F480891

General Info

Members Datasets Scaffolds Average Seq Length
789 272 1578 98

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10069610|Ga0070676_100696102
Length 109
Sequence VILKNPMGGGARSFGIMRRVFWPALALIIVGNFAGYAVAGPNGLLAWGGYHRDLQERKIELAQLEAEKAQLRHRSTLLDPRKADPDMADELVRRDLGLVRPDEVIVPLD

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
165 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
166 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
167 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
168 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
169 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
170 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
192 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
195 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
196 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
197 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
198 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
199 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
202 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
243 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
244 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
245 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
246 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
247 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
248 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
249 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
250 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
251 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
252 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
253 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
254 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
255 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
256 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
257 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
260 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
263 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
264 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
265 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
266 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
267 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
272 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 2.41
Rhizosphere 97.21
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10069610 3300005328 Bacteria 2109
2 MBSR1b_contig_11141605 2162886012 Bacteria 1326
3 CNBas_1004128 3300000531 Bacteria 818
4 JGI24740J21852_10096916 3300001979 Bacteria 754
5 JGI24748J21848_1026112 3300002074 Bacteria 713
6 JGI24738J21930_10103389 3300002075 Bacteria 609
7 JGI24034J26672_10042031 3300002239 Bacteria 769
8 JGI24751J29686_10043287 3300002459 Bacteria 931
9 JGI25406J46586_10200970 3300003203 Bacteria 582
10 Ga0065714_10497189 3300005288 Bacteria 525
11 Ga0065712_10091497 3300005290 Bacteria 2371
12 Ga0065712_10605641 3300005290 Bacteria 588
13 Ga0065715_10030695 3300005293 Bacteria 1448
14 Ga0065715_10175404 3300005293 Bacteria 1515
15 Ga0065715_10175552 3300005293 Bacteria 1514
16 Ga0070658_11166967 3300005327 Bacteria 670
17 Ga0070658_11185579 3300005327 Bacteria 664
18 Ga0070676_10252780 3300005328 Bacteria 1177
19 Ga0070676_10634869 3300005328 Bacteria 774
20 Ga0070683_100908143 3300005329 Bacteria 845
21 Ga0070690_101196592 3300005330 Bacteria 606
22 Ga0070670_100009915 3300005331 Bacteria 8134
23 Ga0070670_100012394 3300005331 Bacteria 7295
24 Ga0070670_100037775 3300005331 Bacteria 4153
25 Ga0070670_100054972 3300005331 Bacteria 3417
26 Ga0070670_100892105 3300005331 Bacteria 806
27 Ga0070670_101544593 3300005331 Bacteria 610
28 Ga0070670_101632234 3300005331 Bacteria 593
29 Ga0070677_10000309 3300005333 Bacteria 16988
30 Ga0070677_10244266 3300005333 Bacteria 888
31 Ga0070677_10363476 3300005333 Bacteria 753
32 Ga0068869_100197044 3300005334 Bacteria 1587
33 Ga0068869_100650477 3300005334 Bacteria 895
34 Ga0070666_10394895 3300005335 Bacteria 994
35 Ga0070666_11092510 3300005335 Bacteria 593
36 Ga0070680_100138959 3300005336 Bacteria 2036
37 Ga0070680_100154378 3300005336 Bacteria 1928
38 Ga0070680_100192794 3300005336 Bacteria 1717
39 Ga0070680_100194691 3300005336 Bacteria 1709
40 Ga0070680_101138528 3300005336 Bacteria 674
41 Ga0070682_102087826 3300005337 Bacteria 500
42 Ga0068868_100292048 3300005338 Bacteria 1382
43 Ga0068868_101949630 3300005338 Bacteria 557
44 Ga0070660_100719598 3300005339 Bacteria 837
45 Ga0070660_100732836 3300005339 Bacteria 830
46 Ga0070660_101011013 3300005339 Bacteria 703
47 Ga0070660_101740588 3300005339 Bacteria 531
48 Ga0070689_100854567 3300005340 Bacteria 803
49 Ga0070687_100898545 3300005343 Bacteria 635
50 Ga0070661_100048713 3300005344 Bacteria 3102
51 Ga0070661_100062181 3300005344 Bacteria 2741
52 Ga0070661_100075986 3300005344 Bacteria 2476
53 Ga0070661_100338629 3300005344 Bacteria 1178
54 Ga0070661_100372198 3300005344 Bacteria 1125
55 Ga0070661_100592835 3300005344 Bacteria 895
56 Ga0070661_101073422 3300005344 Bacteria 670
57 Ga0070661_101553026 3300005344 Bacteria 559
58 Ga0070668_100024392 3300005347 Bacteria 4582
59 Ga0070668_100882493 3300005347 Bacteria 799
60 Ga0070668_100967588 3300005347 Bacteria 764
61 Ga0070668_101036010 3300005347 Bacteria 739
62 Ga0070669_100036245 3300005353 Bacteria 3574
63 Ga0070669_100060402 3300005353 Bacteria 2785
64 Ga0070669_100084009 3300005353 Bacteria 2375
65 Ga0070669_100302874 3300005353 Bacteria 1286
66 Ga0070669_100452955 3300005353 Bacteria 1058
67 Ga0070669_100664215 3300005353 Bacteria 878
68 Ga0070669_100823507 3300005353 Bacteria 790
69 Ga0070669_101909655 3300005353 Unclassified 518
70 Ga0070675_100023519 3300005354 Bacteria 4928
71 Ga0070675_100111015 3300005354 Bacteria 2320
72 Ga0070675_100193795 3300005354 Bacteria 1762
73 Ga0070675_100292862 3300005354 Bacteria 1433
74 Ga0070675_100425772 3300005354 Bacteria 1187
75 Ga0070675_100657136 3300005354 Bacteria 953
76 Ga0070671_100022312 3300005355 Bacteria 5170
77 Ga0070671_100036057 3300005355 Bacteria 4100
78 Ga0070671_100132409 3300005355 Bacteria 2100
79 Ga0070671_100230274 3300005355 Bacteria 1572
80 Ga0070671_100536014 3300005355 Bacteria 1009
81 Ga0070674_100032447 3300005356 Bacteria 3468
82 Ga0070674_100454528 3300005356 Bacteria 1058
83 Ga0070674_100856443 3300005356 Bacteria 789
84 Ga0070674_101095721 3300005356 Bacteria 703
85 Ga0070674_101166426 3300005356 Bacteria 683
86 Ga0070673_100051549 3300005364 Bacteria 3224
87 Ga0070673_100056864 3300005364 Bacteria 3088
88 Ga0070673_100101098 3300005364 Bacteria 2375
89 Ga0070673_100313071 3300005364 Bacteria 1385
90 Ga0070673_100326802 3300005364 Bacteria 1356
91 Ga0070673_101224339 3300005364 Bacteria 704
92 Ga0070673_101323898 3300005364 Bacteria 677
93 Ga0070659_100021963 3300005366 Bacteria 4868
94 Ga0070659_100121683 3300005366 Bacteria 2115
95 Ga0070659_100271565 3300005366 Bacteria 1409
96 Ga0070659_100508145 3300005366 Bacteria 1028
97 Ga0070659_100814064 3300005366 Bacteria 813
98 Ga0070659_101359963 3300005366 Bacteria 631
99 Ga0070667_100001943 3300005367 Bacteria 18339
100 Ga0070667_100004347 3300005367 Bacteria 11953
101 Ga0070667_100016231 3300005367 Bacteria 6161
102 Ga0070667_100019495 3300005367 Bacteria 5628
103 Ga0070667_100201265 3300005367 Bacteria 1767
104 Ga0070667_100291913 3300005367 Bacteria 1466
105 Ga0070667_101251814 3300005367 Bacteria 695
106 Ga0070667_102002059 3300005367 Bacteria 545
107 Ga0070701_10965509 3300005438 Bacteria 592
108 Ga0070663_100118984 3300005455 Bacteria 1993
109 Ga0070663_100337935 3300005455 Bacteria 1216
110 Ga0070663_101477235 3300005455 Bacteria 604
111 Ga0070678_100169022 3300005456 Bacteria 1779
112 Ga0070678_100701492 3300005456 Bacteria 912
113 Ga0070678_102410216 3300005456 Bacteria 500
114 Ga0070662_100000675 3300005457 Bacteria 20798
115 Ga0070662_100113683 3300005457 Bacteria 2066
116 Ga0070662_100230930 3300005457 Bacteria 1480
117 Ga0070662_100378619 3300005457 Bacteria 1165
118 Ga0070662_100503910 3300005457 Bacteria 1010
119 Ga0070662_100765014 3300005457 Bacteria 820
120 Ga0070662_100914782 3300005457 Bacteria 749
121 Ga0070662_101714568 3300005457 Unclassified 542
122 Ga0070681_10120650 3300005458 Bacteria 2557
123 Ga0070681_10133173 3300005458 Bacteria 2417
124 Ga0070681_10309211 3300005458 Bacteria 1490
125 Ga0070681_10312538 3300005458 Bacteria 1481
126 Ga0068867_100168991 3300005459 Bacteria 1730
127 Ga0068867_100967642 3300005459 Bacteria 770
128 Ga0070685_10620845 3300005466 Bacteria 780
129 Ga0070679_100633937 3300005530 Bacteria 1012
130 Ga0070679_101058899 3300005530 Bacteria 755
131 Ga0070679_102161638 3300005530 Bacteria 506
132 Ga0068853_100022979 3300005539 Bacteria 5215
133 Ga0068853_100223913 3300005539 Bacteria 1719
134 Ga0068853_100344108 3300005539 Bacteria 1386
135 Ga0068853_100645872 3300005539 Bacteria 1007
136 Ga0068853_101922497 3300005539 Bacteria 574
137 Ga0070672_100076357 3300005543 Bacteria 2676
138 Ga0070672_100212352 3300005543 Bacteria 1621
139 Ga0070672_100238746 3300005543 Bacteria 1528
140 Ga0070672_100329095 3300005543 Bacteria 1300
141 Ga0070672_100609835 3300005543 Bacteria 951
142 Ga0070672_101329890 3300005543 Bacteria 642
143 Ga0070672_101985170 3300005543 Bacteria 524
144 Ga0070695_101000888 3300005545 Bacteria 680
145 Ga0070696_100013477 3300005546 Bacteria 5485
146 Ga0070696_100086828 3300005546 Bacteria 2222
147 Ga0070693_100075548 3300005547 Bacteria 1995
148 Ga0070665_100002020 3300005548 Bacteria 22820
149 Ga0070665_100103612 3300005548 Bacteria 2848
150 Ga0070665_100245630 3300005548 Bacteria 1790
151 Ga0070665_101181690 3300005548 Bacteria 776
152 Ga0068855_100018812 3300005563 Bacteria 8302
153 Ga0068855_100375947 3300005563 Bacteria 1561
154 Ga0068855_101269158 3300005563 Unclassified 763
155 Ga0068855_101833235 3300005563 Bacteria 616
156 Ga0070664_100010102 3300005564 Bacteria 7652
157 Ga0070664_100011516 3300005564 Bacteria 7179
158 Ga0070664_100113426 3300005564 Bacteria 2367
159 Ga0070664_100120748 3300005564 Bacteria 2294
160 Ga0070664_100129405 3300005564 Bacteria 2217
161 Ga0070664_100219218 3300005564 Bacteria 1702
162 Ga0070664_100247455 3300005564 Bacteria 1602
163 Ga0070664_100330190 3300005564 Bacteria 1383
164 Ga0070664_101114058 3300005564 Bacteria 744
165 Ga0068857_100070697 3300005577 Bacteria 3109
166 Ga0068857_100104034 3300005577 Bacteria 2549
167 Ga0068854_100005153 3300005578 Bacteria 8239
168 Ga0068854_100215525 3300005578 Bacteria 1516
169 Ga0068854_100295088 3300005578 Bacteria 1309
170 Ga0068854_101001419 3300005578 Bacteria 740
171 Ga0068856_100013596 3300005614 Bacteria 7878
172 Ga0068856_100017486 3300005614 Bacteria 6948
173 Ga0068856_100042249 3300005614 Bacteria 4484
174 Ga0068856_100200797 3300005614 Bacteria 2008
175 Ga0068852_100714783 3300005616 Bacteria 1012
176 Ga0068852_102697885 3300005616 Bacteria 516
177 Ga0068859_100000229 3300005617 Bacteria 55082
178 Ga0068859_100028594 3300005617 Bacteria 5589
179 Ga0068859_100250320 3300005617 Bacteria 1862
180 Ga0068859_100706789 3300005617 Bacteria 1098
181 Ga0068864_100000345 3300005618 Bacteria 40863
182 Ga0068864_100103076 3300005618 Bacteria 2533
183 Ga0068864_100303769 3300005618 Bacteria 1495
184 Ga0068864_100556294 3300005618 Bacteria 1109
185 Ga0068866_10272615 3300005718 Bacteria 1045
186 Ga0068866_10532033 3300005718 Unclassified 783
187 Ga0068866_11160268 3300005718 Bacteria 556
188 Ga0068861_100024866 3300005719 Bacteria 4336
189 Ga0068861_100050565 3300005719 Bacteria 3152
190 Ga0068861_100348696 3300005719 Bacteria 1298
191 Ga0068861_101009377 3300005719 Bacteria 795
192 Ga0068851_10191662 3300005834 Bacteria 1137
193 Ga0068851_10325032 3300005834 Bacteria 889
194 Ga0068870_10725031 3300005840 Bacteria 688
195 Ga0068870_11035807 3300005840 Bacteria 587
196 Ga0068863_100001129 3300005841 Bacteria 26682
197 Ga0068863_100001956 3300005841 Bacteria 20462
198 Ga0068863_100013614 3300005841 Bacteria 7845
199 Ga0068863_100049264 3300005841 Bacteria 3994
200 Ga0068863_100141201 3300005841 Bacteria 2302
201 Ga0068863_100231732 3300005841 Bacteria 1781
202 Ga0068863_100811830 3300005841 Bacteria 933
203 Ga0068858_100003029 3300005842 Bacteria 16840
204 Ga0068858_100027743 3300005842 Bacteria 5261
205 Ga0068858_100049453 3300005842 Bacteria 3894
206 Ga0068858_100329038 3300005842 Bacteria 1461
207 Ga0068860_100002029 3300005843 Bacteria 21354
208 Ga0068860_100018215 3300005843 Bacteria 6835
209 Ga0068860_100188049 3300005843 Bacteria 1998
210 Ga0068860_101111830 3300005843 Bacteria 810
211 Ga0068860_101210780 3300005843 Unclassified 775
212 Ga0068862_100004258 3300005844 Bacteria 12114
213 Ga0068862_100047286 3300005844 Bacteria 3671
214 Ga0068862_100118823 3300005844 Bacteria 2328
215 Ga0068862_100198641 3300005844 Bacteria 1807
216 Ga0068862_100220155 3300005844 Unclassified 1718
217 Ga0068862_100448789 3300005844 Unclassified 1215
218 Ga0068862_100469647 3300005844 Bacteria 1189
219 Ga0068862_101328072 3300005844 Bacteria 721
220 Ga0081539_10011281 3300005985 Bacteria 7096
221 Ga0081539_10107118 3300005985 Bacteria 1414
222 Ga0075364_10626192 3300006051 Bacteria 735
223 Ga0097621_100660832 3300006237 Bacteria 960
224 Ga0097621_101728900 3300006237 Bacteria 596
225 Ga0097621_102185894 3300006237 Bacteria 529
226 Ga0068871_100049132 3300006358 Bacteria 3408
227 Ga0075431_100461409 3300006847 Bacteria 1265
228 Ga0075433_10592402 3300006852 Unclassified 973
229 Ga0068865_100004168 3300006881 Bacteria 8700
230 Ga0068865_100302747 3300006881 Bacteria 1280
231 Ga0068865_100717061 3300006881 Bacteria 856
232 Ga0068865_101826086 3300006881 Bacteria 550
233 Ga0097620_100000229 3300006931 Bacteria 55082
234 Ga0097620_100028597 3300006931 Bacteria 5589
235 Ga0097620_100250311 3300006931 Bacteria 1862
236 Ga0097620_100706807 3300006931 Bacteria 1098
237 Ga0075435_100830349 3300007076 Bacteria 805
238 Ga0105251_10211965 3300009011 Bacteria 872
239 Ga0105250_10028148 3300009092 Bacteria 2263
240 Ga0105240_10015925 3300009093 Bacteria 10199
241 Ga0111539_11866450 3300009094 Bacteria 697
242 Ga0105245_10046926 3300009098 Bacteria 3861
243 Ga0105247_10235109 3300009101 Bacteria 1246
244 Ga0105247_10432202 3300009101 Bacteria 945
245 Ga0114129_13425065 3300009147 Bacteria 509
246 Ga0105243_10601102 3300009148 Bacteria 1059
247 Ga0105243_11223022 3300009148 Bacteria 765
248 Ga0105241_10367653 3300009174 Bacteria 1253
249 Ga0105241_10563859 3300009174 Bacteria 1024
250 Ga0105241_10642998 3300009174 Bacteria 963
251 Ga0105241_11465625 3300009174 Bacteria 656
252 Ga0105242_11856968 3300009176 Bacteria 642
253 Ga0105248_10000075 3300009177 Bacteria 114243
254 Ga0105248_10012999 3300009177 Bacteria 9176
255 Ga0105248_10041028 3300009177 Bacteria 5189
256 Ga0105248_10191715 3300009177 Bacteria 2303
257 Ga0105248_10455229 3300009177 Bacteria 1442
258 Ga0105248_10794715 3300009177 Bacteria 1068
259 Ga0105248_11066272 3300009177 Bacteria 913
260 Ga0105237_10054672 3300009545 Bacteria 4000
261 Ga0105237_12285267 3300009545 Bacteria 551
262 Ga0105238_10119010 3300009551 Bacteria 2621
263 Ga0105249_10030646 3300009553 Bacteria 4864
264 Ga0105249_10126984 3300009553 Bacteria 2430
265 Ga0105249_10209994 3300009553 Bacteria 1910
266 Ga0105249_11379722 3300009553 Bacteria 777
267 Ga0105249_11545375 3300009553 Bacteria 736
268 Ga0105030_110533 3300009987 Bacteria 794
269 Ga0105239_11276820 3300010375 Bacteria 847
270 Ga0105246_10124117 3300011119 Bacteria 1918
271 Ga0105246_10287999 3300011119 Unclassified 1321
272 Ga0105246_10468529 3300011119 Bacteria 1063
273 Ga0105246_10783469 3300011119 Bacteria 844
274 Ga0105246_10946000 3300011119 Bacteria 776
275 Ga0157327_1026841 3300012512 Bacteria 691
276 Ga0157373_10007592 3300013100 Bacteria 8059
277 Ga0157373_10068192 3300013100 Bacteria 2514
278 Ga0157373_10187094 3300013100 Bacteria 1459
279 Ga0157373_10190256 3300013100 Bacteria 1446
280 Ga0157373_10315190 3300013100 Bacteria 1112
281 Ga0157373_10825164 3300013100 Bacteria 685
282 Ga0157373_11516235 3300013100 Unclassified 512
283 Ga0157371_10060980 3300013102 Bacteria 2674
284 Ga0157371_10066630 3300013102 Bacteria 2550
285 Ga0157371_11186932 3300013102 Unclassified 588
286 Ga0157371_11510911 3300013102 Bacteria 524
287 Ga0157370_10003024 3300013104 Bacteria 19956
288 Ga0157370_10281158 3300013104 Bacteria 1538
289 Ga0157370_10350296 3300013104 Bacteria 1361
290 Ga0157369_10053130 3300013105 Bacteria 4380
291 Ga0157369_10523688 3300013105 Bacteria 1226
292 Ga0157378_10844980 3300013297 Bacteria 943
293 Ga0157378_12791384 3300013297 Bacteria 541
294 Ga0163162_10268038 3300013306 Bacteria 1839
295 Ga0163162_10718904 3300013306 Bacteria 1119
296 Ga0163162_11326638 3300013306 Bacteria 818
297 Ga0157372_10835618 3300013307 Bacteria 1069
298 Ga0157372_12597483 3300013307 Bacteria 581
299 Ga0157375_10022620 3300013308 Bacteria 5788
300 Ga0157375_10049560 3300013308 Bacteria 4116
301 Ga0157375_10470972 3300013308 Bacteria 1421
302 Ga0157375_10548068 3300013308 Bacteria 1318
303 Ga0157375_10678174 3300013308 Bacteria 1185
304 Ga0163163_10001163 3300014325 Bacteria 22365
305 Ga0163163_10290500 3300014325 Bacteria 1687
306 Ga0163163_11003715 3300014325 Bacteria 898
307 Ga0157380_10166338 3300014326 Bacteria 1922
308 Ga0157380_10426931 3300014326 Bacteria 1266
309 Ga0157380_11057663 3300014326 Bacteria 848
310 Ga0157380_11307694 3300014326 Bacteria 772
311 Ga0182008_10038631 3300014497 Bacteria 2387
312 Ga0157377_10148509 3300014745 Bacteria 1447
313 Ga0157377_10665308 3300014745 Bacteria 751
314 Ga0157379_10004712 3300014968 Bacteria 11712
315 Ga0157379_10014771 3300014968 Bacteria 6849
316 Ga0157379_11709514 3300014968 Bacteria 617
317 Ga0157376_10331188 3300014969 Bacteria 1451
318 Ga0163161_10104259 3300017792 Bacteria 2114
319 Ga0163161_10226144 3300017792 Bacteria 1451
320 Ga0207697_10220275 3300025315 Bacteria 837
321 Ga0207656_10161723 3300025321 Bacteria 1066
322 Ga0207682_10002814 3300025893 Bacteria 7692
323 Ga0207682_10003319 3300025893 Bacteria 7022
324 Ga0207682_10058839 3300025893 Bacteria 1605
325 Ga0207682_10167019 3300025893 Bacteria 1000
326 Ga0207688_10099209 3300025901 Bacteria 1680
327 Ga0207688_10125390 3300025901 Bacteria 1501
328 Ga0207688_10161587 3300025901 Bacteria 1328
329 Ga0207688_10685552 3300025901 Bacteria 648
330 Ga0207645_10152847 3300025907 Bacteria 1507
331 Ga0207645_10232182 3300025907 Bacteria 1218
332 Ga0207645_10286455 3300025907 Bacteria 1095
333 Ga0207645_10664336 3300025907 Unclassified 708
334 Ga0207645_10683191 3300025907 Bacteria 698
335 Ga0207643_10408514 3300025908 Bacteria 859
336 Ga0207643_10542811 3300025908 Bacteria 745
337 Ga0207705_10290651 3300025909 Bacteria 1252
338 Ga0207705_10953270 3300025909 Bacteria 664
339 Ga0207654_10094676 3300025911 Bacteria 1828
340 Ga0207654_10569450 3300025911 Bacteria 806
341 Ga0207707_10143238 3300025912 Bacteria 2089
342 Ga0207707_10221954 3300025912 Bacteria 1645
343 Ga0207707_10225232 3300025912 Bacteria 1632
344 Ga0207707_10474292 3300025912 Bacteria 1069
345 Ga0207707_10656750 3300025912 Bacteria 883
346 Ga0207707_10721659 3300025912 Bacteria 835
347 Ga0207695_10008967 3300025913 Bacteria 12449
348 Ga0207671_10064401 3300025914 Bacteria 2725
349 Ga0207660_10037803 3300025917 Bacteria 3366
350 Ga0207660_10171751 3300025917 Bacteria 1678
351 Ga0207660_10715992 3300025917 Bacteria 817
352 Ga0207662_10348249 3300025918 Bacteria 994
353 Ga0207662_10489407 3300025918 Bacteria 846
354 Ga0207662_11327479 3300025918 Bacteria 511
355 Ga0207657_10068285 3300025919 Bacteria 3020
356 Ga0207657_10140933 3300025919 Bacteria 1970
357 Ga0207649_10239827 3300025920 Bacteria 1301
358 Ga0207649_10286626 3300025920 Bacteria 1199
359 Ga0207649_10600120 3300025920 Bacteria 847
360 Ga0207649_10881067 3300025920 Unclassified 701
361 Ga0207649_11098270 3300025920 Bacteria 627
362 Ga0207649_11539718 3300025920 Bacteria 526
363 Ga0207652_10128961 3300025921 Bacteria 2255
364 Ga0207652_10286529 3300025921 Bacteria 1486
365 Ga0207681_10027411 3300025923 Bacteria 3683
366 Ga0207681_10039418 3300025923 Bacteria 3136
367 Ga0207681_10073642 3300025923 Bacteria 2390
368 Ga0207681_10138423 3300025923 Bacteria 1810
369 Ga0207681_10400810 3300025923 Bacteria 1108
370 Ga0207681_10767224 3300025923 Bacteria 804
371 Ga0207694_10166559 3300025924 Bacteria 1782
372 Ga0207650_10019107 3300025925 Bacteria 4815
373 Ga0207650_10087087 3300025925 Bacteria 2379
374 Ga0207650_10160903 3300025925 Bacteria 1779
375 Ga0207650_10186242 3300025925 Bacteria 1656
376 Ga0207650_10390659 3300025925 Bacteria 1150
377 Ga0207650_10390897 3300025925 Bacteria 1150
378 Ga0207650_10458078 3300025925 Bacteria 1062
379 Ga0207650_10970264 3300025925 Bacteria 723
380 Ga0207650_11365455 3300025925 Bacteria 603
381 Ga0207659_10009454 3300025926 Bacteria 6093
382 Ga0207659_10030673 3300025926 Bacteria 3675
383 Ga0207659_10107915 3300025926 Bacteria 2111
384 Ga0207687_10034470 3300025927 Bacteria 3437
385 Ga0207644_10057381 3300025931 Bacteria 2811
386 Ga0207644_10070433 3300025931 Bacteria 2556
387 Ga0207644_10144425 3300025931 Bacteria 1835
388 Ga0207644_10515412 3300025931 Bacteria 987
389 Ga0207644_10678878 3300025931 Bacteria 858
390 Ga0207690_10039565 3300025932 Bacteria 3077
391 Ga0207690_10379157 3300025932 Bacteria 1123
392 Ga0207690_10592251 3300025932 Bacteria 904
393 Ga0207690_10737923 3300025932 Bacteria 811
394 Ga0207690_11783161 3300025932 Unclassified 514
395 Ga0207706_10000824 3300025933 Bacteria 32138
396 Ga0207706_10025180 3300025933 Bacteria 5335
397 Ga0207706_10067351 3300025933 Bacteria 3150
398 Ga0207706_10092584 3300025933 Bacteria 2658
399 Ga0207706_10244771 3300025933 Bacteria 1567
400 Ga0207706_10326577 3300025933 Bacteria 1335
401 Ga0207706_10329533 3300025933 Bacteria 1328
402 Ga0207706_10585527 3300025933 Bacteria 959
403 Ga0207706_11085910 3300025933 Bacteria 669
404 Ga0207709_10144370 3300025935 Bacteria 1640
405 Ga0207709_10455907 3300025935 Bacteria 989
406 Ga0207670_10416889 3300025936 Bacteria 1076
407 Ga0207669_10660334 3300025937 Bacteria 856
408 Ga0207704_10035751 3300025938 Bacteria 2850
409 Ga0207704_10594267 3300025938 Bacteria 905
410 Ga0207691_10008745 3300025940 Bacteria 9712
411 Ga0207691_10009591 3300025940 Bacteria 9289
412 Ga0207691_10098675 3300025940 Bacteria 2609
413 Ga0207691_10220670 3300025940 Bacteria 1644
414 Ga0207691_10221400 3300025940 Bacteria 1641
415 Ga0207691_10713016 3300025940 Unclassified 846
416 Ga0207711_10000077 3300025941 Bacteria 106500
417 Ga0207711_10033262 3300025941 Bacteria 4361
418 Ga0207711_10192670 3300025941 Bacteria 1858
419 Ga0207711_10731798 3300025941 Bacteria 922
420 Ga0207689_10060648 3300025942 Bacteria 3110
421 Ga0207689_10123081 3300025942 Bacteria 2133
422 Ga0207689_10371523 3300025942 Bacteria 1190
423 Ga0207689_10521093 3300025942 Bacteria 997
424 Ga0207679_10003483 3300025945 Bacteria 9730
425 Ga0207679_10044563 3300025945 Bacteria 3201
426 Ga0207679_10054942 3300025945 Bacteria 2934
427 Ga0207679_10108807 3300025945 Bacteria 2183
428 Ga0207679_10114866 3300025945 Bacteria 2132
429 Ga0207679_10361381 3300025945 Unclassified 1268
430 Ga0207679_10419748 3300025945 Bacteria 1180
431 Ga0207679_10616072 3300025945 Bacteria 979
432 Ga0207679_10683759 3300025945 Bacteria 930
433 Ga0207679_11245235 3300025945 Bacteria 683
434 Ga0207667_10013061 3300025949 Bacteria 9533
435 Ga0207667_10406823 3300025949 Bacteria 1385
436 Ga0207667_11482555 3300025949 Bacteria 650
437 Ga0207651_10175083 3300025960 Bacteria 1696
438 Ga0207651_10484291 3300025960 Bacteria 1067
439 Ga0207651_10512922 3300025960 Bacteria 1038
440 Ga0207651_10588823 3300025960 Bacteria 971
441 Ga0207651_10675025 3300025960 Bacteria 909
442 Ga0207712_10047704 3300025961 Bacteria 2975
443 Ga0207712_10132349 3300025961 Bacteria 1902
444 Ga0207712_10462872 3300025961 Bacteria 1078
445 Ga0207668_10019324 3300025972 Bacteria 4305
446 Ga0207668_10186487 3300025972 Bacteria 1640
447 Ga0207668_10270779 3300025972 Bacteria 1388
448 Ga0207668_10532522 3300025972 Bacteria 1015
449 Ga0207668_10737336 3300025972 Unclassified 868
450 Ga0207668_10798407 3300025972 Bacteria 835
451 Ga0207640_10109326 3300025981 Bacteria 1956
452 Ga0207640_10172338 3300025981 Bacteria 1614
453 Ga0207640_10223218 3300025981 Bacteria 1444
454 Ga0207640_10432601 3300025981 Bacteria 1080
455 Ga0207640_10472073 3300025981 Bacteria 1039
456 Ga0207640_11247194 3300025981 Bacteria 662
457 Ga0207658_10003421 3300025986 Bacteria 11236
458 Ga0207658_10037416 3300025986 Bacteria 3487
459 Ga0207658_10090601 3300025986 Bacteria 2370
460 Ga0207658_10122794 3300025986 Bacteria 2073
461 Ga0207658_10202686 3300025986 Bacteria 1657
462 Ga0207658_10337752 3300025986 Bacteria 1308
463 Ga0207658_10620683 3300025986 Bacteria 972
464 Ga0207658_11040699 3300025986 Bacteria 747
465 Ga0207658_11591229 3300025986 Bacteria 597
466 Ga0207677_10235470 3300026023 Bacteria 1478
467 Ga0207677_10309941 3300026023 Bacteria 1307
468 Ga0207677_11272555 3300026023 Bacteria 675
469 Ga0207703_10001376 3300026035 Bacteria 22216
470 Ga0207703_10044571 3300026035 Bacteria 3566
471 Ga0207703_10132903 3300026035 Bacteria 2151
472 Ga0207703_10136019 3300026035 Bacteria 2128
473 Ga0207703_10771139 3300026035 Bacteria 917
474 Ga0207639_10006874 3300026041 Bacteria 7749
475 Ga0207639_11104849 3300026041 Bacteria 744
476 Ga0207639_12013699 3300026041 Bacteria 538
477 Ga0207678_10130996 3300026067 Bacteria 2139
478 Ga0207678_10148201 3300026067 Bacteria 2003
479 Ga0207678_10220837 3300026067 Bacteria 1622
480 Ga0207678_10281397 3300026067 Bacteria 1428
481 Ga0207678_10964370 3300026067 Bacteria 754
482 Ga0207678_11533301 3300026067 Bacteria 588
483 Ga0207702_10039566 3300026078 Bacteria 3952
484 Ga0207702_10359461 3300026078 Bacteria 1395
485 Ga0207702_10624661 3300026078 Bacteria 1058
486 Ga0207641_10000140 3300026088 Bacteria 105699
487 Ga0207641_10091949 3300026088 Bacteria 2656
488 Ga0207641_10103760 3300026088 Bacteria 2509
489 Ga0207641_10198082 3300026088 Bacteria 1850
490 Ga0207641_10956811 3300026088 Bacteria 852
491 Ga0207641_10957694 3300026088 Bacteria 851
492 Ga0207648_10020329 3300026089 Bacteria 5981
493 Ga0207676_10021459 3300026095 Bacteria 4737
494 Ga0207676_10037142 3300026095 Bacteria 3710
495 Ga0207676_10097177 3300026095 Bacteria 2432
496 Ga0207676_10108894 3300026095 Bacteria 2314
497 Ga0207676_11467439 3300026095 Bacteria 679
498 Ga0207674_10004617 3300026116 Bacteria 16526
499 Ga0207674_10059133 3300026116 Bacteria 3880
500 Ga0207674_10465868 3300026116 Bacteria 1221
501 Ga0207675_100080579 3300026118 Bacteria 3052
502 Ga0207675_100517928 3300026118 Bacteria 1189
503 Ga0207675_101573816 3300026118 Bacteria 678
504 Ga0207675_101771893 3300026118 Bacteria 637
505 Ga0207683_10254340 3300026121 Bacteria 1603
506 Ga0207683_10518188 3300026121 Bacteria 1102
507 Ga0207683_11105947 3300026121 Bacteria 735
508 Ga0207698_10176765 3300026142 Bacteria 1886
509 Ga0209999_1032913 3300027543 Bacteria 964
510 Ga0209983_1015534 3300027665 Bacteria 1571
511 Ga0209974_10002308 3300027876 Bacteria 6925
512 Ga0209974_10184484 3300027876 Bacteria 765
513 Ga0268266_10000186 3300028379 Bacteria 110448
514 Ga0268266_10072353 3300028379 Bacteria 2989
515 Ga0268266_10603799 3300028379 Bacteria 1054
516 Ga0268266_10756984 3300028379 Bacteria 937
517 Ga0268265_10001547 3300028380 Bacteria 19101
518 Ga0268265_10145543 3300028380 Bacteria 1990
519 Ga0268265_10168476 3300028380 Bacteria 1869
520 Ga0268265_10171139 3300028380 Bacteria 1856
521 Ga0268265_10281023 3300028380 Unclassified 1489
522 Ga0268265_10676849 3300028380 Bacteria 994
523 Ga0268265_11281412 3300028380 Bacteria 732
524 Ga0268265_12134371 3300028380 Bacteria 567
525 Ga0268264_10016028 3300028381 Bacteria 6140
526 Ga0268264_10026533 3300028381 Bacteria 4734
527 Ga0268264_10083067 3300028381 Bacteria 2743
528 Ga0268264_10127878 3300028381 Bacteria 2248
529 Ga0268264_10150728 3300028381 Bacteria 2084
530 Ga0265338_10966622 3300028800 Bacteria 578
531 Ga0316177_1198349 3300030731 Bacteria 759
532 Ga0316176_1074978 3300030732 Bacteria 1035
533 Ga0314311_1183506 3300030733 Bacteria 667
534 Ga0316180_1089617 3300030736 Bacteria 1397
535 Ga0316180_1140534 3300030736 Bacteria 593
536 Ga0316183_1132082 3300030742 Bacteria 1100
537 Ga0316181_1144862 3300030744 Bacteria 902
538 Ga0316182_1176905 3300030745 Bacteria 2213
539 Ga0316182_1356999 3300030745 Bacteria 945
540 Ga0307513_10878950 3300031456 Bacteria 603
541 Ga0307408_100009847 3300031548 Bacteria 6300
542 Ga0307408_100027302 3300031548 Bacteria 3932
543 Ga0307408_100053930 3300031548 Bacteria 2906
544 Ga0307408_100546841 3300031548 Bacteria 1021
545 Ga0307408_100967481 3300031548 Bacteria 783
546 Ga0307405_10003202 3300031731 Bacteria 7458
547 Ga0307405_10039026 3300031731 Bacteria 2867
548 Ga0307405_10106643 3300031731 Bacteria 1890
549 Ga0307405_10212173 3300031731 Bacteria 1414
550 Ga0307405_10339410 3300031731 Bacteria 1155
551 Ga0307405_10680941 3300031731 Bacteria 849
552 Ga0307413_10005413 3300031824 Bacteria 5696
553 Ga0307413_10014611 3300031824 Bacteria 3994
554 Ga0307413_10025192 3300031824 Bacteria 3257
555 Ga0307413_10060331 3300031824 Bacteria 2334
556 Ga0307413_10146004 3300031824 Bacteria 1642
557 Ga0307413_10175964 3300031824 Bacteria 1520
558 Ga0307413_10188343 3300031824 Bacteria 1479
559 Ga0307413_10297432 3300031824 Bacteria 1222
560 Ga0307413_10375865 3300031824 Unclassified 1105
561 Ga0307413_10390789 3300031824 Bacteria 1087
562 Ga0307413_10541829 3300031824 Bacteria 942
563 Ga0307413_10801881 3300031824 Bacteria 791
564 Ga0307413_10820640 3300031824 Bacteria 783
565 Ga0307413_10832682 3300031824 Bacteria 778
566 Ga0307410_10008672 3300031852 Bacteria 5651
567 Ga0307410_10034604 3300031852 Bacteria 3273
568 Ga0307410_10044198 3300031852 Bacteria 2957
569 Ga0307410_10049837 3300031852 Bacteria 2812
570 Ga0307410_10096356 3300031852 Bacteria 2111
571 Ga0307410_10110249 3300031852 Bacteria 1990
572 Ga0307410_10149435 3300031852 Bacteria 1737
573 Ga0307410_10213301 3300031852 Bacteria 1480
574 Ga0307410_10514170 3300031852 Bacteria 987
575 Ga0307410_10940470 3300031852 Bacteria 742
576 Ga0307410_10969536 3300031852 Bacteria 732
577 Ga0307410_11417831 3300031852 Bacteria 610
578 Ga0307410_11742956 3300031852 Bacteria 552
579 Ga0307406_10006067 3300031901 Bacteria 6640
580 Ga0307406_10043201 3300031901 Bacteria 2818
581 Ga0307406_10218386 3300031901 Bacteria 1415
582 Ga0307406_10384516 3300031901 Bacteria 1107
583 Ga0307406_12005985 3300031901 Bacteria 517
584 Ga0307407_10018431 3300031903 Bacteria 3530
585 Ga0307407_10053929 3300031903 Bacteria 2315
586 Ga0307407_10079401 3300031903 Bacteria 1979
587 Ga0307407_10098335 3300031903 Bacteria 1810
588 Ga0307407_10137397 3300031903 Bacteria 1572
589 Ga0307407_10159581 3300031903 Bacteria 1474
590 Ga0307407_10174093 3300031903 Bacteria 1420
591 Ga0307407_10417710 3300031903 Bacteria 966
592 Ga0307407_10469917 3300031903 Bacteria 916
593 Ga0307407_11476110 3300031903 Bacteria 537
594 Ga0307407_11679455 3300031903 Bacteria 505
595 Ga0307412_10005338 3300031911 Bacteria 7212
596 Ga0307412_10044749 3300031911 Bacteria 2889
597 Ga0307412_10071952 3300031911 Bacteria 2362
598 Ga0307412_10182377 3300031911 Bacteria 1580
599 Ga0307412_10630669 3300031911 Bacteria 912
600 Ga0307412_10728793 3300031911 Bacteria 854
601 Ga0307412_10896643 3300031911 Bacteria 777
602 Ga0307412_12300559 3300031911 Bacteria 503
603 Ga0307409_100006481 3300031995 Bacteria 6884
604 Ga0307409_100008967 3300031995 Bacteria 6112
605 Ga0307409_100009610 3300031995 Bacteria 5954
606 Ga0307409_100015591 3300031995 Bacteria 4993
607 Ga0307409_100034937 3300031995 Bacteria 3678
608 Ga0307409_100057496 3300031995 Bacteria 3014
609 Ga0307409_100060146 3300031995 Bacteria 2961
610 Ga0307409_100070258 3300031995 Bacteria 2779
611 Ga0307409_100150113 3300031995 Bacteria 2022
612 Ga0307409_100162001 3300031995 Bacteria 1957
613 Ga0307409_100233369 3300031995 Bacteria 1669
614 Ga0307409_100314468 3300031995 Bacteria 1463
615 Ga0307409_100585873 3300031995 Bacteria 1100
616 Ga0307409_100589219 3300031995 Bacteria 1097
617 Ga0307409_100656331 3300031995 Bacteria 1043
618 Ga0307409_100858043 3300031995 Bacteria 919
619 Ga0307409_102045420 3300031995 Unclassified 602
620 Ga0307416_100002384 3300032002 Bacteria 10761
621 Ga0307416_100010253 3300032002 Bacteria 6180
622 Ga0307416_100022526 3300032002 Bacteria 4550
623 Ga0307416_100036907 3300032002 Bacteria 3754
624 Ga0307416_100057602 3300032002 Bacteria 3145
625 Ga0307416_100072145 3300032002 Bacteria 2872
626 Ga0307416_100999619 3300032002 Bacteria 939
627 Ga0307416_101032583 3300032002 Bacteria 926
628 Ga0307416_103452463 3300032002 Bacteria 529
629 Ga0307414_10007766 3300032004 Bacteria 6045
630 Ga0307414_10016015 3300032004 Bacteria 4545
631 Ga0307414_10024412 3300032004 Bacteria 3855
632 Ga0307414_10025484 3300032004 Bacteria 3790
633 Ga0307414_10068251 3300032004 Bacteria 2550
634 Ga0307414_10191416 3300032004 Bacteria 1655
635 Ga0307414_10281583 3300032004 Bacteria 1397
636 Ga0307414_10302079 3300032004 Bacteria 1354
637 Ga0307414_10307341 3300032004 Bacteria 1344
638 Ga0307414_10352075 3300032004 Bacteria 1264
639 Ga0307414_10793269 3300032004 Bacteria 863
640 Ga0307414_11302303 3300032004 Bacteria 674
641 Ga0307411_10001036 3300032005 Bacteria 10741
642 Ga0307411_10008579 3300032005 Bacteria 5306
643 Ga0307411_10016324 3300032005 Bacteria 4200
644 Ga0307411_10030618 3300032005 Bacteria 3300
645 Ga0307411_10114374 3300032005 Bacteria 1938
646 Ga0307411_10121477 3300032005 Bacteria 1891
647 Ga0307411_10128214 3300032005 Bacteria 1849
648 Ga0307411_10150858 3300032005 Bacteria 1727
649 Ga0307411_11698433 3300032005 Bacteria 584
650 Ga0307411_11978062 3300032005 Bacteria 544
651 Ga0307411_12111198 3300032005 Bacteria 527
652 Ga0307415_100004390 3300032126 Bacteria 7311
653 Ga0307415_100007564 3300032126 Bacteria 5949
654 Ga0307415_100033750 3300032126 Bacteria 3323
655 Ga0307415_100044639 3300032126 Bacteria 2964
656 Ga0307415_100093180 3300032126 Bacteria 2187
657 Ga0307415_100172662 3300032126 Bacteria 1687
658 Ga0307415_100235152 3300032126 Bacteria 1478
659 Ga0307415_100533609 3300032126 Bacteria 1032
660 Ga0307415_100564913 3300032126 Bacteria 1006
661 Ga0307415_100680489 3300032126 Bacteria 926
662 Ga0307415_100838477 3300032126 Bacteria 842
663 Ga0307415_102146145 3300032126 Bacteria 546
664 Ga0373961_0219136 3300035241 Bacteria 678
665 Ga0395900_0293020 3300037418 Bacteria 1615
666 Ga0395900_0329775 3300037418 Bacteria 1504
667 Ga0395900_1572915 3300037418 Unclassified 569
668 Ga0395898_0666457 3300037466 Bacteria 982
669 Ga0395905_0088917 3300037471 Bacteria 2895
670 Ga0395905_0122006 3300037471 Bacteria 2450
671 Ga0395905_0342609 3300037471 Bacteria 1386
672 Ga0395905_0384941 3300037471 Bacteria 1297
673 Ga0395905_0804049 3300037471 Bacteria 843
674 Ga0395901_0134283 3300038443 Bacteria 2600
675 Ga0395901_0701065 3300038443 Bacteria 1010
676 Ga0439436_0027635 3300041404 Bacteria 1659
677 Ga0439465_0098994 3300041413 Bacteria 1005
678 Ga0439433_0172985 3300041999 Unclassified 563
679 Ga0439445_0044386 3300042004 Unclassified 1187
680 Ga0439445_0080095 3300042004 Bacteria 912
681 Ga0439445_0263363 3300042004 Bacteria 516
682 Ga0439448_0136702 3300042005 Bacteria 847
683 Ga0439432_014495 3300042006 Bacteria 2668
684 Ga0439432_036823 3300042006 Bacteria 1564
685 Ga0439449_0009361 3300042007 Bacteria 3714
686 Ga0439449_0049218 3300042007 Bacteria 1560
687 Ga0439455_0186905 3300042012 Bacteria 597
688 Ga0439462_0020896 3300042015 Bacteria 1709
689 Ga0450912_017781 3300042116 Bacteria 667
690 Ga0450914_007426 3300042118 Bacteria 990
691 Ga0439434_0229795 3300042435 Bacteria 631
692 Ga0439459_0085403 3300042438 Bacteria 751
693 Ga0450918_035856 3300042531 Bacteria 883
694 Ga0451577_0517167 3300042876 Bacteria 1084
695 Ga0466969_0354064 3300044656 Bacteria 665
696 Ga0466972_0173706 3300044658 Bacteria 1011
697 Ga0466965_0671580 3300044683 Bacteria 593
698 Ga0466965_0900611 3300044683 Bacteria 516
699 Ga0466966_0060745 3300044684 Bacteria 2385
700 Ga0453684_1131046 3300044712 Bacteria 826
701 Ga0466970_0087954 3300044765 Bacteria 1685
702 Ga0466957_0909562 3300044842 Unclassified 629
703 Ga0466960_0208701 3300044901 Bacteria 1070
704 Ga0466959_0110382 3300045049 Bacteria 1963
705 Ga0451576_2325603 3300045051 Unclassified 549
706 Ga0466967_1090505 3300045976 Bacteria 795
707 Ga0495629_0379349 3300046459 Bacteria 962
708 Ga0495605_0147624 3300046474 Bacteria 1051
709 Ga0495596_0454497 3300046500 Bacteria 500
710 Ga0495631_0494645 3300046518 Bacteria 521
711 Ga0495663_0031763 3300046525 Bacteria 1570
712 Ga0495663_0184407 3300046525 Bacteria 724
713 Ga0495598_0000231 3300046537 Bacteria 9952
714 Ga0495621_0000597 3300046539 Bacteria 9014
715 Ga0495621_0126105 3300046539 Bacteria 993
716 Ga0495633_0010977 3300046558 Bacteria 4918
717 Ga0495668_0061694 3300046616 Bacteria 2067
718 Ga0495625_0357948 3300046660 Bacteria 921
719 Ga0495625_0688508 3300046660 Bacteria 605
720 Ga0495669_0001490 3300046684 Bacteria 9649
721 Ga0495669_0001735 3300046684 Bacteria 8929
722 Ga0495669_0007740 3300046684 Bacteria 4510
723 Ga0495669_0008561 3300046684 Bacteria 4307
724 Ga0495669_0033046 3300046684 Bacteria 2276
725 Ga0495669_0057120 3300046684 Bacteria 1760
726 Ga0495669_0134812 3300046684 Bacteria 1164
727 Ga0495669_0618895 3300046684 Unclassified 527
728 Ga0495670_0003874 3300046691 Bacteria 7349
729 Ga0495677_0007384 3300047445 Bacteria 4112
730 Ga0495677_0127782 3300047445 Bacteria 972
731 Ga0495677_0423282 3300047445 Bacteria 527
732 Ga0496101_0346170 3300048904 Bacteria 1168
733 Ga0496101_0357096 3300048904 Bacteria 1149
734 Ga0496101_0764177 3300048904 Bacteria 762
735 Ga0496102_0085784 3300048905 Bacteria 2908
736 Ga0496103_0572745 3300048906 Bacteria 720
737 Ga0496106_0227554 3300048909 Bacteria 1488
738 Ga0496107_0126915 3300048910 Bacteria 1882
739 Ga0496107_0226787 3300048910 Bacteria 1390
740 Ga0496107_0447275 3300048910 Bacteria 960
741 Ga0496108_0134469 3300048911 Bacteria 2126
742 Ga0496108_0584234 3300048911 Bacteria 974
743 Ga0496108_0946097 3300048911 Bacteria 738
744 Ga0496109_0535831 3300048912 Bacteria 1105
745 Ga0496109_0866619 3300048912 Bacteria 841
746 Ga0496110_0098317 3300048913 Bacteria 2622
747 Ga0496111_0002214 3300048914 Bacteria 11663
748 Ga0496112_0012987 3300048915 Bacteria 7677
749 Ga0496112_1507837 3300048915 Bacteria 586
750 Ga0496114_0037140 3300048917 Bacteria 4029
751 Ga0501306_070525 3300049127 Bacteria 589
752 Ga0501298_017094 3300049521 Bacteria 1321
753 Ga0501036_1211689 3300049572 Unclassified 615
754 Ga0501199_002870 3300049650 Bacteria 1631
755 Ga0501201_010753 3300049651 Bacteria 899
756 Ga0501202_006092 3300049652 Bacteria 2148
757 Ga0501209_161423 3300049656 Unclassified 678
758 Ga0501217_014299 3300049661 Bacteria 1791
759 Ga0501223_003778 3300049663 Bacteria 3271
760 Ga0501224_020741 3300049664 Bacteria 978
761 Ga0501233_066903 3300049668 Bacteria 903
762 Ga0501235_023861 3300049669 Bacteria 1365
763 Ga0501240_015737 3300049673 Bacteria 1079
764 Ga0501247_015539 3300049677 Bacteria 952
765 Ga0501247_081917 3300049677 Bacteria 522
766 Ga0501248_049775 3300049678 Bacteria 536
767 Ga0501249_113333 3300049679 Unclassified 657
768 Ga0501249_167531 3300049679 Unclassified 561
769 Ga0501252_019906 3300049682 Bacteria 869
770 Ga0501257_158499 3300049686 Bacteria 628
771 Ga0501219_027723 3300049703 Unclassified 521
772 Ga0501221_073441 3300049704 Bacteria 811
773 Ga0501229_021547 3300049706 Bacteria 856
774 Ga0501234_104874 3300049707 Bacteria 516
775 Ga0501079_0731804 3300049741 Bacteria 779
776 Ga0501079_1396463 3300049741 Bacteria 551
777 Ga0501263_013207 3300049760 Bacteria 1044
778 Ga0501265_111852 3300049762 Bacteria 511
779 Ga0501268_012471 3300049765 Bacteria 1359
780 Ga0501268_108120 3300049765 Bacteria 604
781 Ga0501270_019866 3300049767 Bacteria 1011
782 Ga0501272_010965 3300049769 Bacteria 1016
783 Ga0501273_001053 3300049770 Bacteria 2496
784 nmdc:mga06r32_292789_c1 3300050510 Bacteria 1614
785 nmdc:mga0a205_250227_c1 3300050515 Bacteria 1652
786 nmdc:mga0a205_697786_c1 3300050515 Unclassified 865
787 Ga0495655_0289129 3300053083 Bacteria 560
788 Ga0500658_0000029 3300053134 Bacteria 99170
789 Ga0590074_041143 3300059423 Bacteria 832
790 Ga0070676_10069610
791 MBSR1b_contig_11141605
792 CNBas_1004128
793 JGI24740J21852_10096916
794 JGI24748J21848_1026112
795 JGI24738J21930_10103389
796 JGI24034J26672_10042031
797 JGI24751J29686_10043287
798 JGI25406J46586_10200970
799 Ga0065714_10497189
800 Ga0065712_10091497
801 Ga0065712_10605641
802 Ga0065715_10030695
803 Ga0065715_10175404
804 Ga0065715_10175552
805 Ga0070658_11166967
806 Ga0070658_11185579
807 Ga0070676_10252780
808 Ga0070676_10634869
809 Ga0070683_100908143
810 Ga0070690_101196592
811 Ga0070670_100009915
812 Ga0070670_100012394
813 Ga0070670_100037775
814 Ga0070670_100054972
815 Ga0070670_100892105
816 Ga0070670_101544593
817 Ga0070670_101632234
818 Ga0070677_10000309
819 Ga0070677_10244266
820 Ga0070677_10363476
821 Ga0068869_100197044
822 Ga0068869_100650477
823 Ga0070666_10394895
824 Ga0070666_11092510
825 Ga0070680_100138959
826 Ga0070680_100154378
827 Ga0070680_100192794
828 Ga0070680_100194691
829 Ga0070680_101138528
830 Ga0070682_102087826
831 Ga0068868_100292048
832 Ga0068868_101949630
833 Ga0070660_100719598
834 Ga0070660_100732836
835 Ga0070660_101011013
836 Ga0070660_101740588
837 Ga0070689_100854567
838 Ga0070687_100898545
839 Ga0070661_100048713
840 Ga0070661_100062181
841 Ga0070661_100075986
842 Ga0070661_100338629
843 Ga0070661_100372198
844 Ga0070661_100592835
845 Ga0070661_101073422
846 Ga0070661_101553026
847 Ga0070668_100024392
848 Ga0070668_100882493
849 Ga0070668_100967588
850 Ga0070668_101036010
851 Ga0070669_100036245
852 Ga0070669_100060402
853 Ga0070669_100084009
854 Ga0070669_100302874
855 Ga0070669_100452955
856 Ga0070669_100664215
857 Ga0070669_100823507
858 Ga0070669_101909655
859 Ga0070675_100023519
860 Ga0070675_100111015
861 Ga0070675_100193795
862 Ga0070675_100292862
863 Ga0070675_100425772
864 Ga0070675_100657136
865 Ga0070671_100022312
866 Ga0070671_100036057
867 Ga0070671_100132409
868 Ga0070671_100230274
869 Ga0070671_100536014
870 Ga0070674_100032447
871 Ga0070674_100454528
872 Ga0070674_100856443
873 Ga0070674_101095721
874 Ga0070674_101166426
875 Ga0070673_100051549
876 Ga0070673_100056864
877 Ga0070673_100101098
878 Ga0070673_100313071
879 Ga0070673_100326802
880 Ga0070673_101224339
881 Ga0070673_101323898
882 Ga0070659_100021963
883 Ga0070659_100121683
884 Ga0070659_100271565
885 Ga0070659_100508145
886 Ga0070659_100814064
887 Ga0070659_101359963
888 Ga0070667_100001943
889 Ga0070667_100004347
890 Ga0070667_100016231
891 Ga0070667_100019495
892 Ga0070667_100201265
893 Ga0070667_100291913
894 Ga0070667_101251814
895 Ga0070667_102002059
896 Ga0070701_10965509
897 Ga0070663_100118984
898 Ga0070663_100337935
899 Ga0070663_101477235
900 Ga0070678_100169022
901 Ga0070678_100701492
902 Ga0070678_102410216
903 Ga0070662_100000675
904 Ga0070662_100113683
905 Ga0070662_100230930
906 Ga0070662_100378619
907 Ga0070662_100503910
908 Ga0070662_100765014
909 Ga0070662_100914782
910 Ga0070662_101714568
911 Ga0070681_10120650
912 Ga0070681_10133173
913 Ga0070681_10309211
914 Ga0070681_10312538
915 Ga0068867_100168991
916 Ga0068867_100967642
917 Ga0070685_10620845
918 Ga0070679_100633937
919 Ga0070679_101058899
920 Ga0070679_102161638
921 Ga0068853_100022979
922 Ga0068853_100223913
923 Ga0068853_100344108
924 Ga0068853_100645872
925 Ga0068853_101922497
926 Ga0070672_100076357
927 Ga0070672_100212352
928 Ga0070672_100238746
929 Ga0070672_100329095
930 Ga0070672_100609835
931 Ga0070672_101329890
932 Ga0070672_101985170
933 Ga0070695_101000888
934 Ga0070696_100013477
935 Ga0070696_100086828
936 Ga0070693_100075548
937 Ga0070665_100002020
938 Ga0070665_100103612
939 Ga0070665_100245630
940 Ga0070665_101181690
941 Ga0068855_100018812
942 Ga0068855_100375947
943 Ga0068855_101269158
944 Ga0068855_101833235
945 Ga0070664_100010102
946 Ga0070664_100011516
947 Ga0070664_100113426
948 Ga0070664_100120748
949 Ga0070664_100129405
950 Ga0070664_100219218
951 Ga0070664_100247455
952 Ga0070664_100330190
953 Ga0070664_101114058
954 Ga0068857_100070697
955 Ga0068857_100104034
956 Ga0068854_100005153
957 Ga0068854_100215525
958 Ga0068854_100295088
959 Ga0068854_101001419
960 Ga0068856_100013596
961 Ga0068856_100017486
962 Ga0068856_100042249
963 Ga0068856_100200797
964 Ga0068852_100714783
965 Ga0068852_102697885
966 Ga0068859_100000229
967 Ga0068859_100028594
968 Ga0068859_100250320
969 Ga0068859_100706789
970 Ga0068864_100000345
971 Ga0068864_100103076
972 Ga0068864_100303769
973 Ga0068864_100556294
974 Ga0068866_10272615
975 Ga0068866_10532033
976 Ga0068866_11160268
977 Ga0068861_100024866
978 Ga0068861_100050565
979 Ga0068861_100348696
980 Ga0068861_101009377
981 Ga0068851_10191662
982 Ga0068851_10325032
983 Ga0068870_10725031
984 Ga0068870_11035807
985 Ga0068863_100001129
986 Ga0068863_100001956
987 Ga0068863_100013614
988 Ga0068863_100049264
989 Ga0068863_100141201
990 Ga0068863_100231732
991 Ga0068863_100811830
992 Ga0068858_100003029
993 Ga0068858_100027743
994 Ga0068858_100049453
995 Ga0068858_100329038
996 Ga0068860_100002029
997 Ga0068860_100018215
998 Ga0068860_100188049
999 Ga0068860_101111830
1000 Ga0068860_101210780
1001 Ga0068862_100004258
1002 Ga0068862_100047286
1003 Ga0068862_100118823
1004 Ga0068862_100198641
1005 Ga0068862_100220155
1006 Ga0068862_100448789
1007 Ga0068862_100469647
1008 Ga0068862_101328072
1009 Ga0081539_10011281
1010 Ga0081539_10107118
1011 Ga0075364_10626192
1012 Ga0097621_100660832
1013 Ga0097621_101728900
1014 Ga0097621_102185894
1015 Ga0068871_100049132
1016 Ga0075431_100461409
1017 Ga0075433_10592402
1018 Ga0068865_100004168
1019 Ga0068865_100302747
1020 Ga0068865_100717061
1021 Ga0068865_101826086
1022 Ga0097620_100000229
1023 Ga0097620_100028597
1024 Ga0097620_100250311
1025 Ga0097620_100706807
1026 Ga0075435_100830349
1027 Ga0105251_10211965
1028 Ga0105250_10028148
1029 Ga0105240_10015925
1030 Ga0111539_11866450
1031 Ga0105245_10046926
1032 Ga0105247_10235109
1033 Ga0105247_10432202
1034 Ga0114129_13425065
1035 Ga0105243_10601102
1036 Ga0105243_11223022
1037 Ga0105241_10367653
1038 Ga0105241_10563859
1039 Ga0105241_10642998
1040 Ga0105241_11465625
1041 Ga0105242_11856968
1042 Ga0105248_10000075
1043 Ga0105248_10012999
1044 Ga0105248_10041028
1045 Ga0105248_10191715
1046 Ga0105248_10455229
1047 Ga0105248_10794715
1048 Ga0105248_11066272
1049 Ga0105237_10054672
1050 Ga0105237_12285267
1051 Ga0105238_10119010
1052 Ga0105249_10030646
1053 Ga0105249_10126984
1054 Ga0105249_10209994
1055 Ga0105249_11379722
1056 Ga0105249_11545375
1057 Ga0105030_110533
1058 Ga0105239_11276820
1059 Ga0105246_10124117
1060 Ga0105246_10287999
1061 Ga0105246_10468529
1062 Ga0105246_10783469
1063 Ga0105246_10946000
1064 Ga0157327_1026841
1065 Ga0157373_10007592
1066 Ga0157373_10068192
1067 Ga0157373_10187094
1068 Ga0157373_10190256
1069 Ga0157373_10315190
1070 Ga0157373_10825164
1071 Ga0157373_11516235
1072 Ga0157371_10060980
1073 Ga0157371_10066630
1074 Ga0157371_11186932
1075 Ga0157371_11510911
1076 Ga0157370_10003024
1077 Ga0157370_10281158
1078 Ga0157370_10350296
1079 Ga0157369_10053130
1080 Ga0157369_10523688
1081 Ga0157378_10844980
1082 Ga0157378_12791384
1083 Ga0163162_10268038
1084 Ga0163162_10718904
1085 Ga0163162_11326638
1086 Ga0157372_10835618
1087 Ga0157372_12597483
1088 Ga0157375_10022620
1089 Ga0157375_10049560
1090 Ga0157375_10470972
1091 Ga0157375_10548068
1092 Ga0157375_10678174
1093 Ga0163163_10001163
1094 Ga0163163_10290500
1095 Ga0163163_11003715
1096 Ga0157380_10166338
1097 Ga0157380_10426931
1098 Ga0157380_11057663
1099 Ga0157380_11307694
1100 Ga0182008_10038631
1101 Ga0157377_10148509
1102 Ga0157377_10665308
1103 Ga0157379_10004712
1104 Ga0157379_10014771
1105 Ga0157379_11709514
1106 Ga0157376_10331188
1107 Ga0163161_10104259
1108 Ga0163161_10226144
1109 Ga0207697_10220275
1110 Ga0207656_10161723
1111 Ga0207682_10002814
1112 Ga0207682_10003319
1113 Ga0207682_10058839
1114 Ga0207682_10167019
1115 Ga0207688_10099209
1116 Ga0207688_10125390
1117 Ga0207688_10161587
1118 Ga0207688_10685552
1119 Ga0207645_10152847
1120 Ga0207645_10232182
1121 Ga0207645_10286455
1122 Ga0207645_10664336
1123 Ga0207645_10683191
1124 Ga0207643_10408514
1125 Ga0207643_10542811
1126 Ga0207705_10290651
1127 Ga0207705_10953270
1128 Ga0207654_10094676
1129 Ga0207654_10569450
1130 Ga0207707_10143238
1131 Ga0207707_10221954
1132 Ga0207707_10225232
1133 Ga0207707_10474292
1134 Ga0207707_10656750
1135 Ga0207707_10721659
1136 Ga0207695_10008967
1137 Ga0207671_10064401
1138 Ga0207660_10037803
1139 Ga0207660_10171751
1140 Ga0207660_10715992
1141 Ga0207662_10348249
1142 Ga0207662_10489407
1143 Ga0207662_11327479
1144 Ga0207657_10068285
1145 Ga0207657_10140933
1146 Ga0207649_10239827
1147 Ga0207649_10286626
1148 Ga0207649_10600120
1149 Ga0207649_10881067
1150 Ga0207649_11098270
1151 Ga0207649_11539718
1152 Ga0207652_10128961
1153 Ga0207652_10286529
1154 Ga0207681_10027411
1155 Ga0207681_10039418
1156 Ga0207681_10073642
1157 Ga0207681_10138423
1158 Ga0207681_10400810
1159 Ga0207681_10767224
1160 Ga0207694_10166559
1161 Ga0207650_10019107
1162 Ga0207650_10087087
1163 Ga0207650_10160903
1164 Ga0207650_10186242
1165 Ga0207650_10390659
1166 Ga0207650_10390897
1167 Ga0207650_10458078
1168 Ga0207650_10970264
1169 Ga0207650_11365455
1170 Ga0207659_10009454
1171 Ga0207659_10030673
1172 Ga0207659_10107915
1173 Ga0207687_10034470
1174 Ga0207644_10057381
1175 Ga0207644_10070433
1176 Ga0207644_10144425
1177 Ga0207644_10515412
1178 Ga0207644_10678878
1179 Ga0207690_10039565
1180 Ga0207690_10379157
1181 Ga0207690_10592251
1182 Ga0207690_10737923
1183 Ga0207690_11783161
1184 Ga0207706_10000824
1185 Ga0207706_10025180
1186 Ga0207706_10067351
1187 Ga0207706_10092584
1188 Ga0207706_10244771
1189 Ga0207706_10326577
1190 Ga0207706_10329533
1191 Ga0207706_10585527
1192 Ga0207706_11085910
1193 Ga0207709_10144370
1194 Ga0207709_10455907
1195 Ga0207670_10416889
1196 Ga0207669_10660334
1197 Ga0207704_10035751
1198 Ga0207704_10594267
1199 Ga0207691_10008745
1200 Ga0207691_10009591
1201 Ga0207691_10098675
1202 Ga0207691_10220670
1203 Ga0207691_10221400
1204 Ga0207691_10713016
1205 Ga0207711_10000077
1206 Ga0207711_10033262
1207 Ga0207711_10192670
1208 Ga0207711_10731798
1209 Ga0207689_10060648
1210 Ga0207689_10123081
1211 Ga0207689_10371523
1212 Ga0207689_10521093
1213 Ga0207679_10003483
1214 Ga0207679_10044563
1215 Ga0207679_10054942
1216 Ga0207679_10108807
1217 Ga0207679_10114866
1218 Ga0207679_10361381
1219 Ga0207679_10419748
1220 Ga0207679_10616072
1221 Ga0207679_10683759
1222 Ga0207679_11245235
1223 Ga0207667_10013061
1224 Ga0207667_10406823
1225 Ga0207667_11482555
1226 Ga0207651_10175083
1227 Ga0207651_10484291
1228 Ga0207651_10512922
1229 Ga0207651_10588823
1230 Ga0207651_10675025
1231 Ga0207712_10047704
1232 Ga0207712_10132349
1233 Ga0207712_10462872
1234 Ga0207668_10019324
1235 Ga0207668_10186487
1236 Ga0207668_10270779
1237 Ga0207668_10532522
1238 Ga0207668_10737336
1239 Ga0207668_10798407
1240 Ga0207640_10109326
1241 Ga0207640_10172338
1242 Ga0207640_10223218
1243 Ga0207640_10432601
1244 Ga0207640_10472073
1245 Ga0207640_11247194
1246 Ga0207658_10003421
1247 Ga0207658_10037416
1248 Ga0207658_10090601
1249 Ga0207658_10122794
1250 Ga0207658_10202686
1251 Ga0207658_10337752
1252 Ga0207658_10620683
1253 Ga0207658_11040699
1254 Ga0207658_11591229
1255 Ga0207677_10235470
1256 Ga0207677_10309941
1257 Ga0207677_11272555
1258 Ga0207703_10001376
1259 Ga0207703_10044571
1260 Ga0207703_10132903
1261 Ga0207703_10136019
1262 Ga0207703_10771139
1263 Ga0207639_10006874
1264 Ga0207639_11104849
1265 Ga0207639_12013699
1266 Ga0207678_10130996
1267 Ga0207678_10148201
1268 Ga0207678_10220837
1269 Ga0207678_10281397
1270 Ga0207678_10964370
1271 Ga0207678_11533301
1272 Ga0207702_10039566
1273 Ga0207702_10359461
1274 Ga0207702_10624661
1275 Ga0207641_10000140
1276 Ga0207641_10091949
1277 Ga0207641_10103760
1278 Ga0207641_10198082
1279 Ga0207641_10956811
1280 Ga0207641_10957694
1281 Ga0207648_10020329
1282 Ga0207676_10021459
1283 Ga0207676_10037142
1284 Ga0207676_10097177
1285 Ga0207676_10108894
1286 Ga0207676_11467439
1287 Ga0207674_10004617
1288 Ga0207674_10059133
1289 Ga0207674_10465868
1290 Ga0207675_100080579
1291 Ga0207675_100517928
1292 Ga0207675_101573816
1293 Ga0207675_101771893
1294 Ga0207683_10254340
1295 Ga0207683_10518188
1296 Ga0207683_11105947
1297 Ga0207698_10176765
1298 Ga0209999_1032913
1299 Ga0209983_1015534
1300 Ga0209974_10002308
1301 Ga0209974_10184484
1302 Ga0268266_10000186
1303 Ga0268266_10072353
1304 Ga0268266_10603799
1305 Ga0268266_10756984
1306 Ga0268265_10001547
1307 Ga0268265_10145543
1308 Ga0268265_10168476
1309 Ga0268265_10171139
1310 Ga0268265_10281023
1311 Ga0268265_10676849
1312 Ga0268265_11281412
1313 Ga0268265_12134371
1314 Ga0268264_10016028
1315 Ga0268264_10026533
1316 Ga0268264_10083067
1317 Ga0268264_10127878
1318 Ga0268264_10150728
1319 Ga0265338_10966622
1320 Ga0316177_1198349
1321 Ga0316176_1074978
1322 Ga0314311_1183506
1323 Ga0316180_1089617
1324 Ga0316180_1140534
1325 Ga0316183_1132082
1326 Ga0316181_1144862
1327 Ga0316182_1176905
1328 Ga0316182_1356999
1329 Ga0307513_10878950
1330 Ga0307408_100009847
1331 Ga0307408_100027302
1332 Ga0307408_100053930
1333 Ga0307408_100546841
1334 Ga0307408_100967481
1335 Ga0307405_10003202
1336 Ga0307405_10039026
1337 Ga0307405_10106643
1338 Ga0307405_10212173
1339 Ga0307405_10339410
1340 Ga0307405_10680941
1341 Ga0307413_10005413
1342 Ga0307413_10014611
1343 Ga0307413_10025192
1344 Ga0307413_10060331
1345 Ga0307413_10146004
1346 Ga0307413_10175964
1347 Ga0307413_10188343
1348 Ga0307413_10297432
1349 Ga0307413_10375865
1350 Ga0307413_10390789
1351 Ga0307413_10541829
1352 Ga0307413_10801881
1353 Ga0307413_10820640
1354 Ga0307413_10832682
1355 Ga0307410_10008672
1356 Ga0307410_10034604
1357 Ga0307410_10044198
1358 Ga0307410_10049837
1359 Ga0307410_10096356
1360 Ga0307410_10110249
1361 Ga0307410_10149435
1362 Ga0307410_10213301
1363 Ga0307410_10514170
1364 Ga0307410_10940470
1365 Ga0307410_10969536
1366 Ga0307410_11417831
1367 Ga0307410_11742956
1368 Ga0307406_10006067
1369 Ga0307406_10043201
1370 Ga0307406_10218386
1371 Ga0307406_10384516
1372 Ga0307406_12005985
1373 Ga0307407_10018431
1374 Ga0307407_10053929
1375 Ga0307407_10079401
1376 Ga0307407_10098335
1377 Ga0307407_10137397
1378 Ga0307407_10159581
1379 Ga0307407_10174093
1380 Ga0307407_10417710
1381 Ga0307407_10469917
1382 Ga0307407_11476110
1383 Ga0307407_11679455
1384 Ga0307412_10005338
1385 Ga0307412_10044749
1386 Ga0307412_10071952
1387 Ga0307412_10182377
1388 Ga0307412_10630669
1389 Ga0307412_10728793
1390 Ga0307412_10896643
1391 Ga0307412_12300559
1392 Ga0307409_100006481
1393 Ga0307409_100008967
1394 Ga0307409_100009610
1395 Ga0307409_100015591
1396 Ga0307409_100034937
1397 Ga0307409_100057496
1398 Ga0307409_100060146
1399 Ga0307409_100070258
1400 Ga0307409_100150113
1401 Ga0307409_100162001
1402 Ga0307409_100233369
1403 Ga0307409_100314468
1404 Ga0307409_100585873
1405 Ga0307409_100589219
1406 Ga0307409_100656331
1407 Ga0307409_100858043
1408 Ga0307409_102045420
1409 Ga0307416_100002384
1410 Ga0307416_100010253
1411 Ga0307416_100022526
1412 Ga0307416_100036907
1413 Ga0307416_100057602
1414 Ga0307416_100072145
1415 Ga0307416_100999619
1416 Ga0307416_101032583
1417 Ga0307416_103452463
1418 Ga0307414_10007766
1419 Ga0307414_10016015
1420 Ga0307414_10024412
1421 Ga0307414_10025484
1422 Ga0307414_10068251
1423 Ga0307414_10191416
1424 Ga0307414_10281583
1425 Ga0307414_10302079
1426 Ga0307414_10307341
1427 Ga0307414_10352075
1428 Ga0307414_10793269
1429 Ga0307414_11302303
1430 Ga0307411_10001036
1431 Ga0307411_10008579
1432 Ga0307411_10016324
1433 Ga0307411_10030618
1434 Ga0307411_10114374
1435 Ga0307411_10121477
1436 Ga0307411_10128214
1437 Ga0307411_10150858
1438 Ga0307411_11698433
1439 Ga0307411_11978062
1440 Ga0307411_12111198
1441 Ga0307415_100004390
1442 Ga0307415_100007564
1443 Ga0307415_100033750
1444 Ga0307415_100044639
1445 Ga0307415_100093180
1446 Ga0307415_100172662
1447 Ga0307415_100235152
1448 Ga0307415_100533609
1449 Ga0307415_100564913
1450 Ga0307415_100680489
1451 Ga0307415_100838477
1452 Ga0307415_102146145
1453 Ga0373961_0219136
1454 Ga0395900_0293020
1455 Ga0395900_0329775
1456 Ga0395900_1572915
1457 Ga0395898_0666457
1458 Ga0395905_0088917
1459 Ga0395905_0122006
1460 Ga0395905_0342609
1461 Ga0395905_0384941
1462 Ga0395905_0804049
1463 Ga0395901_0134283
1464 Ga0395901_0701065
1465 Ga0439436_0027635
1466 Ga0439465_0098994
1467 Ga0439433_0172985
1468 Ga0439445_0044386
1469 Ga0439445_0080095
1470 Ga0439445_0263363
1471 Ga0439448_0136702
1472 Ga0439432_014495
1473 Ga0439432_036823
1474 Ga0439449_0009361
1475 Ga0439449_0049218
1476 Ga0439455_0186905
1477 Ga0439462_0020896
1478 Ga0450912_017781
1479 Ga0450914_007426
1480 Ga0439434_0229795
1481 Ga0439459_0085403
1482 Ga0450918_035856
1483 Ga0451577_0517167
1484 Ga0466969_0354064
1485 Ga0466972_0173706
1486 Ga0466965_0671580
1487 Ga0466965_0900611
1488 Ga0466966_0060745
1489 Ga0453684_1131046
1490 Ga0466970_0087954
1491 Ga0466957_0909562
1492 Ga0466960_0208701
1493 Ga0466959_0110382
1494 Ga0451576_2325603
1495 Ga0466967_1090505
1496 Ga0495629_0379349
1497 Ga0495605_0147624
1498 Ga0495596_0454497
1499 Ga0495631_0494645
1500 Ga0495663_0031763
1501 Ga0495663_0184407
1502 Ga0495598_0000231
1503 Ga0495621_0000597
1504 Ga0495621_0126105
1505 Ga0495633_0010977
1506 Ga0495668_0061694
1507 Ga0495625_0357948
1508 Ga0495625_0688508
1509 Ga0495669_0001490
1510 Ga0495669_0001735
1511 Ga0495669_0007740
1512 Ga0495669_0008561
1513 Ga0495669_0033046
1514 Ga0495669_0057120
1515 Ga0495669_0134812
1516 Ga0495669_0618895
1517 Ga0495670_0003874
1518 Ga0495677_0007384
1519 Ga0495677_0127782
1520 Ga0495677_0423282
1521 Ga0496101_0346170
1522 Ga0496101_0357096
1523 Ga0496101_0764177
1524 Ga0496102_0085784
1525 Ga0496103_0572745
1526 Ga0496106_0227554
1527 Ga0496107_0126915
1528 Ga0496107_0226787
1529 Ga0496107_0447275
1530 Ga0496108_0134469
1531 Ga0496108_0584234
1532 Ga0496108_0946097
1533 Ga0496109_0535831
1534 Ga0496109_0866619
1535 Ga0496110_0098317
1536 Ga0496111_0002214
1537 Ga0496112_0012987
1538 Ga0496112_1507837
1539 Ga0496114_0037140
1540 Ga0501306_070525
1541 Ga0501298_017094
1542 Ga0501036_1211689
1543 Ga0501199_002870
1544 Ga0501201_010753
1545 Ga0501202_006092
1546 Ga0501209_161423
1547 Ga0501217_014299
1548 Ga0501223_003778
1549 Ga0501224_020741
1550 Ga0501233_066903
1551 Ga0501235_023861
1552 Ga0501240_015737
1553 Ga0501247_015539
1554 Ga0501247_081917
1555 Ga0501248_049775
1556 Ga0501249_113333
1557 Ga0501249_167531
1558 Ga0501252_019906
1559 Ga0501257_158499
1560 Ga0501219_027723
1561 Ga0501221_073441
1562 Ga0501229_021547
1563 Ga0501234_104874
1564 Ga0501079_0731804
1565 Ga0501079_1396463
1566 Ga0501263_013207
1567 Ga0501265_111852
1568 Ga0501268_012471
1569 Ga0501268_108120
1570 Ga0501270_019866
1571 Ga0501272_010965
1572 Ga0501273_001053
1573 nmdc:mga06r32_292789_c1
1574 nmdc:mga0a205_250227_c1
1575 nmdc:mga0a205_697786_c1
1576 Ga0495655_0289129
1577 Ga0500658_0000029
1578 Ga0590074_041143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04977

DivIC

Septum formation initiator

29

109

0.93

Map