F480855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 788 | 352 | 1576 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300003659|JGI25404J52841_10014027|JGI25404J52841_100140271 |
| Length | 246 |
| Sequence | MNVHSRAPDRYTALPIAMPAPHLTAICYGPARFIGEAKMAAVWQISGDYFENCNCSVVCPCLVSKSAPLTSKPTEGVCDVALMFHIENGSYEGTALDNLNVALAVHAPGPMADGNWAVAAYIDERANDGQTEALGAIFTGAAGGPMAHFAPLIAKNLGVKKVPISYSVKGKTRSAEIPGILHMSVDPLPTAHPSGEMWANVGHPVSPDKLALAVGAPGNTFNDHGMRWDNSGKNGHYAPIRWSSTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 10 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 107 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 108 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 128 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 129 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 196 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 343 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 346 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 347 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 348 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 349 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 350 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 351 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 352 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0.89 |
| Isolates | 1.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.89 |
| Nodule | 0.63 |
| Rhizoplane | 6.35 |
| Rhizosphere | 90.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10014027 | 3300003659 | Bacteria | 1738 |
| 2 | 2214759110 | 2209111006 | Bacteria | 3000 |
| 3 | ARSoilYngRDRAFT_c00056 | 3300000042 | Bacteria | 18475 |
| 4 | ARcpr5yngRDRAFT_c000087 | 3300000043 | Bacteria | 14971 |
| 5 | ARSoilOldRDRAFT_c000087 | 3300000044 | Bacteria | 17353 |
| 6 | ARCol0oldRDRAFT_c00189 | 3300000045 | Bacteria | 5614 |
| 7 | ARCol0yngRDRAFT_1000076 | 3300000652 | Bacteria | 18618 |
| 8 | JGI24751J29686_10007510 | 3300002459 | Bacteria | 2228 |
| 9 | JGI25404J52841_10003182 | 3300003659 | Bacteria | 3215 |
| 10 | JGI25404J52841_10006590 | 3300003659 | Bacteria | 2437 |
| 11 | JGI25404J52841_10008867 | 3300003659 | Bacteria | 2146 |
| 12 | Ga0065717_1002162 | 3300005276 | Bacteria | 2668 |
| 13 | Ga0065716_1001866 | 3300005277 | Bacteria | 2956 |
| 14 | Ga0065704_10143605 | 3300005289 | Bacteria | 1494 |
| 15 | Ga0065715_10106446 | 3300005293 | Bacteria | 2828 |
| 16 | Ga0065715_10126637 | 3300005293 | Bacteria | 2096 |
| 17 | Ga0065707_10106977 | 3300005295 | Bacteria | 2574 |
| 18 | Ga0065707_10136913 | 3300005295 | Bacteria | 1827 |
| 19 | Ga0070676_10231106 | 3300005328 | Bacteria | 1226 |
| 20 | Ga0070690_100551212 | 3300005330 | Bacteria | 869 |
| 21 | Ga0070666_10129936 | 3300005335 | Bacteria | 1750 |
| 22 | Ga0070680_100030343 | 3300005336 | Bacteria | 4343 |
| 23 | Ga0070680_100047675 | 3300005336 | Bacteria | 3489 |
| 24 | Ga0070682_100026653 | 3300005337 | Bacteria | 3461 |
| 25 | Ga0068868_100402225 | 3300005338 | Bacteria | 1182 |
| 26 | Ga0070660_100023793 | 3300005339 | Bacteria | 4540 |
| 27 | Ga0070689_100012861 | 3300005340 | Bacteria | 6042 |
| 28 | Ga0070691_10178556 | 3300005341 | Bacteria | 1104 |
| 29 | Ga0070687_100368960 | 3300005343 | Bacteria | 932 |
| 30 | Ga0070669_100397382 | 3300005353 | Bacteria | 1127 |
| 31 | Ga0070675_100211972 | 3300005354 | Bacteria | 1684 |
| 32 | Ga0070671_100000745 | 3300005355 | Bacteria | 23338 |
| 33 | Ga0070671_100005255 | 3300005355 | Bacteria | 10320 |
| 34 | Ga0070671_100090152 | 3300005355 | Bacteria | 2567 |
| 35 | Ga0070671_100169898 | 3300005355 | Bacteria | 1844 |
| 36 | Ga0070674_100052015 | 3300005356 | Bacteria | 2824 |
| 37 | Ga0070674_100554656 | 3300005356 | Bacteria | 965 |
| 38 | Ga0070673_100020425 | 3300005364 | Bacteria | 4778 |
| 39 | Ga0070688_100255742 | 3300005365 | Bacteria | 1249 |
| 40 | Ga0070688_100575917 | 3300005365 | Bacteria | 859 |
| 41 | Ga0070659_100241398 | 3300005366 | Bacteria | 1495 |
| 42 | Ga0070667_100733666 | 3300005367 | Bacteria | 915 |
| 43 | Ga0070709_10008513 | 3300005434 | Bacteria | 5636 |
| 44 | Ga0070709_10097818 | 3300005434 | Bacteria | 1949 |
| 45 | Ga0070709_10261352 | 3300005434 | Bacteria | 1251 |
| 46 | Ga0070709_10287636 | 3300005434 | Bacteria | 1197 |
| 47 | Ga0070714_100057034 | 3300005435 | Bacteria | 3342 |
| 48 | Ga0070714_100150865 | 3300005435 | Bacteria | 2094 |
| 49 | Ga0070713_100051794 | 3300005436 | Bacteria | 3396 |
| 50 | Ga0070713_100093571 | 3300005436 | Bacteria | 2590 |
| 51 | Ga0070713_100171766 | 3300005436 | Bacteria | 1942 |
| 52 | Ga0070713_100193288 | 3300005436 | Bacteria | 1835 |
| 53 | Ga0070713_100368157 | 3300005436 | Bacteria | 1336 |
| 54 | Ga0070713_100581745 | 3300005436 | Bacteria | 1062 |
| 55 | Ga0070710_10015607 | 3300005437 | Bacteria | 3848 |
| 56 | Ga0070710_10017856 | 3300005437 | Bacteria | 3641 |
| 57 | Ga0070711_100050490 | 3300005439 | Bacteria | 2853 |
| 58 | Ga0070711_100052580 | 3300005439 | Bacteria | 2803 |
| 59 | Ga0070711_100125194 | 3300005439 | Bacteria | 1907 |
| 60 | Ga0070711_100194004 | 3300005439 | Bacteria | 1563 |
| 61 | Ga0070711_100359264 | 3300005439 | Bacteria | 1173 |
| 62 | Ga0070711_100584031 | 3300005439 | Bacteria | 930 |
| 63 | Ga0070700_100142862 | 3300005441 | Bacteria | 1629 |
| 64 | Ga0070694_100137317 | 3300005444 | Bacteria | 1773 |
| 65 | Ga0070663_100113115 | 3300005455 | Bacteria | 2042 |
| 66 | Ga0070662_100078545 | 3300005457 | Bacteria | 2452 |
| 67 | Ga0070662_100209464 | 3300005457 | Bacteria | 1551 |
| 68 | Ga0070681_10024148 | 3300005458 | Bacteria | 6121 |
| 69 | Ga0070681_10083405 | 3300005458 | Bacteria | 3150 |
| 70 | Ga0070681_10304738 | 3300005458 | Bacteria | 1502 |
| 71 | Ga0068867_100556696 | 3300005459 | Bacteria | 994 |
| 72 | Ga0068867_100678654 | 3300005459 | Bacteria | 907 |
| 73 | Ga0070706_100105465 | 3300005467 | Bacteria | 2622 |
| 74 | Ga0070706_100730708 | 3300005467 | Bacteria | 918 |
| 75 | Ga0070706_101271159 | 3300005467 | Unclassified | 675 |
| 76 | Ga0070698_100201202 | 3300005471 | Bacteria | 1927 |
| 77 | Ga0074259_10685891 | 3300005507 | Bacteria | 924 |
| 78 | Ga0070699_100255695 | 3300005518 | Bacteria | 1566 |
| 79 | Ga0070679_100022095 | 3300005530 | Bacteria | 6215 |
| 80 | Ga0070679_100074040 | 3300005530 | Bacteria | 3396 |
| 81 | Ga0070684_100493408 | 3300005535 | Bacteria | 1134 |
| 82 | Ga0070684_100624942 | 3300005535 | Bacteria | 1002 |
| 83 | Ga0070697_100012814 | 3300005536 | Bacteria | 6568 |
| 84 | Ga0070697_100061990 | 3300005536 | Bacteria | 3051 |
| 85 | Ga0070697_100355631 | 3300005536 | Bacteria | 1265 |
| 86 | Ga0068853_100198105 | 3300005539 | Bacteria | 1827 |
| 87 | Ga0068853_100694785 | 3300005539 | Bacteria | 970 |
| 88 | Ga0068853_100716567 | 3300005539 | Bacteria | 955 |
| 89 | Ga0070672_100097944 | 3300005543 | Bacteria | 2375 |
| 90 | Ga0070672_100158742 | 3300005543 | Bacteria | 1875 |
| 91 | Ga0070672_100654542 | 3300005543 | Bacteria | 918 |
| 92 | Ga0070686_100045571 | 3300005544 | Bacteria | 2763 |
| 93 | Ga0070686_100089518 | 3300005544 | Bacteria | 2056 |
| 94 | Ga0070686_100590509 | 3300005544 | Bacteria | 874 |
| 95 | Ga0070686_100605796 | 3300005544 | Bacteria | 864 |
| 96 | Ga0070695_100077478 | 3300005545 | Bacteria | 2191 |
| 97 | Ga0070693_100242487 | 3300005547 | Bacteria | 1191 |
| 98 | Ga0070693_100334082 | 3300005547 | Bacteria | 1032 |
| 99 | Ga0070665_100041089 | 3300005548 | Bacteria | 4647 |
| 100 | Ga0070665_100235078 | 3300005548 | Bacteria | 1833 |
| 101 | Ga0070665_100944393 | 3300005548 | Bacteria | 875 |
| 102 | Ga0070704_100048584 | 3300005549 | Bacteria | 2971 |
| 103 | Ga0068855_100997918 | 3300005563 | Bacteria | 880 |
| 104 | Ga0070664_100179180 | 3300005564 | Bacteria | 1883 |
| 105 | Ga0070664_100229940 | 3300005564 | Bacteria | 1662 |
| 106 | Ga0070664_100337223 | 3300005564 | Bacteria | 1369 |
| 107 | Ga0068857_100493139 | 3300005577 | Bacteria | 1149 |
| 108 | Ga0068854_100334899 | 3300005578 | Bacteria | 1234 |
| 109 | Ga0068854_100372973 | 3300005578 | Bacteria | 1174 |
| 110 | Ga0068856_100169035 | 3300005614 | Bacteria | 2198 |
| 111 | Ga0068856_100348872 | 3300005614 | Bacteria | 1498 |
| 112 | Ga0068856_100502288 | 3300005614 | Bacteria | 1234 |
| 113 | Ga0068856_101024860 | 3300005614 | Bacteria | 843 |
| 114 | Ga0070702_100346485 | 3300005615 | Bacteria | 1045 |
| 115 | Ga0070702_100532259 | 3300005615 | Bacteria | 869 |
| 116 | Ga0068852_100032612 | 3300005616 | Bacteria | 4315 |
| 117 | Ga0068852_100297126 | 3300005616 | Bacteria | 1562 |
| 118 | Ga0068859_100000579 | 3300005617 | Bacteria | 36523 |
| 119 | Ga0068859_100038156 | 3300005617 | Bacteria | 4820 |
| 120 | Ga0068859_100254391 | 3300005617 | Bacteria | 1847 |
| 121 | Ga0068859_101293982 | 3300005617 | Bacteria | 803 |
| 122 | Ga0068864_100218019 | 3300005618 | Bacteria | 1759 |
| 123 | Ga0068866_10093236 | 3300005718 | Bacteria | 1645 |
| 124 | Ga0068861_100193618 | 3300005719 | Bacteria | 1702 |
| 125 | Ga0068851_10190900 | 3300005834 | Bacteria | 1139 |
| 126 | Ga0068863_100001862 | 3300005841 | Bacteria | 20969 |
| 127 | Ga0068863_100797586 | 3300005841 | Bacteria | 942 |
| 128 | Ga0068858_100002351 | 3300005842 | Bacteria | 19106 |
| 129 | Ga0068858_100176864 | 3300005842 | Bacteria | 2014 |
| 130 | Ga0068860_100203573 | 3300005843 | Bacteria | 1919 |
| 131 | Ga0068860_100357653 | 3300005843 | Bacteria | 1438 |
| 132 | Ga0068862_100085514 | 3300005844 | Bacteria | 2741 |
| 133 | Ga0068862_101025186 | 3300005844 | Bacteria | 817 |
| 134 | Ga0081455_10000354 | 3300005937 | Bacteria | 60535 |
| 135 | Ga0081455_10006105 | 3300005937 | Bacteria | 13014 |
| 136 | Ga0081455_10044470 | 3300005937 | Bacteria | 3873 |
| 137 | Ga0081455_10059433 | 3300005937 | Bacteria | 3228 |
| 138 | Ga0081455_10072968 | 3300005937 | Bacteria | 2839 |
| 139 | Ga0081455_10082946 | 3300005937 | Bacteria | 2621 |
| 140 | Ga0081455_10119511 | 3300005937 | Bacteria | 2078 |
| 141 | Ga0081455_10240248 | 3300005937 | Bacteria | 1331 |
| 142 | Ga0081455_10248572 | 3300005937 | Bacteria | 1302 |
| 143 | Ga0081540_1000055 | 3300005983 | Bacteria | 122642 |
| 144 | Ga0081540_1000075 | 3300005983 | Bacteria | 106804 |
| 145 | Ga0081540_1002306 | 3300005983 | Bacteria | 15659 |
| 146 | Ga0081540_1003603 | 3300005983 | Bacteria | 12154 |
| 147 | Ga0081540_1011401 | 3300005983 | Bacteria | 5942 |
| 148 | Ga0081540_1015638 | 3300005983 | Bacteria | 4794 |
| 149 | Ga0081540_1020205 | 3300005983 | Bacteria | 4016 |
| 150 | Ga0081540_1020840 | 3300005983 | Bacteria | 3927 |
| 151 | Ga0081540_1026165 | 3300005983 | Bacteria | 3337 |
| 152 | Ga0081540_1027929 | 3300005983 | Bacteria | 3183 |
| 153 | Ga0081539_10000209 | 3300005985 | Bacteria | 136637 |
| 154 | Ga0081539_10004192 | 3300005985 | Bacteria | 16296 |
| 155 | Ga0070717_10027109 | 3300006028 | Bacteria | 4576 |
| 156 | Ga0070717_10159098 | 3300006028 | Bacteria | 1959 |
| 157 | Ga0070717_10164544 | 3300006028 | Bacteria | 1926 |
| 158 | Ga0070717_10181382 | 3300006028 | Bacteria | 1835 |
| 159 | Ga0070717_10263038 | 3300006028 | Bacteria | 1527 |
| 160 | Ga0075365_10068220 | 3300006038 | Bacteria | 2389 |
| 161 | Ga0075365_10173304 | 3300006038 | Bacteria | 1506 |
| 162 | Ga0070715_10211779 | 3300006163 | Bacteria | 991 |
| 163 | Ga0070716_100099163 | 3300006173 | Bacteria | 1782 |
| 164 | Ga0070716_100111737 | 3300006173 | Bacteria | 1695 |
| 165 | Ga0070716_100613081 | 3300006173 | Bacteria | 820 |
| 166 | Ga0070712_100012839 | 3300006175 | Bacteria | 5333 |
| 167 | Ga0070712_100025006 | 3300006175 | Bacteria | 3964 |
| 168 | Ga0070712_100028936 | 3300006175 | Bacteria | 3711 |
| 169 | Ga0070712_100117691 | 3300006175 | Bacteria | 1994 |
| 170 | Ga0070712_100215467 | 3300006175 | Bacteria | 1517 |
| 171 | Ga0070712_100498484 | 3300006175 | Bacteria | 1020 |
| 172 | Ga0070712_100579418 | 3300006175 | Bacteria | 948 |
| 173 | Ga0070712_100792552 | 3300006175 | Bacteria | 813 |
| 174 | Ga0097621_100676022 | 3300006237 | Bacteria | 949 |
| 175 | Ga0097621_100713919 | 3300006237 | Bacteria | 924 |
| 176 | Ga0068871_100481928 | 3300006358 | Bacteria | 1116 |
| 177 | Ga0075428_100075095 | 3300006844 | Bacteria | 3692 |
| 178 | Ga0075428_100560431 | 3300006844 | Bacteria | 1221 |
| 179 | Ga0075433_10083334 | 3300006852 | Bacteria | 2822 |
| 180 | Ga0075433_10222728 | 3300006852 | Bacteria | 1675 |
| 181 | Ga0075434_100039041 | 3300006871 | Bacteria | 4704 |
| 182 | Ga0075434_100123877 | 3300006871 | Bacteria | 2601 |
| 183 | Ga0075434_100342542 | 3300006871 | Bacteria | 1516 |
| 184 | Ga0075429_100011921 | 3300006880 | Bacteria | 7538 |
| 185 | Ga0097620_100000579 | 3300006931 | Bacteria | 36523 |
| 186 | Ga0097620_100038156 | 3300006931 | Bacteria | 4820 |
| 187 | Ga0097620_100254372 | 3300006931 | Bacteria | 1847 |
| 188 | Ga0097620_101293759 | 3300006931 | Bacteria | 803 |
| 189 | Ga0075435_100446992 | 3300007076 | Bacteria | 1114 |
| 190 | Ga0099794_10006930 | 3300007265 | Bacteria | 4623 |
| 191 | Ga0105250_10083473 | 3300009092 | Bacteria | 1296 |
| 192 | Ga0105240_10098984 | 3300009093 | Bacteria | 3550 |
| 193 | Ga0105240_10144979 | 3300009093 | Bacteria | 2835 |
| 194 | Ga0105240_10527731 | 3300009093 | Bacteria | 1309 |
| 195 | Ga0111539_10001365 | 3300009094 | Bacteria | 32515 |
| 196 | Ga0111539_10609924 | 3300009094 | Bacteria | 1271 |
| 197 | Ga0105245_10056904 | 3300009098 | Bacteria | 3516 |
| 198 | Ga0105247_10001257 | 3300009101 | Bacteria | 18792 |
| 199 | Ga0105247_10010609 | 3300009101 | Bacteria | 5564 |
| 200 | Ga0105247_10035823 | 3300009101 | Bacteria | 3026 |
| 201 | Ga0114129_10006147 | 3300009147 | Bacteria | 17031 |
| 202 | Ga0114129_10478663 | 3300009147 | Bacteria | 1629 |
| 203 | Ga0114129_10597448 | 3300009147 | Bacteria | 1430 |
| 204 | Ga0105243_10042966 | 3300009148 | Bacteria | 3541 |
| 205 | Ga0105243_10062475 | 3300009148 | Bacteria | 2982 |
| 206 | Ga0105243_10101758 | 3300009148 | Bacteria | 2386 |
| 207 | Ga0105241_10103593 | 3300009174 | Bacteria | 2266 |
| 208 | Ga0105241_10270902 | 3300009174 | Bacteria | 1446 |
| 209 | Ga0105241_10299661 | 3300009174 | Bacteria | 1379 |
| 210 | Ga0105242_10102413 | 3300009176 | Bacteria | 2428 |
| 211 | Ga0105248_10039393 | 3300009177 | Bacteria | 5292 |
| 212 | Ga0105248_10080677 | 3300009177 | Bacteria | 3657 |
| 213 | Ga0105248_10360162 | 3300009177 | Bacteria | 1637 |
| 214 | Ga0105237_10169403 | 3300009545 | Bacteria | 2184 |
| 215 | Ga0105237_10277533 | 3300009545 | Bacteria | 1678 |
| 216 | Ga0105238_10029067 | 3300009551 | Bacteria | 5631 |
| 217 | Ga0105238_11260141 | 3300009551 | Unclassified | 765 |
| 218 | Ga0105249_10084671 | 3300009553 | Bacteria | 2953 |
| 219 | Ga0105249_10509264 | 3300009553 | Bacteria | 1250 |
| 220 | Ga0105249_10812959 | 3300009553 | Bacteria | 999 |
| 221 | Ga0099796_10073672 | 3300010159 | Bacteria | 1238 |
| 222 | Ga0105239_10032427 | 3300010375 | Bacteria | 5740 |
| 223 | Ga0105239_10142809 | 3300010375 | Bacteria | 2669 |
| 224 | Ga0105239_11194281 | 3300010375 | Unclassified | 876 |
| 225 | Ga0105246_10085263 | 3300011119 | Bacteria | 2262 |
| 226 | Ga0105246_10162775 | 3300011119 | Bacteria | 1701 |
| 227 | Ga0105246_10398592 | 3300011119 | Bacteria | 1142 |
| 228 | Ga0105246_10471581 | 3300011119 | Bacteria | 1060 |
| 229 | Ga0157321_1000258 | 3300012487 | Bacteria | 2445 |
| 230 | Ga0157335_1001024 | 3300012492 | Bacteria | 1437 |
| 231 | Ga0157326_1015693 | 3300012513 | Bacteria | 892 |
| 232 | Ga0157370_10015231 | 3300013104 | Bacteria | 7828 |
| 233 | Ga0157370_10222469 | 3300013104 | Bacteria | 1748 |
| 234 | Ga0157369_10815653 | 3300013105 | Bacteria | 958 |
| 235 | Ga0157369_10957912 | 3300013105 | Bacteria | 877 |
| 236 | Ga0157378_10477724 | 3300013297 | Bacteria | 1241 |
| 237 | Ga0163162_10121070 | 3300013306 | Bacteria | 2721 |
| 238 | Ga0163162_10466678 | 3300013306 | Bacteria | 1394 |
| 239 | Ga0163162_10521536 | 3300013306 | Bacteria | 1318 |
| 240 | Ga0163162_11457725 | 3300013306 | Bacteria | 779 |
| 241 | Ga0157372_10340657 | 3300013307 | Bacteria | 1746 |
| 242 | Ga0157372_10752903 | 3300013307 | Bacteria | 1133 |
| 243 | Ga0157375_10057270 | 3300013308 | Bacteria | 3851 |
| 244 | Ga0157375_10075075 | 3300013308 | Bacteria | 3404 |
| 245 | Ga0157375_10989970 | 3300013308 | Bacteria | 981 |
| 246 | Ga0163163_10022041 | 3300014325 | Bacteria | 6023 |
| 247 | Ga0182008_10014572 | 3300014497 | Bacteria | 4113 |
| 248 | Ga0157377_10060047 | 3300014745 | Bacteria | 2170 |
| 249 | Ga0157377_10391761 | 3300014745 | Bacteria | 944 |
| 250 | Ga0157379_10336707 | 3300014968 | Bacteria | 1379 |
| 251 | Ga0157379_10611825 | 3300014968 | Bacteria | 1018 |
| 252 | Ga0157379_10686393 | 3300014968 | Bacteria | 960 |
| 253 | Ga0157379_10767490 | 3300014968 | Bacteria | 908 |
| 254 | Ga0157376_10498795 | 3300014969 | Bacteria | 1196 |
| 255 | Ga0157376_10523695 | 3300014969 | Bacteria | 1169 |
| 256 | Ga0182007_10018951 | 3300015262 | Unclassified | 2483 |
| 257 | Ga0163161_10042292 | 3300017792 | Bacteria | 3277 |
| 258 | Ga0163161_10382872 | 3300017792 | Bacteria | 1125 |
| 259 | Ga0197907_10512701 | 3300020069 | Unclassified | 869 |
| 260 | Ga0206356_11356092 | 3300020070 | Bacteria | 824 |
| 261 | Ga0206351_10203003 | 3300020077 | Unclassified | 792 |
| 262 | Ga0206354_11401222 | 3300020081 | Bacteria | 767 |
| 263 | Ga0206353_10146507 | 3300020082 | Unclassified | 784 |
| 264 | Ga0213873_10022209 | 3300021358 | Bacteria | 1501 |
| 265 | Ga0213874_10045108 | 3300021377 | Bacteria | 1334 |
| 266 | Ga0224712_10290964 | 3300022467 | Bacteria | 762 |
| 267 | Ga0224712_10353777 | 3300022467 | Bacteria | 694 |
| 268 | Ga0209148_1008961 | 3300025254 | Bacteria | 1980 |
| 269 | Ga0209051_1001604 | 3300025303 | Bacteria | 18452 |
| 270 | Ga0207692_10023590 | 3300025898 | Bacteria | 2847 |
| 271 | Ga0207692_10038188 | 3300025898 | Bacteria | 2354 |
| 272 | Ga0207692_10065868 | 3300025898 | Bacteria | 1892 |
| 273 | Ga0207692_10101364 | 3300025898 | Bacteria | 1581 |
| 274 | Ga0207692_10108267 | 3300025898 | Bacteria | 1537 |
| 275 | Ga0207692_10283650 | 3300025898 | Unclassified | 1003 |
| 276 | Ga0207642_10125251 | 3300025899 | Bacteria | 1332 |
| 277 | Ga0207710_10000321 | 3300025900 | Bacteria | 36685 |
| 278 | Ga0207688_10086444 | 3300025901 | Bacteria | 1797 |
| 279 | Ga0207688_10336252 | 3300025901 | Bacteria | 928 |
| 280 | Ga0207680_10037074 | 3300025903 | Bacteria | 2813 |
| 281 | Ga0207647_10231429 | 3300025904 | Bacteria | 1063 |
| 282 | Ga0207685_10115378 | 3300025905 | Bacteria | 1171 |
| 283 | Ga0207699_10462742 | 3300025906 | Bacteria | 911 |
| 284 | Ga0207699_10486897 | 3300025906 | Bacteria | 889 |
| 285 | Ga0207705_10463924 | 3300025909 | Bacteria | 983 |
| 286 | Ga0207684_10088723 | 3300025910 | Bacteria | 2635 |
| 287 | Ga0207684_10492217 | 3300025910 | Bacteria | 1051 |
| 288 | Ga0207654_10056710 | 3300025911 | Bacteria | 2273 |
| 289 | Ga0207707_10000754 | 3300025912 | Bacteria | 31878 |
| 290 | Ga0207707_10036412 | 3300025912 | Bacteria | 4302 |
| 291 | Ga0207707_10157210 | 3300025912 | Bacteria | 1988 |
| 292 | Ga0207695_10100066 | 3300025913 | Bacteria | 2895 |
| 293 | Ga0207695_10154608 | 3300025913 | Bacteria | 2229 |
| 294 | Ga0207695_10278000 | 3300025913 | Bacteria | 1568 |
| 295 | Ga0207671_10368916 | 3300025914 | Bacteria | 1140 |
| 296 | Ga0207671_10516084 | 3300025914 | Bacteria | 953 |
| 297 | Ga0207693_10001869 | 3300025915 | Bacteria | 18434 |
| 298 | Ga0207693_10018489 | 3300025915 | Bacteria | 5551 |
| 299 | Ga0207693_10040514 | 3300025915 | Bacteria | 3669 |
| 300 | Ga0207693_10045432 | 3300025915 | Bacteria | 3451 |
| 301 | Ga0207693_10100752 | 3300025915 | Bacteria | 2265 |
| 302 | Ga0207693_10252189 | 3300025915 | Bacteria | 1385 |
| 303 | Ga0207693_10426109 | 3300025915 | Bacteria | 1037 |
| 304 | Ga0207693_10642886 | 3300025915 | Bacteria | 824 |
| 305 | Ga0207663_10026941 | 3300025916 | Bacteria | 3343 |
| 306 | Ga0207663_10034683 | 3300025916 | Bacteria | 3020 |
| 307 | Ga0207663_10105511 | 3300025916 | Bacteria | 1902 |
| 308 | Ga0207663_10341302 | 3300025916 | Bacteria | 1131 |
| 309 | Ga0207660_10080267 | 3300025917 | Bacteria | 2395 |
| 310 | Ga0207660_10567490 | 3300025917 | Bacteria | 923 |
| 311 | Ga0207662_10193743 | 3300025918 | Bacteria | 1313 |
| 312 | Ga0207657_10101835 | 3300025919 | Bacteria | 2383 |
| 313 | Ga0207649_10557998 | 3300025920 | Bacteria | 877 |
| 314 | Ga0207652_10037202 | 3300025921 | Bacteria | 4119 |
| 315 | Ga0207681_10268629 | 3300025923 | Bacteria | 1338 |
| 316 | Ga0207681_10500128 | 3300025923 | Bacteria | 995 |
| 317 | Ga0207694_10018204 | 3300025924 | Bacteria | 5311 |
| 318 | Ga0207650_10010743 | 3300025925 | Bacteria | 6285 |
| 319 | Ga0207659_10004652 | 3300025926 | Bacteria | 8311 |
| 320 | Ga0207687_10075132 | 3300025927 | Bacteria | 2424 |
| 321 | Ga0207687_10153830 | 3300025927 | Bacteria | 1758 |
| 322 | Ga0207700_10011038 | 3300025928 | Bacteria | 5739 |
| 323 | Ga0207700_10043491 | 3300025928 | Bacteria | 3300 |
| 324 | Ga0207700_10371104 | 3300025928 | Bacteria | 1249 |
| 325 | Ga0207700_10409601 | 3300025928 | Bacteria | 1189 |
| 326 | Ga0207700_10677268 | 3300025928 | Bacteria | 920 |
| 327 | Ga0207664_10044924 | 3300025929 | Bacteria | 3462 |
| 328 | Ga0207664_10075674 | 3300025929 | Bacteria | 2722 |
| 329 | Ga0207664_10113757 | 3300025929 | Bacteria | 2254 |
| 330 | Ga0207664_10179154 | 3300025929 | Bacteria | 1819 |
| 331 | Ga0207664_10470945 | 3300025929 | Bacteria | 1123 |
| 332 | Ga0207664_10545256 | 3300025929 | Bacteria | 1040 |
| 333 | Ga0207664_10580221 | 3300025929 | Bacteria | 1007 |
| 334 | Ga0207664_10871105 | 3300025929 | Bacteria | 809 |
| 335 | Ga0207664_10901050 | 3300025929 | Bacteria | 794 |
| 336 | Ga0207644_10004666 | 3300025931 | Bacteria | 8906 |
| 337 | Ga0207644_10009370 | 3300025931 | Bacteria | 6431 |
| 338 | Ga0207644_10307976 | 3300025931 | Bacteria | 1278 |
| 339 | Ga0207706_10067446 | 3300025933 | Bacteria | 3147 |
| 340 | Ga0207706_10406582 | 3300025933 | Bacteria | 1180 |
| 341 | Ga0207686_10170956 | 3300025934 | Bacteria | 1532 |
| 342 | Ga0207709_10132782 | 3300025935 | Bacteria | 1699 |
| 343 | Ga0207709_10180470 | 3300025935 | Bacteria | 1490 |
| 344 | Ga0207709_10296887 | 3300025935 | Bacteria | 1200 |
| 345 | Ga0207670_10247962 | 3300025936 | Bacteria | 1375 |
| 346 | Ga0207669_10941357 | 3300025937 | Bacteria | 723 |
| 347 | Ga0207665_10091379 | 3300025939 | Bacteria | 2110 |
| 348 | Ga0207665_10153945 | 3300025939 | Bacteria | 1649 |
| 349 | Ga0207665_10260810 | 3300025939 | Bacteria | 1284 |
| 350 | Ga0207691_10126618 | 3300025940 | Bacteria | 2260 |
| 351 | Ga0207691_10160693 | 3300025940 | Bacteria | 1971 |
| 352 | Ga0207691_10412210 | 3300025940 | Bacteria | 1152 |
| 353 | Ga0207711_10374337 | 3300025941 | Bacteria | 1321 |
| 354 | Ga0207711_10543526 | 3300025941 | Bacteria | 1084 |
| 355 | Ga0207661_10654240 | 3300025944 | Bacteria | 966 |
| 356 | Ga0207679_10061391 | 3300025945 | Bacteria | 2798 |
| 357 | Ga0207679_10635792 | 3300025945 | Bacteria | 964 |
| 358 | Ga0207667_10374241 | 3300025949 | Bacteria | 1451 |
| 359 | Ga0207667_11304521 | 3300025949 | Bacteria | 702 |
| 360 | Ga0207651_10012715 | 3300025960 | Bacteria | 4778 |
| 361 | Ga0207712_10085297 | 3300025961 | Bacteria | 2310 |
| 362 | Ga0207668_10259563 | 3300025972 | Bacteria | 1415 |
| 363 | Ga0207640_10441816 | 3300025981 | Bacteria | 1070 |
| 364 | Ga0207640_10654688 | 3300025981 | Bacteria | 895 |
| 365 | Ga0207658_10008550 | 3300025986 | Bacteria | 6963 |
| 366 | Ga0207658_10205649 | 3300025986 | Bacteria | 1647 |
| 367 | Ga0207658_10632175 | 3300025986 | Bacteria | 964 |
| 368 | Ga0207658_10703269 | 3300025986 | Bacteria | 913 |
| 369 | Ga0207677_10568253 | 3300026023 | Bacteria | 991 |
| 370 | Ga0207703_10005117 | 3300026035 | Bacteria | 10610 |
| 371 | Ga0207703_10457311 | 3300026035 | Bacteria | 1193 |
| 372 | Ga0207639_10174451 | 3300026041 | Bacteria | 1824 |
| 373 | Ga0207639_10507643 | 3300026041 | Bacteria | 1102 |
| 374 | Ga0207639_11072726 | 3300026041 | Bacteria | 755 |
| 375 | Ga0207678_10067104 | 3300026067 | Bacteria | 3079 |
| 376 | Ga0207678_10155277 | 3300026067 | Bacteria | 1954 |
| 377 | Ga0207708_10374517 | 3300026075 | Bacteria | 1173 |
| 378 | Ga0207702_10059159 | 3300026078 | Bacteria | 3264 |
| 379 | Ga0207702_10081019 | 3300026078 | Bacteria | 2818 |
| 380 | Ga0207702_11032571 | 3300026078 | Bacteria | 816 |
| 381 | Ga0207641_10027983 | 3300026088 | Bacteria | 4656 |
| 382 | Ga0207648_10083146 | 3300026089 | Bacteria | 2792 |
| 383 | Ga0207676_10258314 | 3300026095 | Bacteria | 1571 |
| 384 | Ga0207674_10072530 | 3300026116 | Bacteria | 3459 |
| 385 | Ga0207675_100050193 | 3300026118 | Bacteria | 3893 |
| 386 | Ga0207675_100107815 | 3300026118 | Bacteria | 2627 |
| 387 | Ga0207683_10447825 | 3300026121 | Bacteria | 1190 |
| 388 | Ga0207683_10620120 | 3300026121 | Bacteria | 1002 |
| 389 | Ga0207698_10218568 | 3300026142 | Bacteria | 1720 |
| 390 | Ga0207698_10932563 | 3300026142 | Bacteria | 877 |
| 391 | Ga0209588_1015403 | 3300027671 | Bacteria | 2351 |
| 392 | Ga0207428_10052816 | 3300027907 | Bacteria | 3243 |
| 393 | Ga0207428_10513537 | 3300027907 | Bacteria | 869 |
| 394 | Ga0268266_10108350 | 3300028379 | Bacteria | 2458 |
| 395 | Ga0268266_11087466 | 3300028379 | Bacteria | 774 |
| 396 | Ga0268265_10516421 | 3300028380 | Bacteria | 1128 |
| 397 | Ga0268264_10148467 | 3300028381 | Bacteria | 2099 |
| 398 | Ga0307509_10022472 | 3300031507 | Bacteria | 7108 |
| 399 | Ga0307509_10083352 | 3300031507 | Bacteria | 3296 |
| 400 | Ga0307509_10120381 | 3300031507 | Bacteria | 2604 |
| 401 | Ga0265313_10001357 | 3300031595 | Bacteria | 23065 |
| 402 | Ga0373930_0003209 | 3300034816 | Bacteria | 2584 |
| 403 | Ga0373948_0000835 | 3300034817 | Bacteria | 4076 |
| 404 | Ga0373950_0000174 | 3300034818 | Bacteria | 9151 |
| 405 | Ga0373959_0003847 | 3300034820 | Bacteria | 2403 |
| 406 | Ga0373938_0000152 | 3300034957 | Bacteria | 10044 |
| 407 | Ga0373926_0045504 | 3300035083 | Bacteria | 1573 |
| 408 | Ga0373926_0077200 | 3300035083 | Bacteria | 1229 |
| 409 | Ga0373928_0001004 | 3300035084 | Bacteria | 5532 |
| 410 | Ga0373929_0000088 | 3300035085 | Bacteria | 15260 |
| 411 | Ga0373940_0000067 | 3300035088 | Bacteria | 11804 |
| 412 | Ga0373944_0002667 | 3300035089 | Bacteria | 4546 |
| 413 | Ga0373944_0045249 | 3300035089 | Bacteria | 1373 |
| 414 | Ga0373949_0000825 | 3300035090 | Bacteria | 9872 |
| 415 | Ga0373949_0051539 | 3300035090 | Bacteria | 1038 |
| 416 | Ga0373951_0000361 | 3300035091 | Bacteria | 13672 |
| 417 | Ga0373952_0000776 | 3300035092 | Bacteria | 5745 |
| 418 | Ga0373952_0116121 | 3300035092 | Bacteria | 721 |
| 419 | Ga0373923_0349205 | 3300035111 | Bacteria | 706 |
| 420 | Ga0373932_0000315 | 3300035112 | Bacteria | 14731 |
| 421 | Ga0373932_0148679 | 3300035112 | Bacteria | 802 |
| 422 | Ga0373936_0005700 | 3300035113 | Bacteria | 4699 |
| 423 | Ga0373936_0173973 | 3300035113 | Bacteria | 942 |
| 424 | Ga0373939_0000202 | 3300035114 | Bacteria | 16524 |
| 425 | Ga0373939_0155010 | 3300035114 | Bacteria | 837 |
| 426 | Ga0373941_0000272 | 3300035115 | Bacteria | 9963 |
| 427 | Ga0373945_0020386 | 3300035116 | Bacteria | 2269 |
| 428 | Ga0373945_0034457 | 3300035116 | Bacteria | 1804 |
| 429 | Ga0373945_0051602 | 3300035116 | Bacteria | 1513 |
| 430 | Ga0373953_0009905 | 3300035117 | Bacteria | 3301 |
| 431 | Ga0373953_0069698 | 3300035117 | Bacteria | 1449 |
| 432 | Ga0373954_0010290 | 3300035118 | Bacteria | 4126 |
| 433 | Ga0373956_0098647 | 3300035119 | Bacteria | 1353 |
| 434 | Ga0373956_0189276 | 3300035119 | Bacteria | 974 |
| 435 | Ga0373957_0069203 | 3300035120 | Bacteria | 1378 |
| 436 | Ga0373957_0091428 | 3300035120 | Bacteria | 1210 |
| 437 | Ga0373960_0001079 | 3300035121 | Bacteria | 5889 |
| 438 | Ga0373943_0002252 | 3300035170 | Bacteria | 8763 |
| 439 | Ga0373943_0011264 | 3300035170 | Bacteria | 4023 |
| 440 | Ga0373946_0002522 | 3300035171 | Bacteria | 6466 |
| 441 | Ga0373946_0007987 | 3300035171 | Bacteria | 3887 |
| 442 | Ga0373946_0023104 | 3300035171 | Bacteria | 2427 |
| 443 | Ga0373946_0028211 | 3300035171 | Bacteria | 2225 |
| 444 | Ga0373955_0060010 | 3300035172 | Bacteria | 2096 |
| 445 | Ga0373955_0237150 | 3300035172 | Unclassified | 1092 |
| 446 | Ga0373942_0022419 | 3300035207 | Bacteria | 1602 |
| 447 | Ga0373961_0001117 | 3300035241 | Bacteria | 8464 |
| 448 | Ga0373962_0000443 | 3300035242 | Bacteria | 9060 |
| 449 | Ga0373962_0019599 | 3300035242 | Bacteria | 1771 |
| 450 | Ga0373924_0100439 | 3300035410 | Bacteria | 1244 |
| 451 | Ga0373924_0183178 | 3300035410 | Bacteria | 922 |
| 452 | Ga0373931_0038720 | 3300035691 | Bacteria | 2495 |
| 453 | Ga0373931_0047305 | 3300035691 | Bacteria | 2277 |
| 454 | Ga0373931_0050173 | 3300035691 | Bacteria | 2219 |
| 455 | Ga0373931_0203054 | 3300035691 | Bacteria | 1185 |
| 456 | Ga0373935_0000844 | 3300035692 | Bacteria | 16529 |
| 457 | Ga0373935_0010594 | 3300035692 | Bacteria | 5532 |
| 458 | Ga0373935_0014264 | 3300035692 | Bacteria | 4796 |
| 459 | Ga0373935_0019830 | 3300035692 | Bacteria | 4104 |
| 460 | Ga0373935_0035725 | 3300035692 | Bacteria | 3102 |
| 461 | Ga0373927_0003240 | 3300035695 | Bacteria | 11709 |
| 462 | Ga0373927_0004432 | 3300035695 | Bacteria | 9836 |
| 463 | Ga0373927_0007662 | 3300035695 | Bacteria | 7306 |
| 464 | Ga0373927_0015407 | 3300035695 | Bacteria | 5052 |
| 465 | Ga0373927_0043231 | 3300035695 | Bacteria | 2918 |
| 466 | Ga0373927_0043279 | 3300035695 | Bacteria | 2915 |
| 467 | Ga0373927_0044784 | 3300035695 | Bacteria | 2862 |
| 468 | Ga0373927_0211001 | 3300035695 | Bacteria | 1275 |
| 469 | Ga0373933_0011508 | 3300035724 | Bacteria | 4881 |
| 470 | Ga0373933_0159355 | 3300035724 | Bacteria | 1432 |
| 471 | Ga0373947_0000642 | 3300035725 | Bacteria | 20669 |
| 472 | Ga0373947_0006874 | 3300035725 | Bacteria | 6597 |
| 473 | Ga0373947_0018867 | 3300035725 | Bacteria | 3973 |
| 474 | Ga0373947_0053613 | 3300035725 | Bacteria | 2432 |
| 475 | Ga0373947_0305604 | 3300035725 | Bacteria | 1061 |
| 476 | Ga0373937_0003851 | 3300036401 | Bacteria | 12686 |
| 477 | Ga0373937_0020098 | 3300036401 | Bacteria | 5984 |
| 478 | Ga0373937_0054905 | 3300036401 | Bacteria | 3656 |
| 479 | Ga0373937_0170175 | 3300036401 | Bacteria | 2044 |
| 480 | Ga0373937_0353695 | 3300036401 | Bacteria | 1392 |
| 481 | Ga0373937_0495660 | 3300036401 | Bacteria | 1160 |
| 482 | Ga0373937_0590492 | 3300036401 | Bacteria | 1054 |
| 483 | Ga0373925_0000810 | 3300037068 | Bacteria | 28845 |
| 484 | Ga0373925_0005823 | 3300037068 | Bacteria | 9148 |
| 485 | Ga0373925_0014589 | 3300037068 | Bacteria | 5678 |
| 486 | Ga0373925_0026771 | 3300037068 | Bacteria | 4221 |
| 487 | Ga0373925_0027980 | 3300037068 | Bacteria | 4128 |
| 488 | Ga0373925_0042607 | 3300037068 | Bacteria | 3367 |
| 489 | Ga0373925_0163907 | 3300037068 | Bacteria | 1752 |
| 490 | Ga0373925_0204456 | 3300037068 | Bacteria | 1571 |
| 491 | Ga0373925_0218729 | 3300037068 | Bacteria | 1520 |
| 492 | Ga0373925_0301704 | 3300037068 | Bacteria | 1293 |
| 493 | Ga0373925_0367744 | 3300037068 | Bacteria | 1170 |
| 494 | Ga0373925_0399314 | 3300037068 | Bacteria | 1121 |
| 495 | Ga0373925_0801607 | 3300037068 | Bacteria | 776 |
| 496 | Ga0395899_0012745 | 3300037312 | Bacteria | 6442 |
| 497 | Ga0395900_0083944 | 3300037418 | Bacteria | 3272 |
| 498 | Ga0395900_0604500 | 3300037418 | Bacteria | 1037 |
| 499 | Ga0395905_0026470 | 3300037471 | Bacteria | 5467 |
| 500 | Ga0395901_0001801 | 3300038443 | Bacteria | 22128 |
| 501 | Ga0395901_0084011 | 3300038443 | Bacteria | 3328 |
| 502 | Ga0395901_0219603 | 3300038443 | Bacteria | 1987 |
| 503 | Ga0436365_1094394 | 3300039437 | Bacteria | 3179 |
| 504 | Ga0436365_1294223 | 3300039437 | Bacteria | 1640 |
| 505 | Ga0436363_0092417 | 3300039450 | Bacteria | 2186 |
| 506 | Ga0436363_0950219 | 3300039450 | Bacteria | 1017 |
| 507 | Ga0436363_1669531 | 3300039450 | Bacteria | 4579 |
| 508 | Ga0466965_0268823 | 3300044683 | Bacteria | 918 |
| 509 | Ga0453684_0094755 | 3300044712 | Bacteria | 3672 |
| 510 | Ga0466959_0569759 | 3300045049 | Bacteria | 763 |
| 511 | Ga0451576_0090531 | 3300045051 | Bacteria | 3182 |
| 512 | Ga0495592_0037156 | 3300046454 | Bacteria | 3667 |
| 513 | Ga0495592_0049028 | 3300046454 | Bacteria | 3140 |
| 514 | Ga0495592_0179425 | 3300046454 | Bacteria | 1443 |
| 515 | Ga0495592_0360360 | 3300046454 | Bacteria | 930 |
| 516 | Ga0495603_0002414 | 3300046455 | Bacteria | 10981 |
| 517 | Ga0495603_0159737 | 3300046455 | Bacteria | 1307 |
| 518 | Ga0495629_0000117 | 3300046459 | Bacteria | 70838 |
| 519 | Ga0495629_0009945 | 3300046459 | Bacteria | 6942 |
| 520 | Ga0495629_0120581 | 3300046459 | Bacteria | 1827 |
| 521 | Ga0495629_0167146 | 3300046459 | Bacteria | 1527 |
| 522 | Ga0495629_0334267 | 3300046459 | Bacteria | 1035 |
| 523 | Ga0495638_0062504 | 3300046460 | Bacteria | 2298 |
| 524 | Ga0495641_0002849 | 3300046461 | Bacteria | 13380 |
| 525 | Ga0495641_0012671 | 3300046461 | Bacteria | 4696 |
| 526 | Ga0495651_0092642 | 3300046462 | Bacteria | 2263 |
| 527 | Ga0495651_0093215 | 3300046462 | Unclassified | 2255 |
| 528 | Ga0495651_0350980 | 3300046462 | Bacteria | 975 |
| 529 | Ga0495653_0009694 | 3300046463 | Bacteria | 7875 |
| 530 | Ga0495653_0016695 | 3300046463 | Bacteria | 5975 |
| 531 | Ga0495653_0147043 | 3300046463 | Bacteria | 1650 |
| 532 | Ga0495580_0003260 | 3300046472 | Bacteria | 13879 |
| 533 | Ga0495580_0013631 | 3300046472 | Bacteria | 6199 |
| 534 | Ga0495582_0000280 | 3300046473 | Bacteria | 28556 |
| 535 | Ga0495582_0055587 | 3300046473 | Bacteria | 2182 |
| 536 | Ga0495582_0083948 | 3300046473 | Bacteria | 1770 |
| 537 | Ga0495605_0058150 | 3300046474 | Bacteria | 1859 |
| 538 | Ga0495639_0000751 | 3300046475 | Bacteria | 14785 |
| 539 | Ga0495639_0002516 | 3300046475 | Bacteria | 8001 |
| 540 | Ga0495639_0006386 | 3300046475 | Bacteria | 5069 |
| 541 | Ga0495639_0068160 | 3300046475 | Unclassified | 1640 |
| 542 | Ga0495639_0146066 | 3300046475 | Bacteria | 1139 |
| 543 | Ga0495639_0224950 | 3300046475 | Bacteria | 923 |
| 544 | Ga0495662_0000078 | 3300046476 | Bacteria | 34824 |
| 545 | Ga0495662_0009678 | 3300046476 | Bacteria | 4727 |
| 546 | Ga0495662_0057325 | 3300046476 | Bacteria | 1881 |
| 547 | Ga0495662_0213356 | 3300046476 | Bacteria | 952 |
| 548 | Ga0495664_0004815 | 3300046477 | Bacteria | 7379 |
| 549 | Ga0495664_0145132 | 3300046477 | Bacteria | 1439 |
| 550 | Ga0495584_0166292 | 3300046491 | Bacteria | 1121 |
| 551 | Ga0495585_0239951 | 3300046492 | Bacteria | 908 |
| 552 | Ga0495594_0043896 | 3300046499 | Bacteria | 2451 |
| 553 | Ga0495594_0062693 | 3300046499 | Bacteria | 2059 |
| 554 | Ga0495606_0096242 | 3300046507 | Bacteria | 1811 |
| 555 | Ga0495608_0147409 | 3300046511 | Bacteria | 1501 |
| 556 | Ga0495608_0181406 | 3300046511 | Bacteria | 1332 |
| 557 | Ga0495616_0046573 | 3300046513 | Bacteria | 2188 |
| 558 | Ga0495618_0028886 | 3300046514 | Bacteria | 3457 |
| 559 | Ga0495620_0123436 | 3300046515 | Bacteria | 1019 |
| 560 | Ga0495628_0080746 | 3300046516 | Bacteria | 2527 |
| 561 | Ga0495628_0098228 | 3300046516 | Unclassified | 2262 |
| 562 | Ga0495628_0152709 | 3300046516 | Bacteria | 1758 |
| 563 | Ga0495628_0194701 | 3300046516 | Bacteria | 1530 |
| 564 | Ga0495628_0409143 | 3300046516 | Bacteria | 990 |
| 565 | Ga0495630_0005075 | 3300046517 | Bacteria | 9258 |
| 566 | Ga0495630_0032801 | 3300046517 | Bacteria | 3871 |
| 567 | Ga0495630_0227051 | 3300046517 | Bacteria | 1426 |
| 568 | Ga0495632_0053973 | 3300046519 | Bacteria | 1971 |
| 569 | Ga0495644_0023701 | 3300046523 | Bacteria | 2336 |
| 570 | Ga0495666_0165108 | 3300046526 | Bacteria | 1026 |
| 571 | Ga0495642_0176944 | 3300046528 | Bacteria | 928 |
| 572 | Ga0495652_0003511 | 3300046529 | Bacteria | 15422 |
| 573 | Ga0495652_0008078 | 3300046529 | Bacteria | 9634 |
| 574 | Ga0495652_0033403 | 3300046529 | Bacteria | 4491 |
| 575 | Ga0495652_0054500 | 3300046529 | Bacteria | 3405 |
| 576 | Ga0495652_0108940 | 3300046529 | Bacteria | 2231 |
| 577 | Ga0495652_0183988 | 3300046529 | Bacteria | 1601 |
| 578 | Ga0495652_0201521 | 3300046529 | Bacteria | 1510 |
| 579 | Ga0495665_0000296 | 3300046531 | Bacteria | 25045 |
| 580 | Ga0495665_0008600 | 3300046531 | Bacteria | 5540 |
| 581 | Ga0495665_0079013 | 3300046531 | Bacteria | 1731 |
| 582 | Ga0495665_0118349 | 3300046531 | Bacteria | 1388 |
| 583 | Ga0495665_0165391 | 3300046531 | Bacteria | 1152 |
| 584 | Ga0495640_0003174 | 3300046533 | Bacteria | 13241 |
| 585 | Ga0495640_0014903 | 3300046533 | Bacteria | 5862 |
| 586 | Ga0495640_0026762 | 3300046533 | Bacteria | 4163 |
| 587 | Ga0495640_0052310 | 3300046533 | Bacteria | 2805 |
| 588 | Ga0495640_0065206 | 3300046533 | Bacteria | 2460 |
| 589 | Ga0495586_0038933 | 3300046535 | Bacteria | 2555 |
| 590 | Ga0495586_0057167 | 3300046535 | Bacteria | 2116 |
| 591 | Ga0495586_0063876 | 3300046535 | Bacteria | 2006 |
| 592 | Ga0495586_0307867 | 3300046535 | Bacteria | 908 |
| 593 | Ga0495587_0052927 | 3300046536 | Bacteria | 2394 |
| 594 | Ga0495587_0070865 | 3300046536 | Bacteria | 2028 |
| 595 | Ga0495645_0002855 | 3300046543 | Bacteria | 11721 |
| 596 | Ga0495645_0039232 | 3300046543 | Bacteria | 3455 |
| 597 | Ga0495645_0093557 | 3300046543 | Bacteria | 2145 |
| 598 | Ga0495645_0343013 | 3300046543 | Bacteria | 964 |
| 599 | Ga0495667_0051957 | 3300046559 | Bacteria | 2702 |
| 600 | Ga0495667_0072495 | 3300046559 | Bacteria | 2245 |
| 601 | Ga0495667_0277092 | 3300046559 | Bacteria | 1065 |
| 602 | Ga0495667_0498332 | 3300046559 | Bacteria | 763 |
| 603 | Ga0495668_0085177 | 3300046616 | Bacteria | 1733 |
| 604 | Ga0495634_0000996 | 3300046642 | Bacteria | 26710 |
| 605 | Ga0495634_0003014 | 3300046642 | Bacteria | 13712 |
| 606 | Ga0495634_0010095 | 3300046642 | Bacteria | 6931 |
| 607 | Ga0495634_0176339 | 3300046642 | Bacteria | 1341 |
| 608 | Ga0495635_0001099 | 3300046663 | Bacteria | 17970 |
| 609 | Ga0495635_0010252 | 3300046663 | Bacteria | 6552 |
| 610 | Ga0495635_0019694 | 3300046663 | Bacteria | 4699 |
| 611 | Ga0495635_0084057 | 3300046663 | Bacteria | 2178 |
| 612 | Ga0495635_0156167 | 3300046663 | Bacteria | 1553 |
| 613 | Ga0495635_0157947 | 3300046663 | Bacteria | 1543 |
| 614 | Ga0495635_0233899 | 3300046663 | Bacteria | 1241 |
| 615 | Ga0495661_0261519 | 3300046665 | Bacteria | 879 |
| 616 | Ga0495657_0076401 | 3300046675 | Bacteria | 2175 |
| 617 | Ga0495657_0184146 | 3300046675 | Bacteria | 1280 |
| 618 | Ga0495599_0036271 | 3300046678 | Bacteria | 3096 |
| 619 | Ga0495599_0059309 | 3300046678 | Bacteria | 2394 |
| 620 | Ga0495599_0091474 | 3300046678 | Bacteria | 1898 |
| 621 | Ga0495599_0304816 | 3300046678 | Unclassified | 961 |
| 622 | Ga0495623_0078970 | 3300046679 | Bacteria | 2039 |
| 623 | Ga0495623_0172602 | 3300046679 | Bacteria | 1262 |
| 624 | Ga0495646_0027666 | 3300046680 | Bacteria | 3556 |
| 625 | Ga0495647_0030188 | 3300046681 | Bacteria | 2010 |
| 626 | Ga0495647_0254450 | 3300046681 | Bacteria | 782 |
| 627 | Ga0495658_0000486 | 3300046683 | Bacteria | 21786 |
| 628 | Ga0495658_0111531 | 3300046683 | Bacteria | 1645 |
| 629 | Ga0495658_0113771 | 3300046683 | Bacteria | 1630 |
| 630 | Ga0495613_0003151 | 3300046689 | Bacteria | 12354 |
| 631 | Ga0495613_0105536 | 3300046689 | Bacteria | 2034 |
| 632 | Ga0495613_0165873 | 3300046689 | Bacteria | 1569 |
| 633 | Ga0495613_0177720 | 3300046689 | Bacteria | 1508 |
| 634 | Ga0495613_0246464 | 3300046689 | Bacteria | 1248 |
| 635 | Ga0495613_0302536 | 3300046689 | Bacteria | 1107 |
| 636 | Ga0495613_0703929 | 3300046689 | Bacteria | 665 |
| 637 | Ga0495624_0003661 | 3300046690 | Bacteria | 11363 |
| 638 | Ga0495624_0003734 | 3300046690 | Bacteria | 11257 |
| 639 | Ga0495624_0014126 | 3300046690 | Bacteria | 5428 |
| 640 | Ga0495624_0023494 | 3300046690 | Bacteria | 4065 |
| 641 | Ga0495624_0283362 | 3300046690 | Bacteria | 1000 |
| 642 | Ga0495671_0107071 | 3300046692 | Bacteria | 1365 |
| 643 | Ga0495649_0132126 | 3300046694 | Bacteria | 1317 |
| 644 | Ga0495600_0095524 | 3300046809 | Bacteria | 1938 |
| 645 | Ga0495600_0121307 | 3300046809 | Bacteria | 1700 |
| 646 | Ga0495600_0205485 | 3300046809 | Bacteria | 1263 |
| 647 | Ga0495581_0000222 | 3300047315 | Bacteria | 26831 |
| 648 | Ga0495581_0001725 | 3300047315 | Bacteria | 12184 |
| 649 | Ga0495581_0010469 | 3300047315 | Bacteria | 5363 |
| 650 | Ga0495581_0073228 | 3300047315 | Bacteria | 1982 |
| 651 | Ga0495581_0221113 | 3300047315 | Bacteria | 1107 |
| 652 | Ga0495604_0110125 | 3300047317 | Bacteria | 2009 |
| 653 | Ga0495604_0150384 | 3300047317 | Bacteria | 1655 |
| 654 | Ga0495604_0163044 | 3300047317 | Bacteria | 1574 |
| 655 | Ga0495604_0165053 | 3300047317 | Bacteria | 1562 |
| 656 | Ga0495604_0427712 | 3300047317 | Bacteria | 868 |
| 657 | Ga0495636_0165143 | 3300047318 | Bacteria | 999 |
| 658 | Ga0495674_0000684 | 3300047319 | Bacteria | 31976 |
| 659 | Ga0495674_0002542 | 3300047319 | Bacteria | 17767 |
| 660 | Ga0495674_0047903 | 3300047319 | Bacteria | 3786 |
| 661 | Ga0495674_0048274 | 3300047319 | Bacteria | 3768 |
| 662 | Ga0495674_0067665 | 3300047319 | Bacteria | 3093 |
| 663 | Ga0495676_0051944 | 3300047321 | Bacteria | 3275 |
| 664 | Ga0495676_0109483 | 3300047321 | Bacteria | 2030 |
| 665 | Ga0495676_0125755 | 3300047321 | Bacteria | 1858 |
| 666 | Ga0495680_0134431 | 3300047322 | Bacteria | 1814 |
| 667 | Ga0495680_0399879 | 3300047322 | Bacteria | 949 |
| 668 | Ga0495683_0054121 | 3300047323 | Bacteria | 2001 |
| 669 | Ga0495675_0436981 | 3300047444 | Bacteria | 759 |
| 670 | Ga0495673_0081311 | 3300047469 | Bacteria | 1342 |
| 671 | Ga0495684_0001356 | 3300047471 | Bacteria | 19666 |
| 672 | Ga0495684_0008929 | 3300047471 | Bacteria | 7743 |
| 673 | Ga0495684_0077290 | 3300047471 | Bacteria | 2527 |
| 674 | Ga0495684_0189801 | 3300047471 | Bacteria | 1520 |
| 675 | Ga0495684_0284958 | 3300047471 | Bacteria | 1191 |
| 676 | Ga0495684_0443316 | 3300047471 | Bacteria | 904 |
| 677 | Ga0495593_0002472 | 3300047673 | Bacteria | 11113 |
| 678 | Ga0495593_0013486 | 3300047673 | Bacteria | 4661 |
| 679 | Ga0495593_0107794 | 3300047673 | Bacteria | 1424 |
| 680 | Ga0495593_0180139 | 3300047673 | Bacteria | 1064 |
| 681 | Ga0495602_0162362 | 3300048088 | Bacteria | 1743 |
| 682 | Ga0495602_0260437 | 3300048088 | Bacteria | 1287 |
| 683 | Ga0495602_0364985 | 3300048088 | Bacteria | 1038 |
| 684 | Ga0496100_0060051 | 3300048903 | Bacteria | 2501 |
| 685 | Ga0496100_0183533 | 3300048903 | Bacteria | 1514 |
| 686 | Ga0496100_0862079 | 3300048903 | Unclassified | 711 |
| 687 | Ga0496101_0015335 | 3300048904 | Bacteria | 5162 |
| 688 | Ga0496102_0057108 | 3300048905 | Bacteria | 3562 |
| 689 | Ga0496102_0089931 | 3300048905 | Bacteria | 2841 |
| 690 | Ga0496102_0279630 | 3300048905 | Bacteria | 1573 |
| 691 | Ga0496102_0596175 | 3300048905 | Bacteria | 1028 |
| 692 | Ga0496103_0055653 | 3300048906 | Bacteria | 2454 |
| 693 | Ga0496104_0049951 | 3300048907 | Bacteria | 3945 |
| 694 | Ga0496104_0081666 | 3300048907 | Bacteria | 3083 |
| 695 | Ga0496104_0118363 | 3300048907 | Bacteria | 2543 |
| 696 | Ga0496104_0208886 | 3300048907 | Unclassified | 1864 |
| 697 | Ga0496104_0255718 | 3300048907 | Bacteria | 1664 |
| 698 | Ga0496105_0055927 | 3300048908 | Bacteria | 3257 |
| 699 | Ga0496105_0554485 | 3300048908 | Bacteria | 896 |
| 700 | Ga0496106_0016343 | 3300048909 | Bacteria | 5491 |
| 701 | Ga0496106_0091858 | 3300048909 | Bacteria | 2344 |
| 702 | Ga0496106_0202409 | 3300048909 | Bacteria | 1580 |
| 703 | Ga0496106_0340916 | 3300048909 | Bacteria | 1204 |
| 704 | Ga0496107_0014468 | 3300048910 | Bacteria | 5525 |
| 705 | Ga0496107_0089169 | 3300048910 | Bacteria | 2252 |
| 706 | Ga0496108_0030060 | 3300048911 | Bacteria | 4503 |
| 707 | Ga0496108_0033847 | 3300048911 | Plasmid | 4245 |
| 708 | Ga0496108_0144963 | 3300048911 | Bacteria | 2047 |
| 709 | Ga0496108_0284066 | 3300048911 | Bacteria | 1440 |
| 710 | Ga0496109_0046468 | 3300048912 | Bacteria | 3943 |
| 711 | Ga0496109_0098584 | 3300048912 | Bacteria | 2709 |
| 712 | Ga0496109_0519503 | 3300048912 | Bacteria | 1124 |
| 713 | Ga0496109_0908709 | 3300048912 | Unclassified | 818 |
| 714 | Ga0496109_0982412 | 3300048912 | Bacteria | 782 |
| 715 | Ga0496110_0011665 | 3300048913 | Bacteria | 7206 |
| 716 | Ga0496110_0162615 | 3300048913 | Bacteria | 2024 |
| 717 | Ga0496110_0190953 | 3300048913 | Bacteria | 1860 |
| 718 | Ga0496111_0008785 | 3300048914 | Bacteria | 6709 |
| 719 | Ga0496111_0012582 | 3300048914 | Bacteria | 5734 |
| 720 | Ga0496111_0282833 | 3300048914 | Bacteria | 1230 |
| 721 | Ga0496112_0031182 | 3300048915 | Bacteria | 5168 |
| 722 | Ga0496112_0031780 | 3300048915 | Bacteria | 5121 |
| 723 | Ga0496112_0068274 | 3300048915 | Plasmid | 3510 |
| 724 | Ga0496112_0114552 | 3300048915 | Bacteria | 2666 |
| 725 | Ga0496112_0138858 | 3300048915 | Bacteria | 2400 |
| 726 | Ga0496112_0680993 | 3300048915 | Bacteria | 957 |
| 727 | Ga0496113_0044026 | 3300048916 | Bacteria | 3305 |
| 728 | Ga0496113_0059943 | 3300048916 | Bacteria | 2868 |
| 729 | Ga0496114_0013125 | 3300048917 | Bacteria | 6638 |
| 730 | Ga0496114_0129578 | 3300048917 | Bacteria | 2177 |
| 731 | Ga0496114_0393020 | 3300048917 | Bacteria | 1228 |
| 732 | Ga0496115_0014659 | 3300048918 | Bacteria | 5937 |
| 733 | Ga0496115_0067614 | 3300048918 | Bacteria | 2890 |
| 734 | Ga0496121_0002804 | 3300048924 | Bacteria | 25823 |
| 735 | Ga0496126_0173505 | 3300048929 | Bacteria | 1835 |
| 736 | Ga0501046_0260891 | 3300049580 | Bacteria | 1273 |
| 737 | Ga0501047_0352625 | 3300049581 | Bacteria | 1308 |
| 738 | Ga0501069_0074013 | 3300049585 | Bacteria | 1911 |
| 739 | Ga0501072_0437313 | 3300049588 | Bacteria | 1036 |
| 740 | Ga0501075_0140672 | 3300049591 | Bacteria | 1839 |
| 741 | Ga0501077_0266764 | 3300049593 | Bacteria | 1089 |
| 742 | nmdc:mga0yw44_64371_c1 | 3300050492 | Bacteria | 2256 |
| 743 | nmdc:mga05p37_578_c1 | 3300050507 | Bacteria | 40238 |
| 744 | nmdc:mga09592_3930_c1 | 3300050508 | Bacteria | 11973 |
| 745 | nmdc:mga08y16_47908_c1 | 3300050511 | Bacteria | 4474 |
| 746 | nmdc:mga08y16_641585_c1 | 3300050511 | Bacteria | 1067 |
| 747 | nmdc:mga0n895_387821_c1 | 3300050512 | Bacteria | 1413 |
| 748 | nmdc:mga0n895_412041_c1 | 3300050512 | Bacteria | 1366 |
| 749 | nmdc:mga0n895_44127_c1 | 3300050512 | Bacteria | 4348 |
| 750 | nmdc:mga0n895_574585_c1 | 3300050512 | Bacteria | 1131 |
| 751 | nmdc:mga0rr50_460401_c1 | 3300050513 | Bacteria | 1079 |
| 752 | nmdc:mga08x19_206790_c1 | 3300050514 | Bacteria | 1347 |
| 753 | nmdc:mga0a205_17986_c1 | 3300050515 | Bacteria | 6250 |
| 754 | Ga0495601_0001859 | 3300053077 | Bacteria | 11761 |
| 755 | Ga0495601_0004536 | 3300053077 | Bacteria | 8023 |
| 756 | Ga0495601_0011341 | 3300053077 | Bacteria | 5327 |
| 757 | Ga0495601_0038828 | 3300053077 | Bacteria | 2978 |
| 758 | Ga0495601_0052006 | 3300053077 | Bacteria | 2586 |
| 759 | Ga0495601_0062944 | 3300053077 | Bacteria | 2357 |
| 760 | Ga0495601_0427432 | 3300053077 | Bacteria | 858 |
| 761 | Ga0495612_0002164 | 3300053078 | Bacteria | 8082 |
| 762 | Ga0495612_0002796 | 3300053078 | Bacteria | 7215 |
| 763 | Ga0495612_0060244 | 3300053078 | Bacteria | 1571 |
| 764 | Ga0495595_0025605 | 3300053084 | Bacteria | 2616 |
| 765 | Ga0495595_0034689 | 3300053084 | Bacteria | 2283 |
| 766 | Ga0495595_0070694 | 3300053084 | Bacteria | 1649 |
| 767 | Ga0495595_0075813 | 3300053084 | Bacteria | 1596 |
| 768 | Ga0495595_0076668 | 3300053084 | Unclassified | 1587 |
| 769 | Ga0495595_0134105 | 3300053084 | Bacteria | 1212 |
| 770 | Ga0495619_0006088 | 3300053085 | Bacteria | 7643 |
| 771 | Ga0495619_0006186 | 3300053085 | Bacteria | 7587 |
| 772 | Ga0495619_0006430 | 3300053085 | Bacteria | 7443 |
| 773 | Ga0495619_0015577 | 3300053085 | Bacteria | 4811 |
| 774 | Ga0495619_0018816 | 3300053085 | Bacteria | 4385 |
| 775 | Ga0495619_0037424 | 3300053085 | Bacteria | 3161 |
| 776 | Ga0495619_0071352 | 3300053085 | Bacteria | 2324 |
| 777 | Ga0495619_0188883 | 3300053085 | Bacteria | 1426 |
| 778 | Ga0500583_0002057 | 3300053092 | Bacteria | 5953 |
| 779 | Ga0500595_021079 | 3300053119 | Bacteria | 2333 |
| 780 | Ga0501082_0171098 | 3300060353 | Bacteria | 1889 |
| 781 | 2515690630 | 2515154123 | Bacteria | 6387382 |
| 782 | 2849083345 | 2849076700 | Bacteria | 7039503 |
| 783 | 2937852748 | 2937848649 | Bacteria | 6983481 |
| 784 | 2958052129 | 2958041894 | Bacteria | 13082850 |
| 785 | 2970472479 | 2970469710 | Bacteria | 6969209 |
| 786 | 3004218504 | 3004211236 | Bacteria | 7417683 |
| 787 | 3004223650 | 3004218560 | Bacteria | 7421728 |
| 788 | 3004276591 | 3004275668 | Bacteria | 7114440 |
| 789 | JGI25404J52841_10014027 | |||
| 790 | 2214759110 | |||
| 791 | ARSoilYngRDRAFT_c00056 | |||
| 792 | ARcpr5yngRDRAFT_c000087 | |||
| 793 | ARSoilOldRDRAFT_c000087 | |||
| 794 | ARCol0oldRDRAFT_c00189 | |||
| 795 | ARCol0yngRDRAFT_1000076 | |||
| 796 | JGI24751J29686_10007510 | |||
| 797 | JGI25404J52841_10003182 | |||
| 798 | JGI25404J52841_10006590 | |||
| 799 | JGI25404J52841_10008867 | |||
| 800 | Ga0065717_1002162 | |||
| 801 | Ga0065716_1001866 | |||
| 802 | Ga0065704_10143605 | |||
| 803 | Ga0065715_10106446 | |||
| 804 | Ga0065715_10126637 | |||
| 805 | Ga0065707_10106977 | |||
| 806 | Ga0065707_10136913 | |||
| 807 | Ga0070676_10231106 | |||
| 808 | Ga0070690_100551212 | |||
| 809 | Ga0070666_10129936 | |||
| 810 | Ga0070680_100030343 | |||
| 811 | Ga0070680_100047675 | |||
| 812 | Ga0070682_100026653 | |||
| 813 | Ga0068868_100402225 | |||
| 814 | Ga0070660_100023793 | |||
| 815 | Ga0070689_100012861 | |||
| 816 | Ga0070691_10178556 | |||
| 817 | Ga0070687_100368960 | |||
| 818 | Ga0070669_100397382 | |||
| 819 | Ga0070675_100211972 | |||
| 820 | Ga0070671_100000745 | |||
| 821 | Ga0070671_100005255 | |||
| 822 | Ga0070671_100090152 | |||
| 823 | Ga0070671_100169898 | |||
| 824 | Ga0070674_100052015 | |||
| 825 | Ga0070674_100554656 | |||
| 826 | Ga0070673_100020425 | |||
| 827 | Ga0070688_100255742 | |||
| 828 | Ga0070688_100575917 | |||
| 829 | Ga0070659_100241398 | |||
| 830 | Ga0070667_100733666 | |||
| 831 | Ga0070709_10008513 | |||
| 832 | Ga0070709_10097818 | |||
| 833 | Ga0070709_10261352 | |||
| 834 | Ga0070709_10287636 | |||
| 835 | Ga0070714_100057034 | |||
| 836 | Ga0070714_100150865 | |||
| 837 | Ga0070713_100051794 | |||
| 838 | Ga0070713_100093571 | |||
| 839 | Ga0070713_100171766 | |||
| 840 | Ga0070713_100193288 | |||
| 841 | Ga0070713_100368157 | |||
| 842 | Ga0070713_100581745 | |||
| 843 | Ga0070710_10015607 | |||
| 844 | Ga0070710_10017856 | |||
| 845 | Ga0070711_100050490 | |||
| 846 | Ga0070711_100052580 | |||
| 847 | Ga0070711_100125194 | |||
| 848 | Ga0070711_100194004 | |||
| 849 | Ga0070711_100359264 | |||
| 850 | Ga0070711_100584031 | |||
| 851 | Ga0070700_100142862 | |||
| 852 | Ga0070694_100137317 | |||
| 853 | Ga0070663_100113115 | |||
| 854 | Ga0070662_100078545 | |||
| 855 | Ga0070662_100209464 | |||
| 856 | Ga0070681_10024148 | |||
| 857 | Ga0070681_10083405 | |||
| 858 | Ga0070681_10304738 | |||
| 859 | Ga0068867_100556696 | |||
| 860 | Ga0068867_100678654 | |||
| 861 | Ga0070706_100105465 | |||
| 862 | Ga0070706_100730708 | |||
| 863 | Ga0070706_101271159 | |||
| 864 | Ga0070698_100201202 | |||
| 865 | Ga0074259_10685891 | |||
| 866 | Ga0070699_100255695 | |||
| 867 | Ga0070679_100022095 | |||
| 868 | Ga0070679_100074040 | |||
| 869 | Ga0070684_100493408 | |||
| 870 | Ga0070684_100624942 | |||
| 871 | Ga0070697_100012814 | |||
| 872 | Ga0070697_100061990 | |||
| 873 | Ga0070697_100355631 | |||
| 874 | Ga0068853_100198105 | |||
| 875 | Ga0068853_100694785 | |||
| 876 | Ga0068853_100716567 | |||
| 877 | Ga0070672_100097944 | |||
| 878 | Ga0070672_100158742 | |||
| 879 | Ga0070672_100654542 | |||
| 880 | Ga0070686_100045571 | |||
| 881 | Ga0070686_100089518 | |||
| 882 | Ga0070686_100590509 | |||
| 883 | Ga0070686_100605796 | |||
| 884 | Ga0070695_100077478 | |||
| 885 | Ga0070693_100242487 | |||
| 886 | Ga0070693_100334082 | |||
| 887 | Ga0070665_100041089 | |||
| 888 | Ga0070665_100235078 | |||
| 889 | Ga0070665_100944393 | |||
| 890 | Ga0070704_100048584 | |||
| 891 | Ga0068855_100997918 | |||
| 892 | Ga0070664_100179180 | |||
| 893 | Ga0070664_100229940 | |||
| 894 | Ga0070664_100337223 | |||
| 895 | Ga0068857_100493139 | |||
| 896 | Ga0068854_100334899 | |||
| 897 | Ga0068854_100372973 | |||
| 898 | Ga0068856_100169035 | |||
| 899 | Ga0068856_100348872 | |||
| 900 | Ga0068856_100502288 | |||
| 901 | Ga0068856_101024860 | |||
| 902 | Ga0070702_100346485 | |||
| 903 | Ga0070702_100532259 | |||
| 904 | Ga0068852_100032612 | |||
| 905 | Ga0068852_100297126 | |||
| 906 | Ga0068859_100000579 | |||
| 907 | Ga0068859_100038156 | |||
| 908 | Ga0068859_100254391 | |||
| 909 | Ga0068859_101293982 | |||
| 910 | Ga0068864_100218019 | |||
| 911 | Ga0068866_10093236 | |||
| 912 | Ga0068861_100193618 | |||
| 913 | Ga0068851_10190900 | |||
| 914 | Ga0068863_100001862 | |||
| 915 | Ga0068863_100797586 | |||
| 916 | Ga0068858_100002351 | |||
| 917 | Ga0068858_100176864 | |||
| 918 | Ga0068860_100203573 | |||
| 919 | Ga0068860_100357653 | |||
| 920 | Ga0068862_100085514 | |||
| 921 | Ga0068862_101025186 | |||
| 922 | Ga0081455_10000354 | |||
| 923 | Ga0081455_10006105 | |||
| 924 | Ga0081455_10044470 | |||
| 925 | Ga0081455_10059433 | |||
| 926 | Ga0081455_10072968 | |||
| 927 | Ga0081455_10082946 | |||
| 928 | Ga0081455_10119511 | |||
| 929 | Ga0081455_10240248 | |||
| 930 | Ga0081455_10248572 | |||
| 931 | Ga0081540_1000055 | |||
| 932 | Ga0081540_1000075 | |||
| 933 | Ga0081540_1002306 | |||
| 934 | Ga0081540_1003603 | |||
| 935 | Ga0081540_1011401 | |||
| 936 | Ga0081540_1015638 | |||
| 937 | Ga0081540_1020205 | |||
| 938 | Ga0081540_1020840 | |||
| 939 | Ga0081540_1026165 | |||
| 940 | Ga0081540_1027929 | |||
| 941 | Ga0081539_10000209 | |||
| 942 | Ga0081539_10004192 | |||
| 943 | Ga0070717_10027109 | |||
| 944 | Ga0070717_10159098 | |||
| 945 | Ga0070717_10164544 | |||
| 946 | Ga0070717_10181382 | |||
| 947 | Ga0070717_10263038 | |||
| 948 | Ga0075365_10068220 | |||
| 949 | Ga0075365_10173304 | |||
| 950 | Ga0070715_10211779 | |||
| 951 | Ga0070716_100099163 | |||
| 952 | Ga0070716_100111737 | |||
| 953 | Ga0070716_100613081 | |||
| 954 | Ga0070712_100012839 | |||
| 955 | Ga0070712_100025006 | |||
| 956 | Ga0070712_100028936 | |||
| 957 | Ga0070712_100117691 | |||
| 958 | Ga0070712_100215467 | |||
| 959 | Ga0070712_100498484 | |||
| 960 | Ga0070712_100579418 | |||
| 961 | Ga0070712_100792552 | |||
| 962 | Ga0097621_100676022 | |||
| 963 | Ga0097621_100713919 | |||
| 964 | Ga0068871_100481928 | |||
| 965 | Ga0075428_100075095 | |||
| 966 | Ga0075428_100560431 | |||
| 967 | Ga0075433_10083334 | |||
| 968 | Ga0075433_10222728 | |||
| 969 | Ga0075434_100039041 | |||
| 970 | Ga0075434_100123877 | |||
| 971 | Ga0075434_100342542 | |||
| 972 | Ga0075429_100011921 | |||
| 973 | Ga0097620_100000579 | |||
| 974 | Ga0097620_100038156 | |||
| 975 | Ga0097620_100254372 | |||
| 976 | Ga0097620_101293759 | |||
| 977 | Ga0075435_100446992 | |||
| 978 | Ga0099794_10006930 | |||
| 979 | Ga0105250_10083473 | |||
| 980 | Ga0105240_10098984 | |||
| 981 | Ga0105240_10144979 | |||
| 982 | Ga0105240_10527731 | |||
| 983 | Ga0111539_10001365 | |||
| 984 | Ga0111539_10609924 | |||
| 985 | Ga0105245_10056904 | |||
| 986 | Ga0105247_10001257 | |||
| 987 | Ga0105247_10010609 | |||
| 988 | Ga0105247_10035823 | |||
| 989 | Ga0114129_10006147 | |||
| 990 | Ga0114129_10478663 | |||
| 991 | Ga0114129_10597448 | |||
| 992 | Ga0105243_10042966 | |||
| 993 | Ga0105243_10062475 | |||
| 994 | Ga0105243_10101758 | |||
| 995 | Ga0105241_10103593 | |||
| 996 | Ga0105241_10270902 | |||
| 997 | Ga0105241_10299661 | |||
| 998 | Ga0105242_10102413 | |||
| 999 | Ga0105248_10039393 | |||
| 1000 | Ga0105248_10080677 | |||
| 1001 | Ga0105248_10360162 | |||
| 1002 | Ga0105237_10169403 | |||
| 1003 | Ga0105237_10277533 | |||
| 1004 | Ga0105238_10029067 | |||
| 1005 | Ga0105238_11260141 | |||
| 1006 | Ga0105249_10084671 | |||
| 1007 | Ga0105249_10509264 | |||
| 1008 | Ga0105249_10812959 | |||
| 1009 | Ga0099796_10073672 | |||
| 1010 | Ga0105239_10032427 | |||
| 1011 | Ga0105239_10142809 | |||
| 1012 | Ga0105239_11194281 | |||
| 1013 | Ga0105246_10085263 | |||
| 1014 | Ga0105246_10162775 | |||
| 1015 | Ga0105246_10398592 | |||
| 1016 | Ga0105246_10471581 | |||
| 1017 | Ga0157321_1000258 | |||
| 1018 | Ga0157335_1001024 | |||
| 1019 | Ga0157326_1015693 | |||
| 1020 | Ga0157370_10015231 | |||
| 1021 | Ga0157370_10222469 | |||
| 1022 | Ga0157369_10815653 | |||
| 1023 | Ga0157369_10957912 | |||
| 1024 | Ga0157378_10477724 | |||
| 1025 | Ga0163162_10121070 | |||
| 1026 | Ga0163162_10466678 | |||
| 1027 | Ga0163162_10521536 | |||
| 1028 | Ga0163162_11457725 | |||
| 1029 | Ga0157372_10340657 | |||
| 1030 | Ga0157372_10752903 | |||
| 1031 | Ga0157375_10057270 | |||
| 1032 | Ga0157375_10075075 | |||
| 1033 | Ga0157375_10989970 | |||
| 1034 | Ga0163163_10022041 | |||
| 1035 | Ga0182008_10014572 | |||
| 1036 | Ga0157377_10060047 | |||
| 1037 | Ga0157377_10391761 | |||
| 1038 | Ga0157379_10336707 | |||
| 1039 | Ga0157379_10611825 | |||
| 1040 | Ga0157379_10686393 | |||
| 1041 | Ga0157379_10767490 | |||
| 1042 | Ga0157376_10498795 | |||
| 1043 | Ga0157376_10523695 | |||
| 1044 | Ga0182007_10018951 | |||
| 1045 | Ga0163161_10042292 | |||
| 1046 | Ga0163161_10382872 | |||
| 1047 | Ga0197907_10512701 | |||
| 1048 | Ga0206356_11356092 | |||
| 1049 | Ga0206351_10203003 | |||
| 1050 | Ga0206354_11401222 | |||
| 1051 | Ga0206353_10146507 | |||
| 1052 | Ga0213873_10022209 | |||
| 1053 | Ga0213874_10045108 | |||
| 1054 | Ga0224712_10290964 | |||
| 1055 | Ga0224712_10353777 | |||
| 1056 | Ga0209148_1008961 | |||
| 1057 | Ga0209051_1001604 | |||
| 1058 | Ga0207692_10023590 | |||
| 1059 | Ga0207692_10038188 | |||
| 1060 | Ga0207692_10065868 | |||
| 1061 | Ga0207692_10101364 | |||
| 1062 | Ga0207692_10108267 | |||
| 1063 | Ga0207692_10283650 | |||
| 1064 | Ga0207642_10125251 | |||
| 1065 | Ga0207710_10000321 | |||
| 1066 | Ga0207688_10086444 | |||
| 1067 | Ga0207688_10336252 | |||
| 1068 | Ga0207680_10037074 | |||
| 1069 | Ga0207647_10231429 | |||
| 1070 | Ga0207685_10115378 | |||
| 1071 | Ga0207699_10462742 | |||
| 1072 | Ga0207699_10486897 | |||
| 1073 | Ga0207705_10463924 | |||
| 1074 | Ga0207684_10088723 | |||
| 1075 | Ga0207684_10492217 | |||
| 1076 | Ga0207654_10056710 | |||
| 1077 | Ga0207707_10000754 | |||
| 1078 | Ga0207707_10036412 | |||
| 1079 | Ga0207707_10157210 | |||
| 1080 | Ga0207695_10100066 | |||
| 1081 | Ga0207695_10154608 | |||
| 1082 | Ga0207695_10278000 | |||
| 1083 | Ga0207671_10368916 | |||
| 1084 | Ga0207671_10516084 | |||
| 1085 | Ga0207693_10001869 | |||
| 1086 | Ga0207693_10018489 | |||
| 1087 | Ga0207693_10040514 | |||
| 1088 | Ga0207693_10045432 | |||
| 1089 | Ga0207693_10100752 | |||
| 1090 | Ga0207693_10252189 | |||
| 1091 | Ga0207693_10426109 | |||
| 1092 | Ga0207693_10642886 | |||
| 1093 | Ga0207663_10026941 | |||
| 1094 | Ga0207663_10034683 | |||
| 1095 | Ga0207663_10105511 | |||
| 1096 | Ga0207663_10341302 | |||
| 1097 | Ga0207660_10080267 | |||
| 1098 | Ga0207660_10567490 | |||
| 1099 | Ga0207662_10193743 | |||
| 1100 | Ga0207657_10101835 | |||
| 1101 | Ga0207649_10557998 | |||
| 1102 | Ga0207652_10037202 | |||
| 1103 | Ga0207681_10268629 | |||
| 1104 | Ga0207681_10500128 | |||
| 1105 | Ga0207694_10018204 | |||
| 1106 | Ga0207650_10010743 | |||
| 1107 | Ga0207659_10004652 | |||
| 1108 | Ga0207687_10075132 | |||
| 1109 | Ga0207687_10153830 | |||
| 1110 | Ga0207700_10011038 | |||
| 1111 | Ga0207700_10043491 | |||
| 1112 | Ga0207700_10371104 | |||
| 1113 | Ga0207700_10409601 | |||
| 1114 | Ga0207700_10677268 | |||
| 1115 | Ga0207664_10044924 | |||
| 1116 | Ga0207664_10075674 | |||
| 1117 | Ga0207664_10113757 | |||
| 1118 | Ga0207664_10179154 | |||
| 1119 | Ga0207664_10470945 | |||
| 1120 | Ga0207664_10545256 | |||
| 1121 | Ga0207664_10580221 | |||
| 1122 | Ga0207664_10871105 | |||
| 1123 | Ga0207664_10901050 | |||
| 1124 | Ga0207644_10004666 | |||
| 1125 | Ga0207644_10009370 | |||
| 1126 | Ga0207644_10307976 | |||
| 1127 | Ga0207706_10067446 | |||
| 1128 | Ga0207706_10406582 | |||
| 1129 | Ga0207686_10170956 | |||
| 1130 | Ga0207709_10132782 | |||
| 1131 | Ga0207709_10180470 | |||
| 1132 | Ga0207709_10296887 | |||
| 1133 | Ga0207670_10247962 | |||
| 1134 | Ga0207669_10941357 | |||
| 1135 | Ga0207665_10091379 | |||
| 1136 | Ga0207665_10153945 | |||
| 1137 | Ga0207665_10260810 | |||
| 1138 | Ga0207691_10126618 | |||
| 1139 | Ga0207691_10160693 | |||
| 1140 | Ga0207691_10412210 | |||
| 1141 | Ga0207711_10374337 | |||
| 1142 | Ga0207711_10543526 | |||
| 1143 | Ga0207661_10654240 | |||
| 1144 | Ga0207679_10061391 | |||
| 1145 | Ga0207679_10635792 | |||
| 1146 | Ga0207667_10374241 | |||
| 1147 | Ga0207667_11304521 | |||
| 1148 | Ga0207651_10012715 | |||
| 1149 | Ga0207712_10085297 | |||
| 1150 | Ga0207668_10259563 | |||
| 1151 | Ga0207640_10441816 | |||
| 1152 | Ga0207640_10654688 | |||
| 1153 | Ga0207658_10008550 | |||
| 1154 | Ga0207658_10205649 | |||
| 1155 | Ga0207658_10632175 | |||
| 1156 | Ga0207658_10703269 | |||
| 1157 | Ga0207677_10568253 | |||
| 1158 | Ga0207703_10005117 | |||
| 1159 | Ga0207703_10457311 | |||
| 1160 | Ga0207639_10174451 | |||
| 1161 | Ga0207639_10507643 | |||
| 1162 | Ga0207639_11072726 | |||
| 1163 | Ga0207678_10067104 | |||
| 1164 | Ga0207678_10155277 | |||
| 1165 | Ga0207708_10374517 | |||
| 1166 | Ga0207702_10059159 | |||
| 1167 | Ga0207702_10081019 | |||
| 1168 | Ga0207702_11032571 | |||
| 1169 | Ga0207641_10027983 | |||
| 1170 | Ga0207648_10083146 | |||
| 1171 | Ga0207676_10258314 | |||
| 1172 | Ga0207674_10072530 | |||
| 1173 | Ga0207675_100050193 | |||
| 1174 | Ga0207675_100107815 | |||
| 1175 | Ga0207683_10447825 | |||
| 1176 | Ga0207683_10620120 | |||
| 1177 | Ga0207698_10218568 | |||
| 1178 | Ga0207698_10932563 | |||
| 1179 | Ga0209588_1015403 | |||
| 1180 | Ga0207428_10052816 | |||
| 1181 | Ga0207428_10513537 | |||
| 1182 | Ga0268266_10108350 | |||
| 1183 | Ga0268266_11087466 | |||
| 1184 | Ga0268265_10516421 | |||
| 1185 | Ga0268264_10148467 | |||
| 1186 | Ga0307509_10022472 | |||
| 1187 | Ga0307509_10083352 | |||
| 1188 | Ga0307509_10120381 | |||
| 1189 | Ga0265313_10001357 | |||
| 1190 | Ga0373930_0003209 | |||
| 1191 | Ga0373948_0000835 | |||
| 1192 | Ga0373950_0000174 | |||
| 1193 | Ga0373959_0003847 | |||
| 1194 | Ga0373938_0000152 | |||
| 1195 | Ga0373926_0045504 | |||
| 1196 | Ga0373926_0077200 | |||
| 1197 | Ga0373928_0001004 | |||
| 1198 | Ga0373929_0000088 | |||
| 1199 | Ga0373940_0000067 | |||
| 1200 | Ga0373944_0002667 | |||
| 1201 | Ga0373944_0045249 | |||
| 1202 | Ga0373949_0000825 | |||
| 1203 | Ga0373949_0051539 | |||
| 1204 | Ga0373951_0000361 | |||
| 1205 | Ga0373952_0000776 | |||
| 1206 | Ga0373952_0116121 | |||
| 1207 | Ga0373923_0349205 | |||
| 1208 | Ga0373932_0000315 | |||
| 1209 | Ga0373932_0148679 | |||
| 1210 | Ga0373936_0005700 | |||
| 1211 | Ga0373936_0173973 | |||
| 1212 | Ga0373939_0000202 | |||
| 1213 | Ga0373939_0155010 | |||
| 1214 | Ga0373941_0000272 | |||
| 1215 | Ga0373945_0020386 | |||
| 1216 | Ga0373945_0034457 | |||
| 1217 | Ga0373945_0051602 | |||
| 1218 | Ga0373953_0009905 | |||
| 1219 | Ga0373953_0069698 | |||
| 1220 | Ga0373954_0010290 | |||
| 1221 | Ga0373956_0098647 | |||
| 1222 | Ga0373956_0189276 | |||
| 1223 | Ga0373957_0069203 | |||
| 1224 | Ga0373957_0091428 | |||
| 1225 | Ga0373960_0001079 | |||
| 1226 | Ga0373943_0002252 | |||
| 1227 | Ga0373943_0011264 | |||
| 1228 | Ga0373946_0002522 | |||
| 1229 | Ga0373946_0007987 | |||
| 1230 | Ga0373946_0023104 | |||
| 1231 | Ga0373946_0028211 | |||
| 1232 | Ga0373955_0060010 | |||
| 1233 | Ga0373955_0237150 | |||
| 1234 | Ga0373942_0022419 | |||
| 1235 | Ga0373961_0001117 | |||
| 1236 | Ga0373962_0000443 | |||
| 1237 | Ga0373962_0019599 | |||
| 1238 | Ga0373924_0100439 | |||
| 1239 | Ga0373924_0183178 | |||
| 1240 | Ga0373931_0038720 | |||
| 1241 | Ga0373931_0047305 | |||
| 1242 | Ga0373931_0050173 | |||
| 1243 | Ga0373931_0203054 | |||
| 1244 | Ga0373935_0000844 | |||
| 1245 | Ga0373935_0010594 | |||
| 1246 | Ga0373935_0014264 | |||
| 1247 | Ga0373935_0019830 | |||
| 1248 | Ga0373935_0035725 | |||
| 1249 | Ga0373927_0003240 | |||
| 1250 | Ga0373927_0004432 | |||
| 1251 | Ga0373927_0007662 | |||
| 1252 | Ga0373927_0015407 | |||
| 1253 | Ga0373927_0043231 | |||
| 1254 | Ga0373927_0043279 | |||
| 1255 | Ga0373927_0044784 | |||
| 1256 | Ga0373927_0211001 | |||
| 1257 | Ga0373933_0011508 | |||
| 1258 | Ga0373933_0159355 | |||
| 1259 | Ga0373947_0000642 | |||
| 1260 | Ga0373947_0006874 | |||
| 1261 | Ga0373947_0018867 | |||
| 1262 | Ga0373947_0053613 | |||
| 1263 | Ga0373947_0305604 | |||
| 1264 | Ga0373937_0003851 | |||
| 1265 | Ga0373937_0020098 | |||
| 1266 | Ga0373937_0054905 | |||
| 1267 | Ga0373937_0170175 | |||
| 1268 | Ga0373937_0353695 | |||
| 1269 | Ga0373937_0495660 | |||
| 1270 | Ga0373937_0590492 | |||
| 1271 | Ga0373925_0000810 | |||
| 1272 | Ga0373925_0005823 | |||
| 1273 | Ga0373925_0014589 | |||
| 1274 | Ga0373925_0026771 | |||
| 1275 | Ga0373925_0027980 | |||
| 1276 | Ga0373925_0042607 | |||
| 1277 | Ga0373925_0163907 | |||
| 1278 | Ga0373925_0204456 | |||
| 1279 | Ga0373925_0218729 | |||
| 1280 | Ga0373925_0301704 | |||
| 1281 | Ga0373925_0367744 | |||
| 1282 | Ga0373925_0399314 | |||
| 1283 | Ga0373925_0801607 | |||
| 1284 | Ga0395899_0012745 | |||
| 1285 | Ga0395900_0083944 | |||
| 1286 | Ga0395900_0604500 | |||
| 1287 | Ga0395905_0026470 | |||
| 1288 | Ga0395901_0001801 | |||
| 1289 | Ga0395901_0084011 | |||
| 1290 | Ga0395901_0219603 | |||
| 1291 | Ga0436365_1094394 | |||
| 1292 | Ga0436365_1294223 | |||
| 1293 | Ga0436363_0092417 | |||
| 1294 | Ga0436363_0950219 | |||
| 1295 | Ga0436363_1669531 | |||
| 1296 | Ga0466965_0268823 | |||
| 1297 | Ga0453684_0094755 | |||
| 1298 | Ga0466959_0569759 | |||
| 1299 | Ga0451576_0090531 | |||
| 1300 | Ga0495592_0037156 | |||
| 1301 | Ga0495592_0049028 | |||
| 1302 | Ga0495592_0179425 | |||
| 1303 | Ga0495592_0360360 | |||
| 1304 | Ga0495603_0002414 | |||
| 1305 | Ga0495603_0159737 | |||
| 1306 | Ga0495629_0000117 | |||
| 1307 | Ga0495629_0009945 | |||
| 1308 | Ga0495629_0120581 | |||
| 1309 | Ga0495629_0167146 | |||
| 1310 | Ga0495629_0334267 | |||
| 1311 | Ga0495638_0062504 | |||
| 1312 | Ga0495641_0002849 | |||
| 1313 | Ga0495641_0012671 | |||
| 1314 | Ga0495651_0092642 | |||
| 1315 | Ga0495651_0093215 | |||
| 1316 | Ga0495651_0350980 | |||
| 1317 | Ga0495653_0009694 | |||
| 1318 | Ga0495653_0016695 | |||
| 1319 | Ga0495653_0147043 | |||
| 1320 | Ga0495580_0003260 | |||
| 1321 | Ga0495580_0013631 | |||
| 1322 | Ga0495582_0000280 | |||
| 1323 | Ga0495582_0055587 | |||
| 1324 | Ga0495582_0083948 | |||
| 1325 | Ga0495605_0058150 | |||
| 1326 | Ga0495639_0000751 | |||
| 1327 | Ga0495639_0002516 | |||
| 1328 | Ga0495639_0006386 | |||
| 1329 | Ga0495639_0068160 | |||
| 1330 | Ga0495639_0146066 | |||
| 1331 | Ga0495639_0224950 | |||
| 1332 | Ga0495662_0000078 | |||
| 1333 | Ga0495662_0009678 | |||
| 1334 | Ga0495662_0057325 | |||
| 1335 | Ga0495662_0213356 | |||
| 1336 | Ga0495664_0004815 | |||
| 1337 | Ga0495664_0145132 | |||
| 1338 | Ga0495584_0166292 | |||
| 1339 | Ga0495585_0239951 | |||
| 1340 | Ga0495594_0043896 | |||
| 1341 | Ga0495594_0062693 | |||
| 1342 | Ga0495606_0096242 | |||
| 1343 | Ga0495608_0147409 | |||
| 1344 | Ga0495608_0181406 | |||
| 1345 | Ga0495616_0046573 | |||
| 1346 | Ga0495618_0028886 | |||
| 1347 | Ga0495620_0123436 | |||
| 1348 | Ga0495628_0080746 | |||
| 1349 | Ga0495628_0098228 | |||
| 1350 | Ga0495628_0152709 | |||
| 1351 | Ga0495628_0194701 | |||
| 1352 | Ga0495628_0409143 | |||
| 1353 | Ga0495630_0005075 | |||
| 1354 | Ga0495630_0032801 | |||
| 1355 | Ga0495630_0227051 | |||
| 1356 | Ga0495632_0053973 | |||
| 1357 | Ga0495644_0023701 | |||
| 1358 | Ga0495666_0165108 | |||
| 1359 | Ga0495642_0176944 | |||
| 1360 | Ga0495652_0003511 | |||
| 1361 | Ga0495652_0008078 | |||
| 1362 | Ga0495652_0033403 | |||
| 1363 | Ga0495652_0054500 | |||
| 1364 | Ga0495652_0108940 | |||
| 1365 | Ga0495652_0183988 | |||
| 1366 | Ga0495652_0201521 | |||
| 1367 | Ga0495665_0000296 | |||
| 1368 | Ga0495665_0008600 | |||
| 1369 | Ga0495665_0079013 | |||
| 1370 | Ga0495665_0118349 | |||
| 1371 | Ga0495665_0165391 | |||
| 1372 | Ga0495640_0003174 | |||
| 1373 | Ga0495640_0014903 | |||
| 1374 | Ga0495640_0026762 | |||
| 1375 | Ga0495640_0052310 | |||
| 1376 | Ga0495640_0065206 | |||
| 1377 | Ga0495586_0038933 | |||
| 1378 | Ga0495586_0057167 | |||
| 1379 | Ga0495586_0063876 | |||
| 1380 | Ga0495586_0307867 | |||
| 1381 | Ga0495587_0052927 | |||
| 1382 | Ga0495587_0070865 | |||
| 1383 | Ga0495645_0002855 | |||
| 1384 | Ga0495645_0039232 | |||
| 1385 | Ga0495645_0093557 | |||
| 1386 | Ga0495645_0343013 | |||
| 1387 | Ga0495667_0051957 | |||
| 1388 | Ga0495667_0072495 | |||
| 1389 | Ga0495667_0277092 | |||
| 1390 | Ga0495667_0498332 | |||
| 1391 | Ga0495668_0085177 | |||
| 1392 | Ga0495634_0000996 | |||
| 1393 | Ga0495634_0003014 | |||
| 1394 | Ga0495634_0010095 | |||
| 1395 | Ga0495634_0176339 | |||
| 1396 | Ga0495635_0001099 | |||
| 1397 | Ga0495635_0010252 | |||
| 1398 | Ga0495635_0019694 | |||
| 1399 | Ga0495635_0084057 | |||
| 1400 | Ga0495635_0156167 | |||
| 1401 | Ga0495635_0157947 | |||
| 1402 | Ga0495635_0233899 | |||
| 1403 | Ga0495661_0261519 | |||
| 1404 | Ga0495657_0076401 | |||
| 1405 | Ga0495657_0184146 | |||
| 1406 | Ga0495599_0036271 | |||
| 1407 | Ga0495599_0059309 | |||
| 1408 | Ga0495599_0091474 | |||
| 1409 | Ga0495599_0304816 | |||
| 1410 | Ga0495623_0078970 | |||
| 1411 | Ga0495623_0172602 | |||
| 1412 | Ga0495646_0027666 | |||
| 1413 | Ga0495647_0030188 | |||
| 1414 | Ga0495647_0254450 | |||
| 1415 | Ga0495658_0000486 | |||
| 1416 | Ga0495658_0111531 | |||
| 1417 | Ga0495658_0113771 | |||
| 1418 | Ga0495613_0003151 | |||
| 1419 | Ga0495613_0105536 | |||
| 1420 | Ga0495613_0165873 | |||
| 1421 | Ga0495613_0177720 | |||
| 1422 | Ga0495613_0246464 | |||
| 1423 | Ga0495613_0302536 | |||
| 1424 | Ga0495613_0703929 | |||
| 1425 | Ga0495624_0003661 | |||
| 1426 | Ga0495624_0003734 | |||
| 1427 | Ga0495624_0014126 | |||
| 1428 | Ga0495624_0023494 | |||
| 1429 | Ga0495624_0283362 | |||
| 1430 | Ga0495671_0107071 | |||
| 1431 | Ga0495649_0132126 | |||
| 1432 | Ga0495600_0095524 | |||
| 1433 | Ga0495600_0121307 | |||
| 1434 | Ga0495600_0205485 | |||
| 1435 | Ga0495581_0000222 | |||
| 1436 | Ga0495581_0001725 | |||
| 1437 | Ga0495581_0010469 | |||
| 1438 | Ga0495581_0073228 | |||
| 1439 | Ga0495581_0221113 | |||
| 1440 | Ga0495604_0110125 | |||
| 1441 | Ga0495604_0150384 | |||
| 1442 | Ga0495604_0163044 | |||
| 1443 | Ga0495604_0165053 | |||
| 1444 | Ga0495604_0427712 | |||
| 1445 | Ga0495636_0165143 | |||
| 1446 | Ga0495674_0000684 | |||
| 1447 | Ga0495674_0002542 | |||
| 1448 | Ga0495674_0047903 | |||
| 1449 | Ga0495674_0048274 | |||
| 1450 | Ga0495674_0067665 | |||
| 1451 | Ga0495676_0051944 | |||
| 1452 | Ga0495676_0109483 | |||
| 1453 | Ga0495676_0125755 | |||
| 1454 | Ga0495680_0134431 | |||
| 1455 | Ga0495680_0399879 | |||
| 1456 | Ga0495683_0054121 | |||
| 1457 | Ga0495675_0436981 | |||
| 1458 | Ga0495673_0081311 | |||
| 1459 | Ga0495684_0001356 | |||
| 1460 | Ga0495684_0008929 | |||
| 1461 | Ga0495684_0077290 | |||
| 1462 | Ga0495684_0189801 | |||
| 1463 | Ga0495684_0284958 | |||
| 1464 | Ga0495684_0443316 | |||
| 1465 | Ga0495593_0002472 | |||
| 1466 | Ga0495593_0013486 | |||
| 1467 | Ga0495593_0107794 | |||
| 1468 | Ga0495593_0180139 | |||
| 1469 | Ga0495602_0162362 | |||
| 1470 | Ga0495602_0260437 | |||
| 1471 | Ga0495602_0364985 | |||
| 1472 | Ga0496100_0060051 | |||
| 1473 | Ga0496100_0183533 | |||
| 1474 | Ga0496100_0862079 | |||
| 1475 | Ga0496101_0015335 | |||
| 1476 | Ga0496102_0057108 | |||
| 1477 | Ga0496102_0089931 | |||
| 1478 | Ga0496102_0279630 | |||
| 1479 | Ga0496102_0596175 | |||
| 1480 | Ga0496103_0055653 | |||
| 1481 | Ga0496104_0049951 | |||
| 1482 | Ga0496104_0081666 | |||
| 1483 | Ga0496104_0118363 | |||
| 1484 | Ga0496104_0208886 | |||
| 1485 | Ga0496104_0255718 | |||
| 1486 | Ga0496105_0055927 | |||
| 1487 | Ga0496105_0554485 | |||
| 1488 | Ga0496106_0016343 | |||
| 1489 | Ga0496106_0091858 | |||
| 1490 | Ga0496106_0202409 | |||
| 1491 | Ga0496106_0340916 | |||
| 1492 | Ga0496107_0014468 | |||
| 1493 | Ga0496107_0089169 | |||
| 1494 | Ga0496108_0030060 | |||
| 1495 | Ga0496108_0033847 | |||
| 1496 | Ga0496108_0144963 | |||
| 1497 | Ga0496108_0284066 | |||
| 1498 | Ga0496109_0046468 | |||
| 1499 | Ga0496109_0098584 | |||
| 1500 | Ga0496109_0519503 | |||
| 1501 | Ga0496109_0908709 | |||
| 1502 | Ga0496109_0982412 | |||
| 1503 | Ga0496110_0011665 | |||
| 1504 | Ga0496110_0162615 | |||
| 1505 | Ga0496110_0190953 | |||
| 1506 | Ga0496111_0008785 | |||
| 1507 | Ga0496111_0012582 | |||
| 1508 | Ga0496111_0282833 | |||
| 1509 | Ga0496112_0031182 | |||
| 1510 | Ga0496112_0031780 | |||
| 1511 | Ga0496112_0068274 | |||
| 1512 | Ga0496112_0114552 | |||
| 1513 | Ga0496112_0138858 | |||
| 1514 | Ga0496112_0680993 | |||
| 1515 | Ga0496113_0044026 | |||
| 1516 | Ga0496113_0059943 | |||
| 1517 | Ga0496114_0013125 | |||
| 1518 | Ga0496114_0129578 | |||
| 1519 | Ga0496114_0393020 | |||
| 1520 | Ga0496115_0014659 | |||
| 1521 | Ga0496115_0067614 | |||
| 1522 | Ga0496121_0002804 | |||
| 1523 | Ga0496126_0173505 | |||
| 1524 | Ga0501046_0260891 | |||
| 1525 | Ga0501047_0352625 | |||
| 1526 | Ga0501069_0074013 | |||
| 1527 | Ga0501072_0437313 | |||
| 1528 | Ga0501075_0140672 | |||
| 1529 | Ga0501077_0266764 | |||
| 1530 | nmdc:mga0yw44_64371_c1 | |||
| 1531 | nmdc:mga05p37_578_c1 | |||
| 1532 | nmdc:mga09592_3930_c1 | |||
| 1533 | nmdc:mga08y16_47908_c1 | |||
| 1534 | nmdc:mga08y16_641585_c1 | |||
| 1535 | nmdc:mga0n895_387821_c1 | |||
| 1536 | nmdc:mga0n895_412041_c1 | |||
| 1537 | nmdc:mga0n895_44127_c1 | |||
| 1538 | nmdc:mga0n895_574585_c1 | |||
| 1539 | nmdc:mga0rr50_460401_c1 | |||
| 1540 | nmdc:mga08x19_206790_c1 | |||
| 1541 | nmdc:mga0a205_17986_c1 | |||
| 1542 | Ga0495601_0001859 | |||
| 1543 | Ga0495601_0004536 | |||
| 1544 | Ga0495601_0011341 | |||
| 1545 | Ga0495601_0038828 | |||
| 1546 | Ga0495601_0052006 | |||
| 1547 | Ga0495601_0062944 | |||
| 1548 | Ga0495601_0427432 | |||
| 1549 | Ga0495612_0002164 | |||
| 1550 | Ga0495612_0002796 | |||
| 1551 | Ga0495612_0060244 | |||
| 1552 | Ga0495595_0025605 | |||
| 1553 | Ga0495595_0034689 | |||
| 1554 | Ga0495595_0070694 | |||
| 1555 | Ga0495595_0075813 | |||
| 1556 | Ga0495595_0076668 | |||
| 1557 | Ga0495595_0134105 | |||
| 1558 | Ga0495619_0006088 | |||
| 1559 | Ga0495619_0006186 | |||
| 1560 | Ga0495619_0006430 | |||
| 1561 | Ga0495619_0015577 | |||
| 1562 | Ga0495619_0018816 | |||
| 1563 | Ga0495619_0037424 | |||
| 1564 | Ga0495619_0071352 | |||
| 1565 | Ga0495619_0188883 | |||
| 1566 | Ga0500583_0002057 | |||
| 1567 | Ga0500595_021079 | |||
| 1568 | Ga0501082_0171098 | |||
| 1569 | 2515690630 | |||
| 1570 | 2849083345 | |||
| 1571 | 2937852748 | |||
| 1572 | 2958052129 | |||
| 1573 | 2970472479 | |||
| 1574 | 3004218504 | |||
| 1575 | 3004223650 | |||
| 1576 | 3004276591 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1soy-assembly1.cif.gz_A | solution structure of the bacterial frataxin orthologue, cyay | 0.6327 | 126 | 178 |
| 6vda-assembly1.cif.gz_A-2 | metal-bound c-terminal domain of czcd transporter from thermotoga maritima | 0.6161 | 79 | 127 |
| 2zzt-assembly1.cif.gz_A-2 | crystal structure of the cytosolic domain of the cation diffusion facilitator family protein | 0.5986 | 78 | 127 |
| 5okc-assembly1.cif.gz_H | crystal structure of the ctf18-1-8 module from ctf18-rfc | 0.5347 | 128 | 163 |
| 5msm-assembly2.cif.gz_E | structure of the dcc1-ctf8-ctf18c trimer | 0.527 | 128 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D0I2_304_459_3.30.70.1350 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain | 0.5626 | 79 | 127 | 3.30.70.1350 |
| 2e8fA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.5425 | 80 | 125 | 3.30.300.20 |
| af_A0A0R0JAC1_523_741_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.5344 | 65 | 125 | 3.60.10.10 |
| 1vw5j00 | Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor | 0.5247 | 79 | 133 | 3.30.429.10 |
| af_P85515_1_101_2.60.40.1940 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.5174 | 126 | 143 | 2.60.40.1940 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A330HTX0-F1-model_v4 | DUF1326 domain-containing protein | 0.999 | 5 | 208 |
|
| AF-A0A7R6Y2C9-F1-model_v4 | deleted | 0.9984 | 3 | 208 |
|
| AF-A0A7R6WUQ5-F1-model_v4 | DUF1326 domain-containing protein | 0.9981 | 1 | 208 |
|
| AF-A0A502ZP63-F1-model_v4 | DUF1326 domain-containing protein | 0.9966 | 5 | 208 |
|
| AF-A0A537SA16-F1-model_v4 | DUF1326 domain-containing protein | 0.9956 | 3 | 208 |
|