2886
406 Ga0495648_0140927 3300046524 Bacteria 1269
407 Ga0495666_0043474 3300046526 Bacteria 2171
408 Ga0495652_0282057 3300046529 Bacteria 1216
409 Ga0495640_0293854 3300046533 Bacteria 1010
410 Ga0495587_0016382 3300046536 Bacteria 4611
411 Ga0495621_0012142 3300046539 Bacteria 2681
412 Ga0495645_0024111 3300046543 Bacteria 4412
413 Ga0495633_0016289 3300046558 Bacteria 3837
414 Ga0495633_0095959 3300046558 Bacteria 1377
415 Ga0495667_0268885 3300046559 Bacteria 1083
416 Ga0495668_0000046 3300046616 Bacteria 224203
417 Ga0495668_0000482 3300046616 Bacteria 50037
418 Ga0495634_0000467 3300046642 Bacteria 40017
419 Ga0495625_0015034 3300046660 Bacteria 6148
420 Ga0495625_0228220 3300046660 Bacteria 1217
421 Ga0495625_0285788 3300046660 Bacteria 1060
422 Ga0495635_0002195 3300046663 Bacteria 13272
423 Ga0495659_0082940 3300046664 Bacteria 1220
424 Ga0495588_0002185 3300046674 Bacteria 8373
425 Ga0495588_0026141 3300046674 Bacteria 2912
426 Ga0495657_0003345 3300046675 Bacteria 13116
427 Ga0495657_0008782 3300046675 Bacteria 7703
428 Ga0495623_0196310 3300046679 Bacteria 1163
429 Ga0495646_0003952 3300046680 Bacteria 9269
430 Ga0495658_0047726 3300046683 Bacteria 2412
431 Ga0495613_0075994 3300046689 Bacteria 2445
432 Ga0495613_0091543 3300046689 Bacteria 2202
433 Ga0495670_0002183 3300046691 Bacteria 9682
434 Ga0495671_0203300 3300046692 Bacteria 960
435 Ga0495649_0094209 3300046694 Bacteria 1594
436 Ga0495600_0009427 3300046809 Bacteria 6030
437 Ga0495660_0000023 3300046810 Bacteria 272605
438 Ga0495581_0003284 3300047315 Bacteria 9282
439 Ga0495581_0261900 3300047315 Bacteria 1011
440 Ga0495604_0001778 3300047317 Bacteria 17566
441 Ga0495636_0030995 3300047318 Bacteria 2190
442 Ga0495636_0302683 3300047318 Bacteria 748
443 Ga0495674_0015566 3300047319 Bacteria 7106
444 Ga0495676_0037296 3300047321 Bacteria 4047
445 Ga0495687_000048 3300047443 Bacteria 205967
446 Ga0495687_027273 3300047443 Bacteria 2675
447 Ga0495675_0118178 3300047444 Bacteria 1652
448 Ga0495685_010161 3300047447 Bacteria 3154
449 Ga0495685_242041 3300047447 Bacteria 573
450 Ga0495681_0000855 3300047470 Bacteria 23416
451 Ga0495686_0001622 3300047472 Bacteria 23546
452 Ga0495686_0001733 3300047472 Bacteria 22411
453 Ga0495686_0018256 3300047472 Bacteria 4711
454 Ga0495686_0037853 3300047472 Bacteria 3088
455 Ga0495593_0024835 3300047673 Bacteria 3317
456 Ga0495614_0004153 3300048089 Bacteria 6522
457 Ga0495614_0005183 3300048089 Bacteria 5881
458 Ga0496100_0419233 3300048903 Bacteria 1022
459 Ga0496101_0331209 3300048904 Bacteria 1195
460 Ga0496102_0067434 3300048905 Bacteria 3282
461 Ga0496103_0320712 3300048906 Bacteria 996
462 Ga0496104_0000208 3300048907 Bacteria 52252
463 Ga0496104_0145630 3300048907 Bacteria 2275
464 Ga0496105_0085946 3300048908 Bacteria 2599
465 Ga0496107_0194250 3300048910 Bacteria 1508
466 Ga0496108_0525151 3300048911 Bacteria 1033
467 Ga0496109_0215642 3300048912 Bacteria 1805
468 Ga0496110_0134960 3300048913 Bacteria 2229
469 Ga0496111_0167081 3300048914 Bacteria 1634
470 Ga0496112_0574757 3300048915 Bacteria 1060
471 Ga0496113_0101048 3300048916 Bacteria 2235
472 Ga0496114_0472021 3300048917 Bacteria 1110
473 Ga0496116_0000112 3300048919 Bacteria 181946
474 Ga0496116_0008006 3300048919 Bacteria 9252
475 Ga0496116_0038839 3300048919 Bacteria 3299
476 Ga0496116_0055068 3300048919 Bacteria 2615
477 Ga0496116_0056847 3300048919 Bacteria 2562
478 Ga0496117_0066456 3300048920 Bacteria 2446
479 Ga0496117_0070300 3300048920 Bacteria 2352
480 Ga0496117_0103295 3300048920 Bacteria 1796
481 Ga0496118_0000454 3300048921 Bacteria 67788
482 Ga0496118_0001211 3300048921 Bacteria 39688
483 Ga0496118_0009223 3300048921 Bacteria 10020
484 Ga0496118_0052042 3300048921 Bacteria 3127
485 Ga0496118_0052159 3300048921 Bacteria 3123
486 Ga0496118_0066244 3300048921 Bacteria 2637
487 Ga0496118_0495200 3300048921 Bacteria 609
488 Ga0496119_0000023 3300048922 Bacteria 259882
489 Ga0496119_0017852 3300048922 Bacteria 5318
490 Ga0496119_0041634 3300048922 Bacteria 2922
491 Ga0496120_0032098 3300048923 Bacteria 3170
492 Ga0496120_0071550 3300048923 Bacteria 1903
493 Ga0496120_0076981 3300048923 Bacteria 1816
494 Ga0496120_0122004 3300048923 Bacteria 1346
495 Ga0496121_0000801 3300048924 Bacteria 57303
496 Ga0496121_0005819 3300048924 Bacteria 15633
497 Ga0496121_0007228 3300048924 Bacteria 13445
498 Ga0496121_0124825 3300048924 Bacteria 1937
499 Ga0496121_0355710 3300048924 Bacteria 974
500 Ga0496121_0714478 3300048924 Bacteria 601
501 Ga0496122_0000067 3300048925 Bacteria 231365
502 Ga0496122_0029928 3300048925 Bacteria 4575
503 Ga0496122_0091279 3300048925 Bacteria 2074
504 Ga0496122_0406551 3300048925 Bacteria 689
505 Ga0496123_0000056 3300048926 Bacteria 231365
506 Ga0496123_0004918 3300048926 Bacteria 13710
507 Ga0496123_0039114 3300048926 Bacteria 3322
508 Ga0496124_0000109 3300048927 Bacteria 166429
509 Ga0496124_0000362 3300048927 Bacteria 82902
510 Ga0496124_0079721 3300048927 Bacteria 2696
511 Ga0496124_0150054 3300048927 Bacteria 1830
512 Ga0496124_0866991 3300048927 Bacteria 551
513 Ga0496125_0000183 3300048928 Bacteria 137652
514 Ga0496125_0043310 3300048928 Bacteria 3823
515 Ga0496125_0073702 3300048928 Bacteria 2652
516 Ga0496125_0077813 3300048928 Bacteria 2553
517 Ga0496126_0006344 3300048929 Bacteria 13188
518 Ga0496126_0141620 3300048929 Bacteria 2069
519 Ga0496126_0228821 3300048929 Bacteria 1558
520 Ga0501306_018201 3300049127 Bacteria 959
521 Ga0501308_081260 3300049128 Bacteria 516
522 Ga0501309_058391 3300049129 Bacteria 617
523 Ga0501309_074238 3300049129 Bacteria 563
524 Ga0501305_069985 3300049161 Bacteria 616
525 Ga0501305_113241 3300049161 Bacteria 515
526 Ga0501307_070198 3300049162 Bacteria 557
527 Ga0495678_006376 3300049459 Bacteria 6289
528 Ga0495678_043154 3300049459 Bacteria 1793
529 Ga0501315_085587 3300049531 Bacteria 540
530 Ga0501317_083839 3300049533 Bacteria 555
531 Ga0501320_054611 3300049536 Bacteria 551
532 Ga0501323_075062 3300049539 Bacteria 546
533 Ga0501324_022906 3300049540 Bacteria 648
534 Ga0501031_0821200 3300049568 Bacteria 596
535 Ga0501032_0431618 3300049569 Bacteria 845
536 Ga0501033_0275648 3300049570 Bacteria 1188
537 Ga0501033_0413398 3300049570 Bacteria 940
538 Ga0501034_0011935 3300049571 Bacteria 8981
539 Ga0501034_0178974 3300049571 Bacteria 2086
540 Ga0501034_0800099 3300049571 Bacteria 835
541 Ga0501036_0221316 3300049572 Bacteria 1589
542 Ga0501036_0821457 3300049572 Bacteria 765
543 Ga0501036_1130266 3300049572 Bacteria 639
544 Ga0501037_0067091 3300049573 Bacteria 2613
545 Ga0501037_0107774 3300049573 Bacteria 2007
546 Ga0501038_0125228 3300049574 Bacteria 2115
547 Ga0501038_0146126 3300049574 Bacteria 1930
548 Ga0501038_0321906 3300049574 Bacteria 1209
549 Ga0501038_0495257 3300049574 Bacteria 935
550 Ga0501039_0255753 3300049575 Bacteria 1377
551 Ga0501039_0326534 3300049575 Bacteria 1206
552 Ga0501040_0503183 3300049576 Bacteria 873
553 Ga0501042_0175169 3300049578 Bacteria 1548
554 Ga0501042_0555864 3300049578 Bacteria 834
555 Ga0501043_0072190 3300049579 Bacteria 2711
556 Ga0501043_0085158 3300049579 Bacteria 2484
557 Ga0501043_0119041 3300049579 Bacteria 2071
558 Ga0501043_0467570 3300049579 Bacteria 945
559 Ga0501043_0737215 3300049579 Bacteria 717
560 Ga0501046_0019737 3300049580 Bacteria 5587
561 Ga0501046_0280369 3300049580 Bacteria 1221
562 Ga0501047_0149608 3300049581 Bacteria 2211
563 Ga0501047_0409422 3300049581 Bacteria 1188
564 Ga0501047_0975905 3300049581 Bacteria 660
565 Ga0501067_0173491 3300049583 Bacteria 1201
566 Ga0501067_0427974 3300049583 Bacteria 739
567 Ga0501068_0420331 3300049584 Bacteria 863
568 Ga0501069_0160929 3300049585 Bacteria 1293
569 Ga0501070_0154309 3300049586 Bacteria 1894
570 Ga0501070_0351670 3300049586 Bacteria 1196
571 Ga0501070_0383034 3300049586 Bacteria 1139
572 Ga0501070_0470377 3300049586 Bacteria 1012
573 Ga0501070_0973580 3300049586 Bacteria 659
574 Ga0501071_1356614 3300049587 Bacteria 549
575 Ga0501073_0078930 3300049589 Bacteria 2291
576 Ga0501073_0116996 3300049589 Bacteria 1847
577 Ga0501073_0266111 3300049589 Bacteria 1183
578 Ga0501079_0631051 3300049741 Bacteria 843
579 Ga0501080_0054256 3300049742 Bacteria 3732
580 Ga0501080_0209894 3300049742 Bacteria 1785
581 Ga0501083_0072370 3300049744 Bacteria 2292
582 Ga0501035_0043057 3300049822 Bacteria 4070
583 Ga0501035_0128279 3300049822 Bacteria 2213
584 Ga0501035_0157921 3300049822 Bacteria 1964
585 Ga0501035_0797720 3300049822 Bacteria 754
586 Ga0501044_0028616 3300049823 Bacteria 5881
587 Ga0501044_0029671 3300049823 Bacteria 5766
588 Ga0501044_0100286 3300049823 Bacteria 2914
589 Ga0501044_0123912 3300049823 Bacteria 2583
590 Ga0501044_0661955 3300049823 Bacteria 932
591 Ga0501044_0942702 3300049823 Bacteria 736
592 Ga0501044_0976405 3300049823 Bacteria 719
593 Ga0501044_1320969 3300049823 Bacteria 587
594 nmdc:mga0k408_654_c1 3300050493 Bacteria 18954
595 nmdc:mga06z11_1339_c1 3300050494 Bacteria 9112
596 nmdc:mga04h51_5454_c1 3300050495 Bacteria 3244
597 nmdc:mga09592_1478830_c1 3300050508 Bacteria 553
598 nmdc:mga06r32_992748_c1 3300050510 Bacteria 792
599 Ga0495601_0428118 3300053077 Bacteria 857
600 Ga0495612_0030521 3300053078 Bacteria 2171
601 Ga0500644_0096917 3300053088 Bacteria 1114
602 Ga0500583_0104813 3300053092 Bacteria 1388
603 Ga0500651_0000883 3300053093 Bacteria 14706
604 Ga0500651_0617129 3300053093 Bacteria 587
605 Ga0500640_008153 3300053095 Bacteria 4125
606 Ga0500650_0116641 3300053098 Bacteria 1246
607 Ga0500553_053216 3300053101 Bacteria 1933
608 Ga0500560_004757 3300053107 Bacteria 2927
609 Ga0500572_151377 3300053111 Bacteria 758
610 Ga0500652_397003 3300053131 Bacteria 511
611 Ga0500559_0021570 3300053136 Bacteria 2730
612 Ga0500559_0307607 3300053136 Bacteria 744
613 Ga0500573_0521807 3300053140 Bacteria 532
614 Ga0500600_0224659 3300053149 Bacteria 863
615 Ga0500600_0429748 3300053149 Bacteria 514
616 Ga0501084_0010778 3300054114 Bacteria 7568
617 Ga0501084_0021169 3300054114 Bacteria 5423
618 Ga0590071_001406 3300059421 Bacteria 6373
619 Ga0590074_035328 3300059423 Bacteria 890
620 Ga0501082_0000055 3300060353 Bacteria 80800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300020080 Ga0206350_10081943 Ga0206350_100819431 111
2 3300031995 Ga0307409_102007565 Ga0307409_1020075651 128
3 3300039450 Ga0436363_1410686 Ga0436363_1410686_221_646 128
4 iso_pu_bacteria 2582581313 2585310545 129
5 iso_pu_bacteria 2582581314 2585315653 129
6 iso_pu_bacteria 2643221647 2644264456 129
7 iso_pu_bacteria 2643221678 2644436786 129
8 iso_pu_bacteria 2784132148 2784588255 129
9 iso_pu_bacteria 2784746763 2785343767 129
10 iso_pu_bacteria 2784746768 2785369069 129
11 iso_pu_bacteria 2786546132 2786670217 129
12 iso_pu_bacteria 2808606359 2808841681 129
13 iso_pu_bacteria 2808606375 2808920216 129
14 iso_pu_bacteria 2808606448 2809231868 129
15 iso_pu_bacteria 2811994917 2812480894 129
16 iso_pu_bacteria 2862382967 2862390792 129
17 iso_pu_bacteria 2862574272 2862579593 129
18 iso_pu_bacteria 2863404153 2863405096 129
19 iso_pu_bacteria 2867369537 2867372356 129
20 iso_pu_bacteria 2867428634 2867431822 129
21 iso_pu_bacteria 2877676314 2877681489 129
22 iso_pu_bacteria 2919468124 2919474768 129
23 iso_pu_bacteria 2954002825 2954004769 129
24 iso_pu_bacteria 2954380949 2954386619 129
25 iso_pu_bacteria 2954673503 2954676559 129
26 iso_pu_bacteria 2954682443 2954687608 129
27 iso_pu_bacteria 2954691527 2954697432 129
28 iso_pu_bacteria 2954701450 2954704823 129
29 iso_pu_bacteria 2954711539 2954716596 129
30 iso_pu_bacteria 2954759201 2954764440 129
31 iso_pu_bacteria 2990059506 2990060793 129
32 iso_pu_bacteria 3006393351 3006396135 129
33 iso_pu_bacteria 8008558824 8008568022 129
34 iso_pu_bacteria 8023623736 8023631830 129
35 iso_pu_bacteria 8048406513 8048413048 129
36 iso_pu_bacteria 8056829672 8056830438 129
37 iso_pu_bacteria 2510065053 2510282915 130
38 iso_pu_bacteria 2510065055 2510293589 130
39 iso_pu_bacteria 2510065058 2510310805 130
40 iso_pu_bacteria 2773857672 2774129028 130
41 iso_pu_bacteria 2917832318 2917836841 130
42 iso_pu_bacteria 2974298342 2974302550 130
43 iso_pu_bacteria 2984499530 2984499866 130
44 3300003354 JGI25160J50197_1017719 JGI25160J50197_10177192 131
45 3300003790 Ga0055528_1009303 Ga0055528_10093035 131
46 3300005335 Ga0070666_10088537 Ga0070666_100885372 131
47 3300005347 Ga0070668_100235864 Ga0070668_1002358641 131
48 3300005353 Ga0070669_101055809 Ga0070669_1010558091 131
49 3300005355 Ga0070671_100302571 Ga0070671_1003025711 131
50 3300005367 Ga0070667_100489063 Ga0070667_1004890632 131
51 3300005455 Ga0070663_100060627 Ga0070663_1000606272 131
52 3300006178 Ga0075367_10096604 Ga0075367_100966042 131
53 3300009011 Ga0105251_10011873 Ga0105251_100118735 131
54 3300009036 Ga0105244_10099122 Ga0105244_100991221 131
55 3300009092 Ga0105250_10028687 Ga0105250_100286872 131
56 3300009553 Ga0105249_10098735 Ga0105249_100987352 131
57 3300017792 Ga0163161_10138706 Ga0163161_101387061 131
58 3300025258 Ga0209129_1001529 Ga0209129_10015297 131
59 3300025273 Ga0209673_1002499 Ga0209673_10024996 131
60 3300025284 Ga0209130_1020681 Ga0209130_10206812 131
61 3300025294 Ga0209025_1030865 Ga0209025_10308651 131
62 3300025299 Ga0209256_1003962 Ga0209256_10039629 131
63 3300025302 Ga0207426_1000447 Ga0207426_100044751 131
64 3300025303 Ga0209051_1109207 Ga0209051_11092071 131
65 3300025728 Ga0207655_1190615 Ga0207655_11906151 131
66 3300025931 Ga0207644_10044010 Ga0207644_100440103 131
67 3300025961 Ga0207712_10499502 Ga0207712_104995022 131
68 3300025972 Ga0207668_10221301 Ga0207668_102213011 131
69 3300025986 Ga0207658_10532041 Ga0207658_105320412 131
70 3300026067 Ga0207678_10125542 Ga0207678_101255422 131
71 3300048904 Ga0496101_0331209 Ga0496101_0331209_348_764 131
72 3300048905 Ga0496102_0067434 Ga0496102_0067434_1282_1698 131
73 3300048906 Ga0496103_0320712 Ga0496103_0320712_346_762 131
74 3300048907 Ga0496104_0145630 Ga0496104_0145630_122_538 131
75 3300048908 Ga0496105_0085946 Ga0496105_0085946_1360_1776 131
76 3300048910 Ga0496107_0194250 Ga0496107_0194250_941_1357 131
77 3300048911 Ga0496108_0525151 Ga0496108_0525151_108_524 131
78 3300048912 Ga0496109_0215642 Ga0496109_0215642_1201_1617 131
79 3300048913 Ga0496110_0134960 Ga0496110_0134960_361_777 131
80 3300048914 Ga0496111_0167081 Ga0496111_0167081_942_1358 131
81 3300048915 Ga0496112_0574757 Ga0496112_0574757_400_816 131
82 3300048916 Ga0496113_0101048 Ga0496113_0101048_1278_1694 131
83 3300048917 Ga0496114_0472021 Ga0496114_0472021_457_873 131
84 3300048919 Ga0496116_0008006 Ga0496116_0008006_2327_2743 131
85 3300048923 Ga0496120_0122004 Ga0496120_0122004_516_932 131
86 3300048924 Ga0496121_0355710 Ga0496121_0355710_61_477 131
87 3300048925 Ga0496122_0091279 Ga0496122_0091279_1049_1465 131
88 3300048927 Ga0496124_0079721 Ga0496124_0079721_150_566 131
89 3300048928 Ga0496125_0073702 Ga0496125_0073702_1816_2232 131
90 3300048929 Ga0496126_0228821 Ga0496126_0228821_488_904 131
91 iso_pu_bacteria 2585427591 2585826554 132
92 iso_pu_bacteria 2585427592 2585832658 132
93 iso_pu_bacteria 2667528173 2671109216 132
94 iso_pu_bacteria 2904474040 2904477505 132
95 iso_pu_bacteria 2919150387 2919153786 132
96 iso_pu_bacteria 2927143783 2927147198 132
97 iso_pu_bacteria 2998344455 2998347405 132
98 3300001989 JGI24739J22299_10097718 JGI24739J22299_100977181 133
99 3300002067 JGI24735J21928_10168173 JGI24735J21928_101681731 133
100 3300003316 rootH1_10011106 rootH1_100111064 133
101 3300003578 Ga0006562J51391_1122768 Ga0006562J51391_11227685 133
102 3300005543 Ga0070672_100322727 Ga0070672_1003227272 133
103 3300006038 Ga0075365_10053112 Ga0075365_100531122 133
104 3300006178 Ga0075367_10001212 Ga0075367_100012125 133
105 3300006948 Ga0099826_10187612 Ga0099826_101876121 133
106 3300011119 Ga0105246_10015842 Ga0105246_100158423 133
107 3300013105 Ga0157369_11087195 Ga0157369_110871951 133
108 3300014497 Ga0182008_10167580 Ga0182008_101675801 133
109 3300015262 Ga0182007_10000138 Ga0182007_100001389 133
110 3300020069 Ga0197907_10522073 Ga0197907_105220731 133
111 3300020070 Ga0206356_11258162 Ga0206356_112581621 133
112 3300022467 Ga0224712_10399955 Ga0224712_103999552 133
113 3300025904 Ga0207647_10035575 Ga0207647_100355753 133
114 3300025940 Ga0207691_10303032 Ga0207691_103030322 133
115 3300025981 Ga0207640_10181159 Ga0207640_101811592 133
116 3300027312 Ga0209371_1011748 Ga0209371_10117482 133
117 3300027666 Ga0209282_1386447 Ga0209282_13864471 133
118 3300027866 Ga0209813_10010049 Ga0209813_100100492 133
119 3300028786 Ga0307517_10018067 Ga0307517_100180676 133
120 3300028794 Ga0307515_10001581 Ga0307515_1000158122 133
121 3300028794 Ga0307515_10017589 Ga0307515_100175895 133
122 3300030500 Ga0268256_1012808 Ga0268256_10128082 133
123 3300030521 Ga0307511_10001316 Ga0307511_100013165 133
124 3300030522 Ga0307512_10002993 Ga0307512_1000299313 133
125 3300031507 Ga0307509_10018435 Ga0307509_100184351 133
126 3300031507 Ga0307509_10207284 Ga0307509_102072842 133
127 3300031548 Ga0307408_102055208 Ga0307408_1020552081 133
128 3300031616 Ga0307508_10008978 Ga0307508_100089786 133
129 3300031616 Ga0307508_10130127 Ga0307508_101301272 133
130 3300031616 Ga0307508_10208079 Ga0307508_102080793 133
131 3300031649 Ga0307514_10057412 Ga0307514_100574122 133
132 3300031649 Ga0307514_10149419 Ga0307514_101494192 133
133 3300031649 Ga0307514_10168437 Ga0307514_101684371 133
134 3300031730 Ga0307516_10007700 Ga0307516_100077002 133
135 3300031730 Ga0307516_10088306 Ga0307516_100883063 133
136 3300031838 Ga0307518_10081297 Ga0307518_100812973 133
137 3300031838 Ga0307518_10417860 Ga0307518_104178602 133
138 3300031838 Ga0307518_10488345 Ga0307518_104883451 133
139 3300031838 Ga0307518_10509710 Ga0307518_105097101 133
140 3300033179 Ga0307507_10005088 Ga0307507_100050885 133
141 3300033179 Ga0307507_10010180 Ga0307507_100101803 133
142 3300033179 Ga0307507_10268688 Ga0307507_102686881 133
143 3300033180 Ga0307510_10011357 Ga0307510_100113577 133
144 3300033180 Ga0307510_10093916 Ga0307510_100939162 133
145 3300033180 Ga0307510_10139353 Ga0307510_101393533 133
146 3300041404 Ga0439436_0024379 Ga0439436_0024379_125_538 133
147 3300041406 Ga0439439_0010007 Ga0439439_0010007_80_493 133
148 3300041406 Ga0439439_0058213 Ga0439439_0058213_254_667 133
149 3300041444 Ga0451790_47954 Ga0451790_47954_49_462 133
150 3300041451 Ga0451791_1192668 Ga0451791_1192668_342_755 133
151 3300041486 Ga0451807_0359962 Ga0451807_0359962_176_589 133
152 3300041502 Ga0451846_05427 Ga0451846_05427_29_442 133
153 3300041502 Ga0451846_46678 Ga0451846_46678_48_461 133
154 3300041503 Ga0451847_1002177 Ga0451847_1002177_186_602 133
155 3300041505 Ga0451849_0500776 Ga0451849_0500776_67_480 133
156 3300041512 Ga0451853_1935799 Ga0451853_1935799_72_485 133
157 3300041512 Ga0451853_2748623 Ga0451853_2748623_1931_2344 133
158 3300041999 Ga0439433_0012549 Ga0439433_0012549_32_445 133
159 3300042007 Ga0439449_0011840 Ga0439449_0011840_1923_2336 133
160 3300042007 Ga0439449_0148722 Ga0439449_0148722_409_822 133
161 3300042008 Ga0439450_176428 Ga0439450_176428_38_451 133
162 3300042014 Ga0439457_000067 Ga0439457_000067_496_909 133
163 3300042014 Ga0439457_019977 Ga0439457_019977_320_733 133
164 3300042131 Ga0450894_002002 Ga0450894_002002_1187_1600 133
165 3300042133 Ga0450896_000634 Ga0450896_000634_701_1114 133
166 3300042134 Ga0450898_008488 Ga0450898_008488_493_906 133
167 3300042135 Ga0450899_002987 Ga0450899_002987_839_1252 133
168 3300042136 Ga0450900_013256 Ga0450900_013256_12_425 133
169 3300042145 Ga0450906_012125 Ga0450906_012125_398_811 133
170 3300042157 Ga0439458_0022738 Ga0439458_0022738_515_928 133
171 3300042184 Ga0450908_003370 Ga0450908_003370_1982_2395 133
172 3300044658 Ga0466972_0012227 Ga0466972_0012227_2713_3126 133
173 3300044684 Ga0466966_0031611 Ga0466966_0031611_1289_1702 133
174 3300044693 Ga0466961_0004232 Ga0466961_0004232_67_480 133
175 3300044694 Ga0466963_0001367 Ga0466963_0001367_1365_1778 133
176 3300044735 Ga0466968_0047531 Ga0466968_0047531_1361_1774 133
177 3300044901 Ga0466960_0058579 Ga0466960_0058579_78_491 133
178 3300045049 Ga0466959_1081050 Ga0466959_1081050_101_514 133
179 3300045836 Ga0466958_0812018 Ga0466958_0812018_51_464 133
180 3300045976 Ga0466967_0140803 Ga0466967_0140803_500_913 133
181 3300045976 Ga0466967_0795008 Ga0466967_0795008_294_707 133
182 3300046455 Ga0495603_0002581 Ga0495603_0002581_547_960 133
183 3300046459 Ga0495629_0006477 Ga0495629_0006477_303_716 133
184 3300046459 Ga0495629_0067998 Ga0495629_0067998_828_1241 133
185 3300046460 Ga0495638_0019580 Ga0495638_0019580_2051_2464 133
186 3300046462 Ga0495651_0024350 Ga0495651_0024350_3071_3484 133
187 3300046475 Ga0495639_0139416 Ga0495639_0139416_273_686 133
188 3300046476 Ga0495662_0001236 Ga0495662_0001236_9392_9805 133
189 3300046476 Ga0495662_0039489 Ga0495662_0039489_1557_1970 133
190 3300046477 Ga0495664_0003532 Ga0495664_0003532_6184_6597 133
191 3300046499 Ga0495594_0718323 Ga0495594_0718323_50_463 133
192 3300046514 Ga0495618_0065293 Ga0495618_0065293_676_1089 133
193 3300046516 Ga0495628_0035900 Ga0495628_0035900_2895_3308 133
194 3300046517 Ga0495630_0028167 Ga0495630_0028167_2517_2930 133
195 3300046526 Ga0495666_0043474 Ga0495666_0043474_1612_2025 133
196 3300046533 Ga0495640_0293854 Ga0495640_0293854_499_912 133
197 3300046536 Ga0495587_0016382 Ga0495587_0016382_2972_3385 133
198 3300046543 Ga0495645_0024111 Ga0495645_0024111_1789_2202 133
199 3300046559 Ga0495667_0268885 Ga0495667_0268885_239_652 133
200 3300046642 Ga0495634_0000467 Ga0495634_0000467_37932_38345 133
201 3300046660 Ga0495625_0015034 Ga0495625_0015034_1765_2178 133
202 3300046660 Ga0495625_0285788 Ga0495625_0285788_60_473 133
203 3300046663 Ga0495635_0002195 Ga0495635_0002195_11962_12375 133
204 3300046674 Ga0495588_0002185 Ga0495588_0002185_7434_7847 133
205 3300046674 Ga0495588_0026141 Ga0495588_0026141_1390_1803 133
206 3300046675 Ga0495657_0003345 Ga0495657_0003345_10822_11235 133
207 3300046675 Ga0495657_0008782 Ga0495657_0008782_6448_6861 133
208 3300046679 Ga0495623_0196310 Ga0495623_0196310_260_673 133
209 3300046680 Ga0495646_0003952 Ga0495646_0003952_2630_3043 133
210 3300046683 Ga0495658_0047726 Ga0495658_0047726_89_502 133
211 3300046689 Ga0495613_0075994 Ga0495613_0075994_417_830 133
212 3300046689 Ga0495613_0091543 Ga0495613_0091543_1758_2171 133
213 3300046692 Ga0495671_0203300 Ga0495671_0203300_246_659 133
214 3300046809 Ga0495600_0009427 Ga0495600_0009427_1355_1768 133
215 3300047315 Ga0495581_0003284 Ga0495581_0003284_8642_9055 133
216 3300047315 Ga0495581_0261900 Ga0495581_0261900_13_426 133
217 3300047317 Ga0495604_0001778 Ga0495604_0001778_10706_11119 133
218 3300047319 Ga0495674_0015566 Ga0495674_0015566_2504_2917 133
219 3300047321 Ga0495676_0037296 Ga0495676_0037296_46_459 133
220 3300047444 Ga0495675_0118178 Ga0495675_0118178_1220_1633 133
221 3300047447 Ga0495685_010161 Ga0495685_010161_496_909 133
222 3300047447 Ga0495685_242041 Ga0495685_242041_96_509 133
223 3300047470 Ga0495681_0000855 Ga0495681_0000855_19554_19967 133
224 3300047673 Ga0495593_0024835 Ga0495593_0024835_2885_3298 133
225 3300048089 Ga0495614_0004153 Ga0495614_0004153_834_1247 133
226 3300048089 Ga0495614_0005183 Ga0495614_0005183_2777_3190 133
227 3300049127 Ga0501306_018201 Ga0501306_018201_50_463 133
228 3300049128 Ga0501308_081260 Ga0501308_081260_54_467 133
229 3300049129 Ga0501309_058391 Ga0501309_058391_50_463 133
230 3300049129 Ga0501309_074238 Ga0501309_074238_42_455 133
231 3300049161 Ga0501305_069985 Ga0501305_069985_50_463 133
232 3300049161 Ga0501305_113241 Ga0501305_113241_65_478 133
233 3300049162 Ga0501307_070198 Ga0501307_070198_106_519 133
234 3300049531 Ga0501315_085587 Ga0501315_085587_27_440 133
235 3300049533 Ga0501317_083839 Ga0501317_083839_52_465 133
236 3300049536 Ga0501320_054611 Ga0501320_054611_67_480 133
237 3300049539 Ga0501323_075062 Ga0501323_075062_89_502 133
238 3300049540 Ga0501324_022906 Ga0501324_022906_215_628 133
239 3300049568 Ga0501031_0821200 Ga0501031_0821200_34_447 133
240 3300049572 Ga0501036_1130266 Ga0501036_1130266_67_480 133
241 3300049574 Ga0501038_0146126 Ga0501038_0146126_1449_1862 133
242 3300049586 Ga0501070_0351670 Ga0501070_0351670_519_932 133
243 3300049586 Ga0501070_0973580 Ga0501070_0973580_141_554 133
244 3300049587 Ga0501071_1356614 Ga0501071_1356614_70_483 133
245 3300049822 Ga0501035_0797720 Ga0501035_0797720_272_685 133
246 3300050494 nmdc:mga06z11_1339_c1 nmdc:mga06z11_1339_c1_6032_6445 133
247 3300050495 nmdc:mga04h51_5454_c1 nmdc:mga04h51_5454_c1_1399_1812 133
248 3300053077 Ga0495601_0428118 Ga0495601_0428118_423_836 133
249 3300053078 Ga0495612_0030521 Ga0495612_0030521_1568_1981 133
250 3300053088 Ga0500644_0096917 Ga0500644_0096917_648_1061 133
251 3300053092 Ga0500583_0104813 Ga0500583_0104813_287_700 133
252 3300053093 Ga0500651_0617129 Ga0500651_0617129_35_448 133
253 3300053095 Ga0500640_008153 Ga0500640_008153_265_678 133
254 3300053101 Ga0500553_053216 Ga0500553_053216_1475_1888 133
255 3300053107 Ga0500560_004757 Ga0500560_004757_756_1169 133
256 3300053111 Ga0500572_151377 Ga0500572_151377_222_635 133
257 3300053131 Ga0500652_397003 Ga0500652_397003_68_481 133
258 3300053136 Ga0500559_0307607 Ga0500559_0307607_20_433 133
259 3300053140 Ga0500573_0521807 Ga0500573_0521807_11_424 133
260 3300053149 Ga0500600_0224659 Ga0500600_0224659_369_782 133
261 3300053149 Ga0500600_0429748 Ga0500600_0429748_43_456 133
262 iso_pu_bacteria 2508501125 2509131984 133
263 iso_pu_bacteria 2513237151 2513962033 133
264 iso_pu_bacteria 2526164713 2527075308 133
265 iso_pu_bacteria 2562617112 2563065124 133
266 iso_pu_bacteria 2600255256 2601534533 133
267 iso_pu_bacteria 2600255257 2601539118 133
268 iso_pu_bacteria 2600255310 2601757467 133
269 iso_pu_bacteria 2600255311 2601763826 133
270 iso_pu_bacteria 2602042046 2603640172 133
271 iso_pu_bacteria 2711768613 2713481888 133
272 iso_pu_bacteria 2738541296 2738821501 133
273 iso_pu_bacteria 2738541298 2738833984 133
274 iso_pu_bacteria 2738541306 2738875187 133
275 iso_pu_bacteria 2738543002 2739187141 133
276 iso_pu_bacteria 2738543008 2739221785 133
277 iso_pu_bacteria 2811995292 2813726416 133
278 iso_pu_bacteria 2814123068 2814693792 133
279 iso_pu_bacteria 2884411467 2884415329 133
280 iso_pu_bacteria 2891670763 2891674366 133
281 iso_pu_bacteria 2904504865 2904508172 133
282 iso_pu_bacteria 2921643360 2921645392 133
283 iso_pu_bacteria 2935625433 2935628532 133
284 iso_pu_bacteria 2939617950 2939620845 133
285 iso_pu_bacteria 2945934425 2945936384 133
286 iso_pu_bacteria 2974435778 2974436033 133
287 iso_pu_bacteria 2990703756 2990709711 133
288 iso_pu_bacteria 641736151 642425386 133
289 iso_pu_bacteria 8019504834 8019507198 133
290 iso_pu_bacteria 8055301274 8055308418 133
291 3300006946 Ga0079104_1000041 Ga0079104_1000041108 134
292 3300006948 Ga0099826_10037622 Ga0099826_100376222 134
293 3300009148 Ga0105243_10389996 Ga0105243_103899962 134
294 3300009545 Ga0105237_10006004 Ga0105237_100060048 134
295 3300010375 Ga0105239_10000694 Ga0105239_100006942 134
296 3300015262 Ga0182007_10279545 Ga0182007_102795452 134
297 3300025913 Ga0207695_10041030 Ga0207695_100410303 134
298 3300025913 Ga0207695_10097450 Ga0207695_100974502 134
299 3300025914 Ga0207671_10010811 Ga0207671_100108113 134
300 3300025935 Ga0207709_10263245 Ga0207709_102632452 134
301 3300025981 Ga0207640_10009445 Ga0207640_100094453 134
302 3300027111 Ga0209281_1000073 Ga0209281_1000073107 134
303 3300031911 Ga0307412_10004361 Ga0307412_100043612 134
304 3300041453 Ga0451797_0926805 Ga0451797_0926805_37_441 134
305 3300046524 Ga0495648_0041907 Ga0495648_0041907_822_1244 134
306 3300047472 Ga0495686_0037853 Ga0495686_0037853_2647_3069 134
307 3300048921 Ga0496118_0009223 Ga0496118_0009223_2014_2436 134
308 3300048921 Ga0496118_0052159 Ga0496118_0052159_899_1321 134
309 3300048921 Ga0496118_0495200 Ga0496118_0495200_68_490 134
310 3300048924 Ga0496121_0005819 Ga0496121_0005819_647_1069 134
311 3300048924 Ga0496121_0007228 Ga0496121_0007228_6863_7285 134
312 3300048927 Ga0496124_0150054 Ga0496124_0150054_114_536 134
313 3300048929 Ga0496126_0141620 Ga0496126_0141620_1325_1747 134
314 3300049571 Ga0501034_0178974 Ga0501034_0178974_413_835 134
315 3300049573 Ga0501037_0107774 Ga0501037_0107774_588_1010 134
316 3300049822 Ga0501035_0043057 Ga0501035_0043057_58_480 134
317 3300053136 Ga0500559_0021570 Ga0500559_0021570_1377_1799 134
318 iso_pu_bacteria 2510065057 2510304823 134
319 iso_pu_bacteria 2513237143 2513902766 134
320 iso_pu_bacteria 2551306091 2551725771 134
321 iso_pu_bacteria 2551306092 2551733436 134
322 iso_pu_bacteria 2721755763 2723878630 134
323 iso_pu_bacteria 2786546517 2787436839 134
324 iso_pu_bacteria 2842918807 2842922556 134
325 iso_pu_bacteria 2844533157 2844536100 134
326 iso_pu_bacteria 2855825444 2855829907 134
327 iso_pu_bacteria 2884338543 2884342577 134
328 iso_pu_bacteria 2915986958 2915989596 134
329 iso_pu_bacteria 2915993759 2915999140 134
330 iso_pu_bacteria 2916007675 2916011964 134
331 iso_pu_bacteria 2916014648 2916017827 134
332 iso_pu_bacteria 2916041962 2916043170 134
333 iso_pu_bacteria 2916048683 2916049418 134
334 iso_pu_bacteria 2916076590 2916076641 134
335 iso_pu_bacteria 2921208531 2921208611 134
336 iso_pu_bacteria 2921237296 2921238387 134
337 iso_pu_bacteria 2921244191 2921249971 134
338 iso_pu_bacteria 2921282425 2921289180 134
339 iso_pu_bacteria 2921296804 2921302704 134
340 iso_pu_bacteria 2924144063 2924150259 134
341 iso_pu_bacteria 2924150972 2924153498 134
342 iso_pu_bacteria 2924200457 2924206388 134
343 iso_pu_bacteria 2924214083 2924220806 134
344 iso_pu_bacteria 2924221636 2924224891 134
345 iso_pu_bacteria 2937002841 2937008822 134
346 iso_pu_bacteria 2937009748 2937012349 134
347 iso_pu_bacteria 2937049772 2937049818 134
348 iso_pu_bacteria 2937056579 2937056746 134
349 iso_pu_bacteria 2937091812 2937091848 134
350 iso_pu_bacteria 2937113482 2937113808 134
351 iso_pu_bacteria 2953994433 2953996742 134
352 iso_pu_bacteria 2954721474 2954726543 134
353 iso_pu_bacteria 2954731030 2954735252 134
354 iso_pu_bacteria 2954740390 2954745467 134
355 iso_pu_bacteria 2954749733 2954754121 134
356 iso_pu_bacteria 2957408893 2957412716 134
357 iso_pu_bacteria 2957422303 2957423132 134
358 iso_pu_bacteria 2957430029 2957432390 134
359 iso_pu_bacteria 2957450854 2957453384 134
360 iso_pu_bacteria 2957464669 2957470348 134
361 iso_pu_bacteria 2957471148 2957474109 134
362 iso_pu_bacteria 2957484790 2957487988 134
363 iso_pu_bacteria 2957491536 2957493521 134
364 iso_pu_bacteria 2957498199 2957498244 134
365 iso_pu_bacteria 2960584000 2960586441 134
366 iso_pu_bacteria 2960597568 2960598983 134
367 iso_pu_bacteria 2960624210 2960629482 134
368 iso_pu_bacteria 2960637947 2960639341 134
369 iso_pu_bacteria 2960652885 2960658273 134
370 iso_pu_bacteria 2960667422 2960673632 134
371 iso_pu_bacteria 2960674078 2960679986 134
372 iso_pu_bacteria 2960687367 2960691246 134
373 iso_pu_bacteria 2964607997 2964608029 134
374 iso_pu_bacteria 2964621998 2964628670 134
375 iso_pu_bacteria 2964628898 2964629596 134
376 iso_pu_bacteria 2964649959 2964654675 134
377 iso_pu_bacteria 2964656573 2964657862 134
378 iso_pu_bacteria 2964678106 2964680785 134
379 iso_pu_bacteria 2964685014 2964691505 134
380 iso_pu_bacteria 2964698721 2964701083 134
381 iso_pu_bacteria 2964712639 2964718270 134
382 iso_pu_bacteria 2964719344 2964720911 134
383 iso_pu_bacteria 2967671571 2967678106 134
384 iso_pu_bacteria 2967706974 2967708914 134
385 iso_pu_bacteria 2967714385 2967719714 134
386 iso_pu_bacteria 2967721400 2967726743 134
387 iso_pu_bacteria 2967742019 2967747302 134
388 iso_pu_bacteria 2967748971 2967753185 134
389 iso_pu_bacteria 2967769361 2967775115 134
390 iso_pu_bacteria 2970040964 2970043690 134
391 iso_pu_bacteria 2970047711 2970047939 134
392 iso_pu_bacteria 2970061556 2970061601 134
393 iso_pu_bacteria 2970076120 2970079924 134
394 iso_pu_bacteria 2970082768 2970085521 134
395 iso_pu_bacteria 2970088815 2970088860 134
396 iso_pu_bacteria 2970109326 2970113256 134
397 iso_pu_bacteria 2970116247 2970117214 134
398 iso_pu_bacteria 2970136068 2970139100 134
399 iso_pu_bacteria 2970149975 2970156538 134
400 iso_pu_bacteria 2970156795 2970156803 134
401 iso_pu_bacteria 2970170962 2970172570 134
402 iso_pu_bacteria 2970177841 2970182650 134
403 iso_pu_bacteria 2970184632 2970185187 134
404 iso_pu_bacteria 2977516862 2977517542 134
405 iso_pu_bacteria 2977537788 2977541895 134
406 iso_pu_bacteria 2977558990 2977565683 134
407 iso_pu_bacteria 2977572785 2977578586 134
408 iso_pu_bacteria 2977579622 2977581349 134
409 iso_pu_bacteria 648276728 648736286 134
410 3300003771 Ga0055526_1000052 Ga0055526_100005223 135
411 3300025263 Ga0209565_1028525 Ga0209565_10285252 135
412 3300025295 Ga0209564_1000026 Ga0209564_1000026343 135
413 3300025924 Ga0207694_10408381 Ga0207694_104083812 135
414 3300046501 Ga0495607_0027452 Ga0495607_0027452_2669_3076 135
415 3300046507 Ga0495606_0000044 Ga0495606_0000044_10488_10895 135
416 3300046512 Ga0495610_0001877 Ga0495610_0001877_117_524 135
417 3300046558 Ga0495633_0016289 Ga0495633_0016289_1022_1429 135
418 3300046558 Ga0495633_0095959 Ga0495633_0095959_843_1250 135
419 3300046616 Ga0495668_0000482 Ga0495668_0000482_5632_6039 135
420 3300046694 Ga0495649_0094209 Ga0495649_0094209_392_799 135
421 3300047472 Ga0495686_0018256 Ga0495686_0018256_1028_1435 135
422 3300048919 Ga0496116_0055068 Ga0496116_0055068_1829_2236 135
423 3300048924 Ga0496121_0714478 Ga0496121_0714478_181_588 135
424 3300048926 Ga0496123_0039114 Ga0496123_0039114_686_1111 135
425 iso_pu_bacteria 2965089291 2965095659 135
426 3300002737 JGI25162J39368_1000007 JGI25162J39368_1000007129 136
427 3300002771 JGI25163J39215_1000410 JGI25163J39215_10004109 136
428 3300002772 JGI25164J39214_1000010 JGI25164J39214_1000010247 136
429 3300002772 JGI25164J39214_1000016 JGI25164J39214_100001661 136
430 3300003751 Ga0055538_1000006 Ga0055538_1000006129 136
431 3300003752 Ga0055539_1000010 Ga0055539_1000010129 136
432 3300003756 Ga0055533_1000013 Ga0055533_1000013129 136
433 3300003759 Ga0055525_1000015 Ga0055525_1000015129 136
434 3300003841 Ga0055541_1000007 Ga0055541_1000007246 136
435 3300005289 Ga0065704_10000667 Ga0065704_100006675 136
436 3300005843 Ga0068860_100015862 Ga0068860_1000158625 136
437 3300005981 Ga0081538_10018400 Ga0081538_100184007 136
438 3300009036 Ga0105244_10000026 Ga0105244_1000002677 136
439 3300009036 Ga0105244_10013663 Ga0105244_100136636 136
440 3300009092 Ga0105250_10000889 Ga0105250_100008893 136
441 3300013102 Ga0157371_10000044 Ga0157371_1000004485 136
442 3300013104 Ga0157370_10014800 Ga0157370_100148003 136
443 3300013306 Ga0163162_10241183 Ga0163162_102411832 136
444 3300025207 Ga0209760_100034 Ga0209760_1000343 136
445 3300025224 Ga0209784_100022 Ga0209784_100022242 136
446 3300025225 Ga0209566_100021 Ga0209566_100021242 136
447 3300025226 Ga0209674_100038 Ga0209674_100038242 136
448 3300025230 Ga0209563_100042 Ga0209563_100042242 136
449 3300025231 Ga0207427_100027 Ga0207427_100027242 136
450 3300025233 Ga0209437_100049 Ga0209437_100049242 136
451 3300025253 Ga0209677_100025 Ga0209677_100025242 136
452 3300025261 Ga0209233_1002834 Ga0209233_10028347 136
453 3300025711 Ga0207696_1000952 Ga0207696_100095213 136
454 3300025728 Ga0207655_1000057 Ga0207655_1000057107 136
455 3300025728 Ga0207655_1009713 Ga0207655_10097131 136
456 3300031852 Ga0307410_11083404 Ga0307410_110834041 136
457 3300039447 Ga0436361_0393634 Ga0436361_0393634_2701_3123 136
458 3300041491 Ga0451833_1362901 Ga0451833_1362901_57_479 136
459 3300041507 Ga0451851_0733926 Ga0451851_0733926_96_518 136
460 3300041509 Ga0451843_0213834 Ga0451843_0213834_28_450 136
461 3300041512 Ga0451853_1657403 Ga0451853_1657403_265_687 136
462 3300042013 Ga0439456_002153 Ga0439456_002153_2623_3045 136
463 3300045836 Ga0466958_1047114 Ga0466958_1047114_90_512 136
464 3300045976 Ga0466967_0199482 Ga0466967_0199482_1128_1550 136
465 3300046471 Ga0495650_0000039 Ga0495650_0000039_280033_280455 136
466 3300046515 Ga0495620_0259627 Ga0495620_0259627_88_510 136
467 3300046810 Ga0495660_0000023 Ga0495660_0000023_133189_133611 136
468 3300047318 Ga0495636_0302683 Ga0495636_0302683_310_732 136
469 3300047443 Ga0495687_027273 Ga0495687_027273_378_800 136
470 3300048907 Ga0496104_0000208 Ga0496104_0000208_38199_38621 136
471 3300048919 Ga0496116_0000112 Ga0496116_0000112_114462_114884 136
472 3300048920 Ga0496117_0066456 Ga0496117_0066456_1888_2310 136
473 3300048921 Ga0496118_0000454 Ga0496118_0000454_65284_65706 136
474 3300048921 Ga0496118_0066244 Ga0496118_0066244_43_465 136
475 3300048922 Ga0496119_0041634 Ga0496119_0041634_559_981 136
476 3300048923 Ga0496120_0032098 Ga0496120_0032098_1056_1478 136
477 3300048925 Ga0496122_0000067 Ga0496122_0000067_98572_98994 136
478 3300048926 Ga0496123_0000056 Ga0496123_0000056_132372_132794 136
479 3300048927 Ga0496124_0000362 Ga0496124_0000362_54636_55058 136
480 3300048928 Ga0496125_0000183 Ga0496125_0000183_77320_77742 136
481 3300048929 Ga0496126_0006344 Ga0496126_0006344_10638_11060 136
482 3300053098 Ga0500650_0116641 Ga0500650_0116641_459_881 136
483 3300001979 JGI24740J21852_10077636 JGI24740J21852_100776361 137
484 3300002737 JGI25162J39368_1000156 JGI25162J39368_10001569 137
485 3300002737 JGI25162J39368_1000530 JGI25162J39368_100053020 137
486 3300002741 JGI25157J39369_1000416 JGI25157J39369_100041620 137
487 3300002741 JGI25157J39369_1025406 JGI25157J39369_10254061 137
488 3300002771 JGI25163J39215_1000355 JGI25163J39215_100035510 137
489 3300002772 JGI25164J39214_1000086 JGI25164J39214_100008620 137
490 3300002773 JGI25152J39213_1000753 JGI25152J39213_10007537 137
491 3300003214 JGI25165J46597_1000144 JGI25165J46597_100014484 137
492 3300003320 rootH2_10013512 rootH2_100135129 137
493 3300003320 rootH2_10127174 rootH2_101271745 137
494 3300003322 rootL2_10184212 rootL2_101842122 137
495 3300003574 Ga0007410J51695_1067624 Ga0007410J51695_10676241 137
496 3300003751 Ga0055538_1001173 Ga0055538_10011733 137
497 3300003761 Ga0055535_1000061 Ga0055535_100006120 137
498 3300003762 Ga0055542_1000099 Ga0055542_100009984 137
499 3300003763 Ga0055529_1000117 Ga0055529_100011784 137
500 3300003856 Ga0058692_1003357 Ga0058692_10033573 137
501 3300003856 Ga0058692_1006983 Ga0058692_10069834 137
502 3300004799 Ga0058863_11838688 Ga0058863_118386881 137
503 3300005331 Ga0070670_100818626 Ga0070670_1008186261 137
504 3300005335 Ga0070666_10078590 Ga0070666_100785903 137
505 3300005337 Ga0070682_101066449 Ga0070682_1010664491 137
506 3300005344 Ga0070661_101132704 Ga0070661_1011327041 137
507 3300005347 Ga0070668_100185435 Ga0070668_1001854351 137
508 3300005456 Ga0070678_100393614 Ga0070678_1003936142 137
509 3300005539 Ga0068853_100298879 Ga0068853_1002988792 137
510 3300005548 Ga0070665_100000039 Ga0070665_1000000398 137
511 3300005548 Ga0070665_100019619 Ga0070665_1000196192 137
512 3300005548 Ga0070665_100587746 Ga0070665_1005877462 137
513 3300006195 Ga0075366_10000464 Ga0075366_100004649 137
514 3300006946 Ga0079104_1000059 Ga0079104_100005973 137
515 3300009092 Ga0105250_10000020 Ga0105250_10000020138 137
516 3300013105 Ga0157369_10000184 Ga0157369_100001848 137
517 3300013307 Ga0157372_10000189 Ga0157372_1000018942 137
518 3300013307 Ga0157372_10179084 Ga0157372_101790842 137
519 3300021361 Ga0213872_10000272 Ga0213872_1000027236 137
520 3300021361 Ga0213872_10000648 Ga0213872_1000064813 137
521 3300021361 Ga0213872_10036234 Ga0213872_100362343 137
522 3300021361 Ga0213872_10139719 Ga0213872_101397191 137
523 3300025207 Ga0209760_100602 Ga0209760_1006025 137
524 3300025224 Ga0209784_100043 Ga0209784_10004340 137
525 3300025228 Ga0209672_103498 Ga0209672_1034983 137
526 3300025231 Ga0207427_100087 Ga0207427_10008740 137
527 3300025233 Ga0209437_100173 Ga0209437_10017340 137
528 3300025242 Ga0209258_100092 Ga0209258_100092111 137
529 3300025245 Ga0207425_1045076 Ga0207425_10450761 137
530 3300025246 Ga0209646_1001268 Ga0209646_10012684 137
531 3300025250 Ga0209026_1000112 Ga0209026_100011240 137
532 3300025250 Ga0209026_1004529 Ga0209026_10045294 137
533 3300025254 Ga0209148_1000047 Ga0209148_1000047308 137
534 3300025256 Ga0209759_1000335 Ga0209759_100033526 137
535 3300025258 Ga0209129_1000021 Ga0209129_1000021220 137
536 3300025261 Ga0209233_1000179 Ga0209233_100017941 137
537 3300025272 Ga0209455_1000056 Ga0209455_1000056232 137
538 3300025711 Ga0207696_1000036 Ga0207696_1000036185 137
539 3300025925 Ga0207650_10355902 Ga0207650_103559022 137
540 3300025933 Ga0207706_10527718 Ga0207706_105277182 137
541 3300025972 Ga0207668_10067600 Ga0207668_100676001 137
542 3300026041 Ga0207639_10155501 Ga0207639_101555011 137
543 3300026067 Ga0207678_10010608 Ga0207678_100106082 137
544 3300026121 Ga0207683_10414943 Ga0207683_104149432 137
545 3300027111 Ga0209281_1000065 Ga0209281_100006572 137
546 3300027312 Ga0209371_1000027 Ga0209371_1000027223 137
547 3300027312 Ga0209371_1000029 Ga0209371_1000029199 137
548 3300027312 Ga0209371_1002330 Ga0209371_100233011 137
549 3300027312 Ga0209371_1002899 Ga0209371_10028991 137
550 3300027312 Ga0209371_1004460 Ga0209371_10044605 137
551 3300027312 Ga0209371_1008023 Ga0209371_10080232 137
552 3300028379 Ga0268266_10000122 Ga0268266_1000012214 137
553 3300028379 Ga0268266_10029190 Ga0268266_100291903 137
554 3300028379 Ga0268266_10453072 Ga0268266_104530722 137
555 3300028379 Ga0268266_11010259 Ga0268266_110102591 137
556 3300028794 Ga0307515_10003726 Ga0307515_100037267 137
557 3300030500 Ga0268256_1000032 Ga0268256_1000032196 137
558 3300030500 Ga0268256_1000045 Ga0268256_100004566 137
559 3300030500 Ga0268256_1002609 Ga0268256_10026099 137
560 3300030500 Ga0268256_1010980 Ga0268256_10109802 137
561 3300030500 Ga0268256_1012447 Ga0268256_10124472 137
562 3300030500 Ga0268256_1043777 Ga0268256_10437772 137
563 3300030522 Ga0307512_10190795 Ga0307512_101907952 137
564 3300031235 Ga0265330_10000043 Ga0265330_1000004396 137
565 3300031238 Ga0265332_10000018 Ga0265332_10000018207 137
566 3300031240 Ga0265320_10130058 Ga0265320_101300582 137
567 3300031241 Ga0265325_10005641 Ga0265325_100056415 137
568 3300031247 Ga0265340_10005465 Ga0265340_100054653 137
569 3300031251 Ga0265327_10000543 Ga0265327_1000054358 137
570 3300031344 Ga0265316_10278470 Ga0265316_102784702 137
571 3300031456 Ga0307513_10000034 Ga0307513_1000003443 137
572 3300031456 Ga0307513_10124813 Ga0307513_101248133 137
573 3300031456 Ga0307513_10540278 Ga0307513_105402782 137
574 3300031548 Ga0307408_100000084 Ga0307408_10000008431 137
575 3300031548 Ga0307408_100000147 Ga0307408_10000014750 137
576 3300031649 Ga0307514_10001452 Ga0307514_1000145227 137
577 3300031711 Ga0265314_10000126 Ga0265314_100001268 137
578 3300031711 Ga0265314_10028287 Ga0265314_100282872 137
579 3300031711 Ga0265314_10363289 Ga0265314_103632892 137
580 3300031730 Ga0307516_10000057 Ga0307516_1000005776 137
581 3300031730 Ga0307516_10000181 Ga0307516_1000018112 137
582 3300031901 Ga0307406_10000067 Ga0307406_1000006718 137
583 3300033180 Ga0307510_10190751 Ga0307510_101907512 137
584 3300035242 Ga0373962_0100559 Ga0373962_0100559_316_741 137
585 3300037471 Ga0395905_0014252 Ga0395905_0014252_6592_7017 137
586 3300037471 Ga0395905_0103259 Ga0395905_0103259_128_553 137
587 3300039447 Ga0436361_0110002 Ga0436361_0110002_299_793 137
588 3300039447 Ga0436361_0214541 Ga0436361_0214541_8620_9045 137
589 3300039447 Ga0436361_0882194 Ga0436361_0882194_11554_11985 137
590 3300039453 Ga0436362_0067749 Ga0436362_0067749_75_488 137
591 3300041459 Ga0451800_0849643 Ga0451800_0849643_104_541 137
592 3300041486 Ga0451807_0084414 Ga0451807_0084414_206_631 137
593 3300041505 Ga0451849_0438339 Ga0451849_0438339_18_443 137
594 3300042010 Ga0439452_000012 Ga0439452_000012_195699_196130 137
595 3300042439 Ga0439464_0022588 Ga0439464_0022588_271_702 137
596 3300046522 Ga0495643_0496885 Ga0495643_0496885_52_465 137
597 3300046529 Ga0495652_0282057 Ga0495652_0282057_184_612 137
598 3300048903 Ga0496100_0419233 Ga0496100_0419233_204_635 137
599 3300048919 Ga0496116_0038839 Ga0496116_0038839_1021_1452 137
600 3300048919 Ga0496116_0056847 Ga0496116_0056847_1214_1645 137
601 3300048920 Ga0496117_0103295 Ga0496117_0103295_57_488 137
602 3300048921 Ga0496118_0052042 Ga0496118_0052042_1291_1722 137
603 3300048922 Ga0496119_0000023 Ga0496119_0000023_215903_216334 137
604 3300048923 Ga0496120_0071550 Ga0496120_0071550_1333_1764 137
605 3300048925 Ga0496122_0029928 Ga0496122_0029928_1644_2075 137
606 3300048926 Ga0496123_0004918 Ga0496123_0004918_10150_10581 137
607 3300048927 Ga0496124_0000109 Ga0496124_0000109_20924_21355 137
608 3300048927 Ga0496124_0866991 Ga0496124_0866991_88_519 137
609 3300048928 Ga0496125_0077813 Ga0496125_0077813_1179_1610 137
610 3300049570 Ga0501033_0413398 Ga0501033_0413398_123_572 137
611 3300049571 Ga0501034_0800099 Ga0501034_0800099_169_609 137
612 3300049574 Ga0501038_0321906 Ga0501038_0321906_151_576 137
613 3300049574 Ga0501038_0495257 Ga0501038_0495257_366_806 137
614 3300049575 Ga0501039_0255753 Ga0501039_0255753_742_1176 137
615 3300049576 Ga0501040_0503183 Ga0501040_0503183_168_593 137
616 3300049578 Ga0501042_0555864 Ga0501042_0555864_294_719 137
617 3300049579 Ga0501043_0072190 Ga0501043_0072190_143_568 137
618 3300049579 Ga0501043_0085158 Ga0501043_0085158_1395_1835 137
619 3300049579 Ga0501043_0119041 Ga0501043_0119041_389_814 137
620 3300049580 Ga0501046_0019737 Ga0501046_0019737_2670_3110 137
621 3300049581 Ga0501047_0149608 Ga0501047_0149608_525_974 137
622 3300049581 Ga0501047_0409422 Ga0501047_0409422_592_1017 137
623 3300049583 Ga0501067_0173491 Ga0501067_0173491_663_1112 137
624 3300049586 Ga0501070_0154309 Ga0501070_0154309_1209_1649 137
625 3300049589 Ga0501073_0116996 Ga0501073_0116996_461_910 137
626 3300049589 Ga0501073_0266111 Ga0501073_0266111_131_556 137
627 3300049741 Ga0501079_0631051 Ga0501079_0631051_200_640 137
628 3300049742 Ga0501080_0054256 Ga0501080_0054256_1877_2317 137
629 3300049742 Ga0501080_0209894 Ga0501080_0209894_738_1163 137
630 3300049822 Ga0501035_0128279 Ga0501035_0128279_504_953 137
631 3300049823 Ga0501044_0029671 Ga0501044_0029671_3429_3869 137
632 3300049823 Ga0501044_0942702 Ga0501044_0942702_209_634 137
633 3300050493 nmdc:mga0k408_654_c1 nmdc:mga0k408_654_c1_9088_9525 137
634 3300053093 Ga0500651_0000883 Ga0500651_0000883_7280_7699 137
635 3300054114 Ga0501084_0021169 Ga0501084_0021169_937_1377 137
636 3300060353 Ga0501082_0000055 Ga0501082_0000055_30674_31114 137
637 2162886011 MRS1b_contig_8876843 MRS1b_0576.00002140 138
638 3300003316 rootH1_10069576 rootH1_100695763 138
639 3300003322 rootL2_10005527 rootL2_100055272 138
640 3300003752 Ga0055539_1002514 Ga0055539_10025142 138
641 3300003756 Ga0055533_1001064 Ga0055533_10010647 138
642 3300003760 Ga0055527_1000048 Ga0055527_100004877 138
643 3300003761 Ga0055535_1000332 Ga0055535_100033217 138
644 3300003762 Ga0055542_1000118 Ga0055542_100011830 138
645 3300003763 Ga0055529_1000132 Ga0055529_100013277 138
646 3300005290 Ga0065712_10077379 Ga0065712_100773794 138
647 3300005335 Ga0070666_10010973 Ga0070666_100109733 138
648 3300005340 Ga0070689_100159811 Ga0070689_1001598112 138
649 3300005340 Ga0070689_100520927 Ga0070689_1005209272 138
650 3300005355 Ga0070671_100824561 Ga0070671_1008245612 138
651 3300005367 Ga0070667_101511148 Ga0070667_1015111481 138
652 3300005445 Ga0070708_100985904 Ga0070708_1009859042 138
653 3300005471 Ga0070698_101998190 Ga0070698_1019981901 138
654 3300005535 Ga0070684_101076715 Ga0070684_1010767151 138
655 3300005548 Ga0070665_100144455 Ga0070665_1001444552 138
656 3300005614 Ga0068856_100021657 Ga0068856_1000216572 138
657 3300005719 Ga0068861_101840943 Ga0068861_1018409431 138
658 3300005983 Ga0081540_1149897 Ga0081540_11498972 138
659 3300006844 Ga0075428_101170016 Ga0075428_1011700161 138
660 3300006946 Ga0079104_1067889 Ga0079104_10678892 138
661 3300007788 Ga0099795_10317407 Ga0099795_103174072 138
662 3300009093 Ga0105240_10330618 Ga0105240_103306183 138
663 3300009148 Ga0105243_10504680 Ga0105243_105046802 138
664 3300009148 Ga0105243_10616934 Ga0105243_106169342 138
665 3300009148 Ga0105243_10756424 Ga0105243_107564242 138
666 3300009148 Ga0105243_11760697 Ga0105243_117606972 138
667 3300009177 Ga0105248_10130002 Ga0105248_101300023 138
668 3300009545 Ga0105237_10005375 Ga0105237_1000537512 138
669 3300009551 Ga0105238_10328717 Ga0105238_103287172 138
670 3300009553 Ga0105249_11381764 Ga0105249_113817641 138
671 3300009986 Ga0105033_102309 Ga0105033_1023092 138
672 3300014325 Ga0163163_11092296 Ga0163163_110922962 138
673 3300014968 Ga0157379_10322539 Ga0157379_103225391 138
674 3300015261 Ga0182006_1000098 Ga0182006_100009814 138
675 3300015262 Ga0182007_10052483 Ga0182007_100524832 138
676 3300015265 Ga0182005_1004265 Ga0182005_10042654 138
677 3300025226 Ga0209674_101087 Ga0209674_1010871 138
678 3300025228 Ga0209672_100017 Ga0209672_100017200 138
679 3300025242 Ga0209258_100038 Ga0209258_100038113 138
680 3300025253 Ga0209677_105835 Ga0209677_1058351 138
681 3300025254 Ga0209148_1000009 Ga0209148_10000091013 138
682 3300025256 Ga0209759_1001510 Ga0209759_10015102 138
683 3300025272 Ga0209455_1000032 Ga0209455_1000032200 138
684 3300025295 Ga0209564_1042997 Ga0209564_10429972 138
685 3300025903 Ga0207680_10182261 Ga0207680_101822612 138
686 3300025913 Ga0207695_10235320 Ga0207695_102353202 138
687 3300025914 Ga0207671_10021302 Ga0207671_100213024 138
688 3300025935 Ga0207709_10362769 Ga0207709_103627691 138
689 3300025935 Ga0207709_11357771 Ga0207709_113577712 138
690 3300025936 Ga0207670_10093082 Ga0207670_100930822 138
691 3300025936 Ga0207670_10249139 Ga0207670_102491392 138
692 3300025941 Ga0207711_10450966 Ga0207711_104509662 138
693 3300026078 Ga0207702_10000735 Ga0207702_1000073527 138
694 3300026118 Ga0207675_100919751 Ga0207675_1009197511 138
695 3300026142 Ga0207698_10663320 Ga0207698_106633202 138
696 3300028379 Ga0268266_10071928 Ga0268266_100719282 138
697 3300028381 Ga0268264_11970966 Ga0268264_119709662 138
698 3300031507 Ga0307509_10002843 Ga0307509_1000284322 138
699 3300031548 Ga0307408_101932684 Ga0307408_1019326841 138
700 3300031616 Ga0307508_10003227 Ga0307508_100032276 138
701 3300031730 Ga0307516_10724411 Ga0307516_107244111 138
702 3300031911 Ga0307412_10002443 Ga0307412_100024431 138
703 3300033180 Ga0307510_10019193 Ga0307510_100191937 138
704 3300033180 Ga0307510_10155435 Ga0307510_101554352 138
705 3300033180 Ga0307510_10168661 Ga0307510_101686611 138
706 3300036401 Ga0373937_1718746 Ga0373937_1718746_117_533 138
707 3300037312 Ga0395899_0000046 Ga0395899_0000046_78217_78633 138
708 3300037312 Ga0395899_0113770 Ga0395899_0113770_167_601 138
709 3300037418 Ga0395900_0000034 Ga0395900_0000034_24733_25149 138
710 3300037418 Ga0395900_0114757 Ga0395900_0114757_2110_2544 138
711 3300037466 Ga0395898_0000081 Ga0395898_0000081_78217_78633 138
712 3300037466 Ga0395898_0350506 Ga0395898_0350506_674_1108 138
713 3300038443 Ga0395901_0037160 Ga0395901_0037160_2889_3305 138
714 3300038443 Ga0395901_0075549 Ga0395901_0075549_210_626 138
715 3300038443 Ga0395901_0187345 Ga0395901_0187345_1419_1853 138
716 3300039437 Ga0436365_1817978 Ga0436365_1817978_309_725 138
717 3300039447 Ga0436361_1195197 Ga0436361_1195197_2533_2973 138
718 3300041404 Ga0439436_0000003 Ga0439436_0000003_87873_88289 138
719 3300042010 Ga0439452_000490 Ga0439452_000490_16148_16606 138
720 3300044656 Ga0466969_0204604 Ga0466969_0204604_189_605 138
721 3300044683 Ga0466965_0096541 Ga0466965_0096541_695_1162 138
722 3300044684 Ga0466966_0001878 Ga0466966_0001878_7308_7724 138
723 3300044693 Ga0466961_0111414 Ga0466961_0111414_348_764 138
724 3300044706 Ga0466964_0019206 Ga0466964_0019206_434_850 138
725 3300044765 Ga0466970_0007491 Ga0466970_0007491_826_1242 138
726 3300044842 Ga0466957_0020204 Ga0466957_0020204_401_817 138
727 3300045049 Ga0466959_0009824 Ga0466959_0009824_6007_6423 138
728 3300045049 Ga0466959_0017138 Ga0466959_0017138_4494_4910 138
729 3300045836 Ga0466958_0699304 Ga0466958_0699304_90_560 138
730 3300046454 Ga0495592_0832913 Ga0495592_0832913_73_489 138
731 3300046457 Ga0495590_0026478 Ga0495590_0026478_891_1355 138
732 3300046460 Ga0495638_0056363 Ga0495638_0056363_1356_1790 138
733 3300046472 Ga0495580_0206998 Ga0495580_0206998_820_1284 138
734 3300046507 Ga0495606_0001207 Ga0495606_0001207_21385_21801 138
735 3300046512 Ga0495610_0001740 Ga0495610_0001740_3445_3861 138
736 3300046519 Ga0495632_0308621 Ga0495632_0308621_255_671 138
737 3300046520 Ga0495637_0150738 Ga0495637_0150738_67_498 138
738 3300046524 Ga0495648_0140927 Ga0495648_0140927_75_491 138
739 3300046539 Ga0495621_0012142 Ga0495621_0012142_42_461 138
740 3300046616 Ga0495668_0000046 Ga0495668_0000046_63907_64335 138
741 3300046660 Ga0495625_0228220 Ga0495625_0228220_749_1165 138
742 3300046664 Ga0495659_0082940 Ga0495659_0082940_417_836 138
743 3300046691 Ga0495670_0002183 Ga0495670_0002183_188_604 138
744 3300047318 Ga0495636_0030995 Ga0495636_0030995_740_1159 138
745 3300047443 Ga0495687_000048 Ga0495687_000048_108623_109042 138
746 3300047472 Ga0495686_0001622 Ga0495686_0001622_11005_11457 138
747 3300047472 Ga0495686_0001733 Ga0495686_0001733_4944_5378 138
748 3300048920 Ga0496117_0070300 Ga0496117_0070300_95_559 138
749 3300048921 Ga0496118_0001211 Ga0496118_0001211_5661_6125 138
750 3300048922 Ga0496119_0017852 Ga0496119_0017852_94_510 138
751 3300048923 Ga0496120_0076981 Ga0496120_0076981_613_1047 138
752 3300048924 Ga0496121_0000801 Ga0496121_0000801_53150_53566 138
753 3300048924 Ga0496121_0124825 Ga0496121_0124825_836_1270 138
754 3300048925 Ga0496122_0406551 Ga0496122_0406551_135_554 138
755 3300048928 Ga0496125_0043310 Ga0496125_0043310_1561_1995 138
756 3300049459 Ga0495678_006376 Ga0495678_006376_2441_2857 138
757 3300049459 Ga0495678_043154 Ga0495678_043154_1178_1606 138
758 3300049569 Ga0501032_0431618 Ga0501032_0431618_325_747 138
759 3300049570 Ga0501033_0275648 Ga0501033_0275648_81_515 138
760 3300049571 Ga0501034_0011935 Ga0501034_0011935_864_1322 138
761 3300049572 Ga0501036_0221316 Ga0501036_0221316_536_958 138
762 3300049572 Ga0501036_0821457 Ga0501036_0821457_300_734 138
763 3300049573 Ga0501037_0067091 Ga0501037_0067091_76_510 138
764 3300049574 Ga0501038_0125228 Ga0501038_0125228_882_1304 138
765 3300049575 Ga0501039_0326534 Ga0501039_0326534_10_438 138
766 3300049578 Ga0501042_0175169 Ga0501042_0175169_482_904 138
767 3300049579 Ga0501043_0467570 Ga0501043_0467570_481_903 138
768 3300049579 Ga0501043_0737215 Ga0501043_0737215_88_516 138
769 3300049580 Ga0501046_0280369 Ga0501046_0280369_640_1062 138
770 3300049581 Ga0501047_0975905 Ga0501047_0975905_145_567 138
771 3300049583 Ga0501067_0427974 Ga0501067_0427974_298_720 138
772 3300049584 Ga0501068_0420331 Ga0501068_0420331_311_727 138
773 3300049585 Ga0501069_0160929 Ga0501069_0160929_838_1260 138
774 3300049586 Ga0501070_0383034 Ga0501070_0383034_51_467 138
775 3300049586 Ga0501070_0470377 Ga0501070_0470377_239_667 138
776 3300049589 Ga0501073_0078930 Ga0501073_0078930_860_1282 138
777 3300049744 Ga0501083_0072370 Ga0501083_0072370_910_1326 138
778 3300049822 Ga0501035_0157921 Ga0501035_0157921_121_543 138
779 3300049823 Ga0501044_0028616 Ga0501044_0028616_4216_4650 138
780 3300049823 Ga0501044_0100286 Ga0501044_0100286_1683_2111 138
781 3300049823 Ga0501044_0123912 Ga0501044_0123912_950_1366 138
782 3300049823 Ga0501044_0661955 Ga0501044_0661955_472_888 138
783 3300049823 Ga0501044_0976405 Ga0501044_0976405_213_635 138
784 3300049823 Ga0501044_1320969 Ga0501044_1320969_89_511 138
785 3300050508 nmdc:mga09592_1478830_c1 nmdc:mga09592_1478830_c1_12_428 138
786 3300050510 nmdc:mga06r32_992748_c1 nmdc:mga06r32_992748_c1_135_551 138
787 3300054114 Ga0501084_0010778 Ga0501084_0010778_873_1289 138
788 3300059421 Ga0590071_001406 Ga0590071_001406_2166_2660 138
789 3300059423 Ga0590074_035328 Ga0590074_035328_146_640 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

63

161

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mh4-assembly1.cif.gz_B crystal structure of osmc-like protein from burkholderia cenocepacia j2315 0.9661 3 138
1zb9-assembly1.cif.gz_B crystal structure of xylella fastidiosa organic peroxide resistance protein 0.9614 3 138
6ed0-assembly1.cif.gz_B "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9611 1 138
6ed0-assembly1.cif.gz_A "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9601 1 138
1n2f-assembly1.cif.gz_B crystal structure of p. aeruginosa ohr 0.959 1 138
ID Description Score Start End Superfamily
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9574 45 138 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9523 45 138 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9476 45 138 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9237 45 138 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9169 45 138 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2W7TTF2-F1-model_v4 Peroxiredoxin 0.9902 2 138 GO:0006979
AF-A0A426SWX4-F1-model_v4 deleted 0.9892 47 138
AF-A0A1L6LFA6-F1-model_v4 deleted 0.9877 1 138
AF-A0A7X6EK14-F1-model_v4 deleted 0.9877 54 138
AF-A0A5E7QDR3-F1-model_v4 deleted 0.9873 1 138

Feature Viewer

pLDDT pTM Quality
95.9 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map