F480855

General Info

Members Datasets Scaffolds Average Seq Length
788 352 1576 210

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10014027|JGI25404J52841_100140271
Length 246
Sequence MNVHSRAPDRYTALPIAMPAPHLTAICYGPARFIGEAKMAAVWQISGDYFENCNCSVVCPCLVSKSAPLTSKPTEGVCDVALMFHIENGSYEGTALDNLNVALAVHAPGPMADGNWAVAAYIDERANDGQTEALGAIFTGAAGGPMAHFAPLIAKNLGVKKVPISYSVKGKTRSAEIPGILHMSVDPLPTAHPSGEMWANVGHPVSPDKLALAVGAPGNTFNDHGMRWDNSGKNGHYAPIRWSSTS

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
10 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
107 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
108 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
128 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
129 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
285 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
286 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
287 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
305 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
343 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
346 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
347 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
348 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
349 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
350 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
351 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
352 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.89
Isolates 1.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0.63
Rhizoplane 6.35
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10014027 3300003659 Bacteria 1738
2 2214759110 2209111006 Bacteria 3000
3 ARSoilYngRDRAFT_c00056 3300000042 Bacteria 18475
4 ARcpr5yngRDRAFT_c000087 3300000043 Bacteria 14971
5 ARSoilOldRDRAFT_c000087 3300000044 Bacteria 17353
6 ARCol0oldRDRAFT_c00189 3300000045 Bacteria 5614
7 ARCol0yngRDRAFT_1000076 3300000652 Bacteria 18618
8 JGI24751J29686_10007510 3300002459 Bacteria 2228
9 JGI25404J52841_10003182 3300003659 Bacteria 3215
10 JGI25404J52841_10006590 3300003659 Bacteria 2437
11 JGI25404J52841_10008867 3300003659 Bacteria 2146
12 Ga0065717_1002162 3300005276 Bacteria 2668
13 Ga0065716_1001866 3300005277 Bacteria 2956
14 Ga0065704_10143605 3300005289 Bacteria 1494
15 Ga0065715_10106446 3300005293 Bacteria 2828
16 Ga0065715_10126637 3300005293 Bacteria 2096
17 Ga0065707_10106977 3300005295 Bacteria 2574
18 Ga0065707_10136913 3300005295 Bacteria 1827
19 Ga0070676_10231106 3300005328 Bacteria 1226
20 Ga0070690_100551212 3300005330 Bacteria 869
21 Ga0070666_10129936 3300005335 Bacteria 1750
22 Ga0070680_100030343 3300005336 Bacteria 4343
23 Ga0070680_100047675 3300005336 Bacteria 3489
24 Ga0070682_100026653 3300005337 Bacteria 3461
25 Ga0068868_100402225 3300005338 Bacteria 1182
26 Ga0070660_100023793 3300005339 Bacteria 4540
27 Ga0070689_100012861 3300005340 Bacteria 6042
28 Ga0070691_10178556 3300005341 Bacteria 1104
29 Ga0070687_100368960 3300005343 Bacteria 932
30 Ga0070669_100397382 3300005353 Bacteria 1127
31 Ga0070675_100211972 3300005354 Bacteria 1684
32 Ga0070671_100000745 3300005355 Bacteria 23338
33 Ga0070671_100005255 3300005355 Bacteria 10320
34 Ga0070671_100090152 3300005355 Bacteria 2567
35 Ga0070671_100169898 3300005355 Bacteria 1844
36 Ga0070674_100052015 3300005356 Bacteria 2824
37 Ga0070674_100554656 3300005356 Bacteria 965
38 Ga0070673_100020425 3300005364 Bacteria 4778
39 Ga0070688_100255742 3300005365 Bacteria 1249
40 Ga0070688_100575917 3300005365 Bacteria 859
41 Ga0070659_100241398 3300005366 Bacteria 1495
42 Ga0070667_100733666 3300005367 Bacteria 915
43 Ga0070709_10008513 3300005434 Bacteria 5636
44 Ga0070709_10097818 3300005434 Bacteria 1949
45 Ga0070709_10261352 3300005434 Bacteria 1251
46 Ga0070709_10287636 3300005434 Bacteria 1197
47 Ga0070714_100057034 3300005435 Bacteria 3342
48 Ga0070714_100150865 3300005435 Bacteria 2094
49 Ga0070713_100051794 3300005436 Bacteria 3396
50 Ga0070713_100093571 3300005436 Bacteria 2590
51 Ga0070713_100171766 3300005436 Bacteria 1942
52 Ga0070713_100193288 3300005436 Bacteria 1835
53 Ga0070713_100368157 3300005436 Bacteria 1336
54 Ga0070713_100581745 3300005436 Bacteria 1062
55 Ga0070710_10015607 3300005437 Bacteria 3848
56 Ga0070710_10017856 3300005437 Bacteria 3641
57 Ga0070711_100050490 3300005439 Bacteria 2853
58 Ga0070711_100052580 3300005439 Bacteria 2803
59 Ga0070711_100125194 3300005439 Bacteria 1907
60 Ga0070711_100194004 3300005439 Bacteria 1563
61 Ga0070711_100359264 3300005439 Bacteria 1173
62 Ga0070711_100584031 3300005439 Bacteria 930
63 Ga0070700_100142862 3300005441 Bacteria 1629
64 Ga0070694_100137317 3300005444 Bacteria 1773
65 Ga0070663_100113115 3300005455 Bacteria 2042
66 Ga0070662_100078545 3300005457 Bacteria 2452
67 Ga0070662_100209464 3300005457 Bacteria 1551
68 Ga0070681_10024148 3300005458 Bacteria 6121
69 Ga0070681_10083405 3300005458 Bacteria 3150
70 Ga0070681_10304738 3300005458 Bacteria 1502
71 Ga0068867_100556696 3300005459 Bacteria 994
72 Ga0068867_100678654 3300005459 Bacteria 907
73 Ga0070706_100105465 3300005467 Bacteria 2622
74 Ga0070706_100730708 3300005467 Bacteria 918
75 Ga0070706_101271159 3300005467 Unclassified 675
76 Ga0070698_100201202 3300005471 Bacteria 1927
77 Ga0074259_10685891 3300005507 Bacteria 924
78 Ga0070699_100255695 3300005518 Bacteria 1566
79 Ga0070679_100022095 3300005530 Bacteria 6215
80 Ga0070679_100074040 3300005530 Bacteria 3396
81 Ga0070684_100493408 3300005535 Bacteria 1134
82 Ga0070684_100624942 3300005535 Bacteria 1002
83 Ga0070697_100012814 3300005536 Bacteria 6568
84 Ga0070697_100061990 3300005536 Bacteria 3051
85 Ga0070697_100355631 3300005536 Bacteria 1265
86 Ga0068853_100198105 3300005539 Bacteria 1827
87 Ga0068853_100694785 3300005539 Bacteria 970
88 Ga0068853_100716567 3300005539 Bacteria 955
89 Ga0070672_100097944 3300005543 Bacteria 2375
90 Ga0070672_100158742 3300005543 Bacteria 1875
91 Ga0070672_100654542 3300005543 Bacteria 918
92 Ga0070686_100045571 3300005544 Bacteria 2763
93 Ga0070686_100089518 3300005544 Bacteria 2056
94 Ga0070686_100590509 3300005544 Bacteria 874
95 Ga0070686_100605796 3300005544 Bacteria 864
96 Ga0070695_100077478 3300005545 Bacteria 2191
97 Ga0070693_100242487 3300005547 Bacteria 1191
98 Ga0070693_100334082 3300005547 Bacteria 1032
99 Ga0070665_100041089 3300005548 Bacteria 4647
100 Ga0070665_100235078 3300005548 Bacteria 1833
101 Ga0070665_100944393 3300005548 Bacteria 875
102 Ga0070704_100048584 3300005549 Bacteria 2971
103 Ga0068855_100997918 3300005563 Bacteria 880
104 Ga0070664_100179180 3300005564 Bacteria 1883
105 Ga0070664_100229940 3300005564 Bacteria 1662
106 Ga0070664_100337223 3300005564 Bacteria 1369
107 Ga0068857_100493139 3300005577 Bacteria 1149
108 Ga0068854_100334899 3300005578 Bacteria 1234
109 Ga0068854_100372973 3300005578 Bacteria 1174
110 Ga0068856_100169035 3300005614 Bacteria 2198
111 Ga0068856_100348872 3300005614 Bacteria 1498
112 Ga0068856_100502288 3300005614 Bacteria 1234
113 Ga0068856_101024860 3300005614 Bacteria 843
114 Ga0070702_100346485 3300005615 Bacteria 1045
115 Ga0070702_100532259 3300005615 Bacteria 869
116 Ga0068852_100032612 3300005616 Bacteria 4315
117 Ga0068852_100297126 3300005616 Bacteria 1562
118 Ga0068859_100000579 3300005617 Bacteria 36523
119 Ga0068859_100038156 3300005617 Bacteria 4820
120 Ga0068859_100254391 3300005617 Bacteria 1847
121 Ga0068859_101293982 3300005617 Bacteria 803
122 Ga0068864_100218019 3300005618 Bacteria 1759
123 Ga0068866_10093236 3300005718 Bacteria 1645
124 Ga0068861_100193618 3300005719 Bacteria 1702
125 Ga0068851_10190900 3300005834 Bacteria 1139
126 Ga0068863_100001862 3300005841 Bacteria 20969
127 Ga0068863_100797586 3300005841 Bacteria 942
128 Ga0068858_100002351 3300005842 Bacteria 19106
129 Ga0068858_100176864 3300005842 Bacteria 2014
130 Ga0068860_100203573 3300005843 Bacteria 1919
131 Ga0068860_100357653 3300005843 Bacteria 1438
132 Ga0068862_100085514 3300005844 Bacteria 2741
133 Ga0068862_101025186 3300005844 Bacteria 817
134 Ga0081455_10000354 3300005937 Bacteria 60535
135 Ga0081455_10006105 3300005937 Bacteria 13014
136 Ga0081455_10044470 3300005937 Bacteria 3873
137 Ga0081455_10059433 3300005937 Bacteria 3228
138 Ga0081455_10072968 3300005937 Bacteria 2839
139 Ga0081455_10082946 3300005937 Bacteria 2621
140 Ga0081455_10119511 3300005937 Bacteria 2078
141 Ga0081455_10240248 3300005937 Bacteria 1331
142 Ga0081455_10248572 3300005937 Bacteria 1302
143 Ga0081540_1000055 3300005983 Bacteria 122642
144 Ga0081540_1000075 3300005983 Bacteria 106804
145 Ga0081540_1002306 3300005983 Bacteria 15659
146 Ga0081540_1003603 3300005983 Bacteria 12154
147 Ga0081540_1011401 3300005983 Bacteria 5942
148 Ga0081540_1015638 3300005983 Bacteria 4794
149 Ga0081540_1020205 3300005983 Bacteria 4016
150 Ga0081540_1020840 3300005983 Bacteria 3927
151 Ga0081540_1026165 3300005983 Bacteria 3337
152 Ga0081540_1027929 3300005983 Bacteria 3183
153 Ga0081539_10000209 3300005985 Bacteria 136637
154 Ga0081539_10004192 3300005985 Bacteria 16296
155 Ga0070717_10027109 3300006028 Bacteria 4576
156 Ga0070717_10159098 3300006028 Bacteria 1959
157 Ga0070717_10164544 3300006028 Bacteria 1926
158 Ga0070717_10181382 3300006028 Bacteria 1835
159 Ga0070717_10263038 3300006028 Bacteria 1527
160 Ga0075365_10068220 3300006038 Bacteria 2389
161 Ga0075365_10173304 3300006038 Bacteria 1506
162 Ga0070715_10211779 3300006163 Bacteria 991
163 Ga0070716_100099163 3300006173 Bacteria 1782
164 Ga0070716_100111737 3300006173 Bacteria 1695
165 Ga0070716_100613081 3300006173 Bacteria 820
166 Ga0070712_100012839 3300006175 Bacteria 5333
167 Ga0070712_100025006 3300006175 Bacteria 3964
168 Ga0070712_100028936 3300006175 Bacteria 3711
169 Ga0070712_100117691 3300006175 Bacteria 1994
170 Ga0070712_100215467 3300006175 Bacteria 1517
171 Ga0070712_100498484 3300006175 Bacteria 1020
172 Ga0070712_100579418 3300006175 Bacteria 948
173 Ga0070712_100792552 3300006175 Bacteria 813
174 Ga0097621_100676022 3300006237 Bacteria 949
175 Ga0097621_100713919 3300006237 Bacteria 924
176 Ga0068871_100481928 3300006358 Bacteria 1116
177 Ga0075428_100075095 3300006844 Bacteria 3692
178 Ga0075428_100560431 3300006844 Bacteria 1221
179 Ga0075433_10083334 3300006852 Bacteria 2822
180 Ga0075433_10222728 3300006852 Bacteria 1675
181 Ga0075434_100039041 3300006871 Bacteria 4704
182 Ga0075434_100123877 3300006871 Bacteria 2601
183 Ga0075434_100342542 3300006871 Bacteria 1516
184 Ga0075429_100011921 3300006880 Bacteria 7538
185 Ga0097620_100000579 3300006931 Bacteria 36523
186 Ga0097620_100038156 3300006931 Bacteria 4820
187 Ga0097620_100254372 3300006931 Bacteria 1847
188 Ga0097620_101293759 3300006931 Bacteria 803
189 Ga0075435_100446992 3300007076 Bacteria 1114
190 Ga0099794_10006930 3300007265 Bacteria 4623
191 Ga0105250_10083473 3300009092 Bacteria 1296
192 Ga0105240_10098984 3300009093 Bacteria 3550
193 Ga0105240_10144979 3300009093 Bacteria 2835
194 Ga0105240_10527731 3300009093 Bacteria 1309
195 Ga0111539_10001365 3300009094 Bacteria 32515
196 Ga0111539_10609924 3300009094 Bacteria 1271
197 Ga0105245_10056904 3300009098 Bacteria 3516
198 Ga0105247_10001257 3300009101 Bacteria 18792
199 Ga0105247_10010609 3300009101 Bacteria 5564
200 Ga0105247_10035823 3300009101 Bacteria 3026
201 Ga0114129_10006147 3300009147 Bacteria 17031
202 Ga0114129_10478663 3300009147 Bacteria 1629
203 Ga0114129_10597448 3300009147 Bacteria 1430
204 Ga0105243_10042966 3300009148 Bacteria 3541
205 Ga0105243_10062475 3300009148 Bacteria 2982
206 Ga0105243_10101758 3300009148 Bacteria 2386
207 Ga0105241_10103593 3300009174 Bacteria 2266
208 Ga0105241_10270902 3300009174 Bacteria 1446
209 Ga0105241_10299661 3300009174 Bacteria 1379
210 Ga0105242_10102413 3300009176 Bacteria 2428
211 Ga0105248_10039393 3300009177 Bacteria 5292
212 Ga0105248_10080677 3300009177 Bacteria 3657
213 Ga0105248_10360162 3300009177 Bacteria 1637
214 Ga0105237_10169403 3300009545 Bacteria 2184
215 Ga0105237_10277533 3300009545 Bacteria 1678
216 Ga0105238_10029067 3300009551 Bacteria 5631
217 Ga0105238_11260141 3300009551 Unclassified 765
218 Ga0105249_10084671 3300009553 Bacteria 2953
219 Ga0105249_10509264 3300009553 Bacteria 1250
220 Ga0105249_10812959 3300009553 Bacteria 999
221 Ga0099796_10073672 3300010159 Bacteria 1238
222 Ga0105239_10032427 3300010375 Bacteria 5740
223 Ga0105239_10142809 3300010375 Bacteria 2669
224 Ga0105239_11194281 3300010375 Unclassified 876
225 Ga0105246_10085263 3300011119 Bacteria 2262
226 Ga0105246_10162775 3300011119 Bacteria 1701
227 Ga0105246_10398592 3300011119 Bacteria 1142
228 Ga0105246_10471581 3300011119 Bacteria 1060
229 Ga0157321_1000258 3300012487 Bacteria 2445
230 Ga0157335_1001024 3300012492 Bacteria 1437
231 Ga0157326_1015693 3300012513 Bacteria 892
232 Ga0157370_10015231 3300013104 Bacteria 7828
233 Ga0157370_10222469 3300013104 Bacteria 1748
234 Ga0157369_10815653 3300013105 Bacteria 958
235 Ga0157369_10957912 3300013105 Bacteria 877
236 Ga0157378_10477724 3300013297 Bacteria 1241
237 Ga0163162_10121070 3300013306 Bacteria 2721
238 Ga0163162_10466678 3300013306 Bacteria 1394
239 Ga0163162_10521536 3300013306 Bacteria 1318
240 Ga0163162_11457725 3300013306 Bacteria 779
241 Ga0157372_10340657 3300013307 Bacteria 1746
242 Ga0157372_10752903 3300013307 Bacteria 1133
243 Ga0157375_10057270 3300013308 Bacteria 3851
244 Ga0157375_10075075 3300013308 Bacteria 3404
245 Ga0157375_10989970 3300013308 Bacteria 981
246 Ga0163163_10022041 3300014325 Bacteria 6023
247 Ga0182008_10014572 3300014497 Bacteria 4113
248 Ga0157377_10060047 3300014745 Bacteria 2170
249 Ga0157377_10391761 3300014745 Bacteria 944
250 Ga0157379_10336707 3300014968 Bacteria 1379
251 Ga0157379_10611825 3300014968 Bacteria 1018
252 Ga0157379_10686393 3300014968 Bacteria 960
253 Ga0157379_10767490 3300014968 Bacteria 908
254 Ga0157376_10498795 3300014969 Bacteria 1196
255 Ga0157376_10523695 3300014969 Bacteria 1169
256 Ga0182007_10018951 3300015262 Unclassified 2483
257 Ga0163161_10042292 3300017792 Bacteria 3277
258 Ga0163161_10382872 3300017792 Bacteria 1125
259 Ga0197907_10512701 3300020069 Unclassified 869
260 Ga0206356_11356092 3300020070 Bacteria 824
261 Ga0206351_10203003 3300020077 Unclassified 792
262 Ga0206354_11401222 3300020081 Bacteria 767
263 Ga0206353_10146507 3300020082 Unclassified 784
264 Ga0213873_10022209 3300021358 Bacteria 1501
265 Ga0213874_10045108 3300021377 Bacteria 1334
266 Ga0224712_10290964 3300022467 Bacteria 762
267 Ga0224712_10353777 3300022467 Bacteria 694
268 Ga0209148_1008961 3300025254 Bacteria 1980
269 Ga0209051_1001604 3300025303 Bacteria 18452
270 Ga0207692_10023590 3300025898 Bacteria 2847
271 Ga0207692_10038188 3300025898 Bacteria 2354
272 Ga0207692_10065868 3300025898 Bacteria 1892
273 Ga0207692_10101364 3300025898 Bacteria 1581
274 Ga0207692_10108267 3300025898 Bacteria 1537
275 Ga0207692_10283650 3300025898 Unclassified 1003
276 Ga0207642_10125251 3300025899 Bacteria 1332
277 Ga0207710_10000321 3300025900 Bacteria 36685
278 Ga0207688_10086444 3300025901 Bacteria 1797
279 Ga0207688_10336252 3300025901 Bacteria 928
280 Ga0207680_10037074 3300025903 Bacteria 2813
281 Ga0207647_10231429 3300025904 Bacteria 1063
282 Ga0207685_10115378 3300025905 Bacteria 1171
283 Ga0207699_10462742 3300025906 Bacteria 911
284 Ga0207699_10486897 3300025906 Bacteria 889
285 Ga0207705_10463924 3300025909 Bacteria 983
286 Ga0207684_10088723 3300025910 Bacteria 2635
287 Ga0207684_10492217 3300025910 Bacteria 1051
288 Ga0207654_10056710 3300025911 Bacteria 2273
289 Ga0207707_10000754 3300025912 Bacteria 31878
290 Ga0207707_10036412 3300025912 Bacteria 4302
291 Ga0207707_10157210 3300025912 Bacteria 1988
292 Ga0207695_10100066 3300025913 Bacteria 2895
293 Ga0207695_10154608 3300025913 Bacteria 2229
294 Ga0207695_10278000 3300025913 Bacteria 1568
295 Ga0207671_10368916 3300025914 Bacteria 1140
296 Ga0207671_10516084 3300025914 Bacteria 953
297 Ga0207693_10001869 3300025915 Bacteria 18434
298 Ga0207693_10018489 3300025915 Bacteria 5551
299 Ga0207693_10040514 3300025915 Bacteria 3669
300 Ga0207693_10045432 3300025915 Bacteria 3451
301 Ga0207693_10100752 3300025915 Bacteria 2265
302 Ga0207693_10252189 3300025915 Bacteria 1385
303 Ga0207693_10426109 3300025915 Bacteria 1037
304 Ga0207693_10642886 3300025915 Bacteria 824
305 Ga0207663_10026941 3300025916 Bacteria 3343
306 Ga0207663_10034683 3300025916 Bacteria 3020
307 Ga0207663_10105511 3300025916 Bacteria 1902
308 Ga0207663_10341302 3300025916 Bacteria 1131
309 Ga0207660_10080267 3300025917 Bacteria 2395
310 Ga0207660_10567490 3300025917 Bacteria 923
311 Ga0207662_10193743 3300025918 Bacteria 1313
312 Ga0207657_10101835 3300025919 Bacteria 2383
313 Ga0207649_10557998 3300025920 Bacteria 877
314 Ga0207652_10037202 3300025921 Bacteria 4119
315 Ga0207681_10268629 3300025923 Bacteria 1338
316 Ga0207681_10500128 3300025923 Bacteria 995
317 Ga0207694_10018204 3300025924 Bacteria 5311
318 Ga0207650_10010743 3300025925 Bacteria 6285
319 Ga0207659_10004652 3300025926 Bacteria 8311
320 Ga0207687_10075132 3300025927 Bacteria 2424
321 Ga0207687_10153830 3300025927 Bacteria 1758
322 Ga0207700_10011038 3300025928 Bacteria 5739
323 Ga0207700_10043491 3300025928 Bacteria 3300
324 Ga0207700_10371104 3300025928 Bacteria 1249
325 Ga0207700_10409601 3300025928 Bacteria 1189
326 Ga0207700_10677268 3300025928 Bacteria 920
327 Ga0207664_10044924 3300025929 Bacteria 3462
328 Ga0207664_10075674 3300025929 Bacteria 2722
329 Ga0207664_10113757 3300025929 Bacteria 2254
330 Ga0207664_10179154 3300025929 Bacteria 1819
331 Ga0207664_10470945 3300025929 Bacteria 1123
332 Ga0207664_10545256 3300025929 Bacteria 1040
333 Ga0207664_10580221 3300025929 Bacteria 1007
334 Ga0207664_10871105 3300025929 Bacteria 809
335 Ga0207664_10901050 3300025929 Bacteria 794
336 Ga0207644_10004666 3300025931 Bacteria 8906
337 Ga0207644_10009370 3300025931 Bacteria 6431
338 Ga0207644_10307976 3300025931 Bacteria 1278
339 Ga0207706_10067446 3300025933 Bacteria 3147
340 Ga0207706_10406582 3300025933 Bacteria 1180
341 Ga0207686_10170956 3300025934 Bacteria 1532
342 Ga0207709_10132782 3300025935 Bacteria 1699
343 Ga0207709_10180470 3300025935 Bacteria 1490
344 Ga0207709_10296887 3300025935 Bacteria 1200
345 Ga0207670_10247962 3300025936 Bacteria 1375
346 Ga0207669_10941357 3300025937 Bacteria 723
347 Ga0207665_10091379 3300025939 Bacteria 2110
348 Ga0207665_10153945 3300025939 Bacteria 1649
349 Ga0207665_10260810 3300025939 Bacteria 1284
350 Ga0207691_10126618 3300025940 Bacteria 2260
351 Ga0207691_10160693 3300025940 Bacteria 1971
352 Ga0207691_10412210 3300025940 Bacteria 1152
353 Ga0207711_10374337 3300025941 Bacteria 1321
354 Ga0207711_10543526 3300025941 Bacteria 1084
355 Ga0207661_10654240 3300025944 Bacteria 966
356 Ga0207679_10061391 3300025945 Bacteria 2798
357 Ga0207679_10635792 3300025945 Bacteria 964
358 Ga0207667_10374241 3300025949 Bacteria 1451
359 Ga0207667_11304521 3300025949 Bacteria 702
360 Ga0207651_10012715 3300025960 Bacteria 4778
361 Ga0207712_10085297 3300025961 Bacteria 2310
362 Ga0207668_10259563 3300025972 Bacteria 1415
363 Ga0207640_10441816 3300025981 Bacteria 1070
364 Ga0207640_10654688 3300025981 Bacteria 895
365 Ga0207658_10008550 3300025986 Bacteria 6963
366 Ga0207658_10205649 3300025986 Bacteria 1647
367 Ga0207658_10632175 3300025986 Bacteria 964
368 Ga0207658_10703269 3300025986 Bacteria 913
369 Ga0207677_10568253 3300026023 Bacteria 991
370 Ga0207703_10005117 3300026035 Bacteria 10610
371 Ga0207703_10457311 3300026035 Bacteria 1193
372 Ga0207639_10174451 3300026041 Bacteria 1824
373 Ga0207639_10507643 3300026041 Bacteria 1102
374 Ga0207639_11072726 3300026041 Bacteria 755
375 Ga0207678_10067104 3300026067 Bacteria 3079
376 Ga0207678_10155277 3300026067 Bacteria 1954
377 Ga0207708_10374517 3300026075 Bacteria 1173
378 Ga0207702_10059159 3300026078 Bacteria 3264
379 Ga0207702_10081019 3300026078 Bacteria 2818
380 Ga0207702_11032571 3300026078 Bacteria 816
381 Ga0207641_10027983 3300026088 Bacteria 4656
382 Ga0207648_10083146 3300026089 Bacteria 2792
383 Ga0207676_10258314 3300026095 Bacteria 1571
384 Ga0207674_10072530 3300026116 Bacteria 3459
385 Ga0207675_100050193 3300026118 Bacteria 3893
386 Ga0207675_100107815 3300026118 Bacteria 2627
387 Ga0207683_10447825 3300026121 Bacteria 1190
388 Ga0207683_10620120 3300026121 Bacteria 1002
389 Ga0207698_10218568 3300026142 Bacteria 1720
390 Ga0207698_10932563 3300026142 Bacteria 877
391 Ga0209588_1015403 3300027671 Bacteria 2351
392 Ga0207428_10052816 3300027907 Bacteria 3243
393 Ga0207428_10513537 3300027907 Bacteria 869
394 Ga0268266_10108350 3300028379 Bacteria 2458
395 Ga0268266_11087466 3300028379 Bacteria 774
396 Ga0268265_10516421 3300028380 Bacteria 1128
397 Ga0268264_10148467 3300028381 Bacteria 2099
398 Ga0307509_10022472 3300031507 Bacteria 7108
399 Ga0307509_10083352 3300031507 Bacteria 3296
400 Ga0307509_10120381 3300031507 Bacteria 2604
401 Ga0265313_10001357 3300031595 Bacteria 23065
402 Ga0373930_0003209 3300034816 Bacteria 2584
403 Ga0373948_0000835 3300034817 Bacteria 4076
404 Ga0373950_0000174 3300034818 Bacteria 9151
405 Ga0373959_0003847 3300034820 Bacteria 2403
406 Ga0373938_0000152 3300034957 Bacteria 10044
407 Ga0373926_0045504 3300035083 Bacteria 1573
408 Ga0373926_0077200 3300035083 Bacteria 1229
409 Ga0373928_0001004 3300035084 Bacteria 5532
410 Ga0373929_0000088 3300035085 Bacteria 15260
411 Ga0373940_0000067 3300035088 Bacteria 11804
412 Ga0373944_0002667 3300035089 Bacteria 4546
413 Ga0373944_0045249 3300035089 Bacteria 1373
414 Ga0373949_0000825 3300035090 Bacteria 9872
415 Ga0373949_0051539 3300035090 Bacteria 1038
416 Ga0373951_0000361 3300035091 Bacteria 13672
417 Ga0373952_0000776 3300035092 Bacteria 5745
418 Ga0373952_0116121 3300035092 Bacteria 721
419 Ga0373923_0349205 3300035111 Bacteria 706
420 Ga0373932_0000315 3300035112 Bacteria 14731
421 Ga0373932_0148679 3300035112 Bacteria 802
422 Ga0373936_0005700 3300035113 Bacteria 4699
423 Ga0373936_0173973 3300035113 Bacteria 942
424 Ga0373939_0000202 3300035114 Bacteria 16524
425 Ga0373939_0155010 3300035114 Bacteria 837
426 Ga0373941_0000272 3300035115 Bacteria 9963
427 Ga0373945_0020386 3300035116 Bacteria 2269
428 Ga0373945_0034457 3300035116 Bacteria 1804
429 Ga0373945_0051602 3300035116 Bacteria 1513
430 Ga0373953_0009905 3300035117 Bacteria 3301
431 Ga0373953_0069698 3300035117 Bacteria 1449
432 Ga0373954_0010290 3300035118 Bacteria 4126
433 Ga0373956_0098647 3300035119 Bacteria 1353
434 Ga0373956_0189276 3300035119 Bacteria 974
435 Ga0373957_0069203 3300035120 Bacteria 1378
436 Ga0373957_0091428 3300035120 Bacteria 1210
437 Ga0373960_0001079 3300035121 Bacteria 5889
438 Ga0373943_0002252 3300035170 Bacteria 8763
439 Ga0373943_0011264 3300035170 Bacteria 4023
440 Ga0373946_0002522 3300035171 Bacteria 6466
441 Ga0373946_0007987 3300035171 Bacteria 3887
442 Ga0373946_0023104 3300035171 Bacteria 2427
443 Ga0373946_0028211 3300035171 Bacteria 2225
444 Ga0373955_0060010 3300035172 Bacteria 2096
445 Ga0373955_0237150 3300035172 Unclassified 1092
446 Ga0373942_0022419 3300035207 Bacteria 1602
447 Ga0373961_0001117 3300035241 Bacteria 8464
448 Ga0373962_0000443 3300035242 Bacteria 9060
449 Ga0373962_0019599 3300035242 Bacteria 1771
450 Ga0373924_0100439 3300035410 Bacteria 1244
451 Ga0373924_0183178 3300035410 Bacteria 922
452 Ga0373931_0038720 3300035691 Bacteria 2495
453 Ga0373931_0047305 3300035691 Bacteria 2277
454 Ga0373931_0050173 3300035691 Bacteria 2219
455 Ga0373931_0203054 3300035691 Bacteria 1185
456 Ga0373935_0000844 3300035692 Bacteria 16529
457 Ga0373935_0010594 3300035692 Bacteria 5532
458 Ga0373935_0014264 3300035692 Bacteria 4796
459 Ga0373935_0019830 3300035692 Bacteria 4104
460 Ga0373935_0035725 3300035692 Bacteria 3102
461 Ga0373927_0003240 3300035695 Bacteria 11709
462 Ga0373927_0004432 3300035695 Bacteria 9836
463 Ga0373927_0007662 3300035695 Bacteria 7306
464 Ga0373927_0015407 3300035695 Bacteria 5052
465 Ga0373927_0043231 3300035695 Bacteria 2918
466 Ga0373927_0043279 3300035695 Bacteria 2915
467 Ga0373927_0044784 3300035695 Bacteria 2862
468 Ga0373927_0211001 3300035695 Bacteria 1275
469 Ga0373933_0011508 3300035724 Bacteria 4881
470 Ga0373933_0159355 3300035724 Bacteria 1432
471 Ga0373947_0000642 3300035725 Bacteria 20669
472 Ga0373947_0006874 3300035725 Bacteria 6597
473 Ga0373947_0018867 3300035725 Bacteria 3973
474 Ga0373947_0053613 3300035725 Bacteria 2432
475 Ga0373947_0305604 3300035725 Bacteria 1061
476 Ga0373937_0003851 3300036401 Bacteria 12686
477 Ga0373937_0020098 3300036401 Bacteria 5984
478 Ga0373937_0054905 3300036401 Bacteria 3656
479 Ga0373937_0170175 3300036401 Bacteria 2044
480 Ga0373937_0353695 3300036401 Bacteria 1392
481 Ga0373937_0495660 3300036401 Bacteria 1160
482 Ga0373937_0590492 3300036401 Bacteria 1054
483 Ga0373925_0000810 3300037068 Bacteria 28845
484 Ga0373925_0005823 3300037068 Bacteria 9148
485 Ga0373925_0014589 3300037068 Bacteria 5678
486 Ga0373925_0026771 3300037068 Bacteria 4221
487 Ga0373925_0027980 3300037068 Bacteria 4128
488 Ga0373925_0042607 3300037068 Bacteria 3367
489 Ga0373925_0163907 3300037068 Bacteria 1752
490 Ga0373925_0204456 3300037068 Bacteria 1571
491 Ga0373925_0218729 3300037068 Bacteria 1520
492 Ga0373925_0301704 3300037068 Bacteria 1293
493 Ga0373925_0367744 3300037068 Bacteria 1170
494 Ga0373925_0399314 3300037068 Bacteria 1121
495 Ga0373925_0801607 3300037068 Bacteria 776
496 Ga0395899_0012745 3300037312 Bacteria 6442
497 Ga0395900_0083944 3300037418 Bacteria 3272
498 Ga0395900_0604500 3300037418 Bacteria 1037
499 Ga0395905_0026470 3300037471 Bacteria 5467
500 Ga0395901_0001801 3300038443 Bacteria 22128
501 Ga0395901_0084011 3300038443 Bacteria 3328
502 Ga0395901_0219603 3300038443 Bacteria 1987
503 Ga0436365_1094394 3300039437 Bacteria 3179
504 Ga0436365_1294223 3300039437 Bacteria 1640
505 Ga0436363_0092417 3300039450 Bacteria 2186
506 Ga0436363_0950219 3300039450 Bacteria 1017
507 Ga0436363_1669531 3300039450 Bacteria 4579
508 Ga0466965_0268823 3300044683 Bacteria 918
509 Ga0453684_0094755 3300044712 Bacteria 3672
510 Ga0466959_0569759 3300045049 Bacteria 763
511 Ga0451576_0090531 3300045051 Bacteria 3182
512 Ga0495592_0037156 3300046454 Bacteria 3667
513 Ga0495592_0049028 3300046454 Bacteria 3140
514 Ga0495592_0179425 3300046454 Bacteria 1443
515 Ga0495592_0360360 3300046454 Bacteria 930
516 Ga0495603_0002414 3300046455 Bacteria 10981
517 Ga0495603_0159737 3300046455 Bacteria 1307
518 Ga0495629_0000117 3300046459 Bacteria 70838
519 Ga0495629_0009945 3300046459 Bacteria 6942
520 Ga0495629_0120581 3300046459 Bacteria 1827
521 Ga0495629_0167146 3300046459 Bacteria 1527
522 Ga0495629_0334267 3300046459 Bacteria 1035
523 Ga0495638_0062504 3300046460 Bacteria 2298
524 Ga0495641_0002849 3300046461 Bacteria 13380
525 Ga0495641_0012671 3300046461 Bacteria 4696
526 Ga0495651_0092642 3300046462 Bacteria 2263
527 Ga0495651_0093215 3300046462 Unclassified 2255
528 Ga0495651_0350980 3300046462 Bacteria 975
529 Ga0495653_0009694 3300046463 Bacteria 7875
530 Ga0495653_0016695 3300046463 Bacteria 5975
531 Ga0495653_0147043 3300046463 Bacteria 1650
532 Ga0495580_0003260 3300046472 Bacteria 13879
533 Ga0495580_0013631 3300046472 Bacteria 6199
534 Ga0495582_0000280 3300046473 Bacteria 28556
535 Ga0495582_0055587 3300046473 Bacteria 2182
536 Ga0495582_0083948 3300046473 Bacteria 1770
537 Ga0495605_0058150 3300046474 Bacteria 1859
538 Ga0495639_0000751 3300046475 Bacteria 14785
539 Ga0495639_0002516 3300046475 Bacteria 8001
540 Ga0495639_0006386 3300046475 Bacteria 5069
541 Ga0495639_0068160 3300046475 Unclassified 1640
542 Ga0495639_0146066 3300046475 Bacteria 1139
543 Ga0495639_0224950 3300046475 Bacteria 923
544 Ga0495662_0000078 3300046476 Bacteria 34824
545 Ga0495662_0009678 3300046476 Bacteria 4727
546 Ga0495662_0057325 3300046476 Bacteria 1881
547 Ga0495662_0213356 3300046476 Bacteria 952
548 Ga0495664_0004815 3300046477 Bacteria 7379
549 Ga0495664_0145132 3300046477 Bacteria 1439
550 Ga0495584_0166292 3300046491 Bacteria 1121
551 Ga0495585_0239951 3300046492 Bacteria 908
552 Ga0495594_0043896 3300046499 Bacteria 2451
553 Ga0495594_0062693 3300046499 Bacteria 2059
554 Ga0495606_0096242 3300046507 Bacteria 1811
555 Ga0495608_0147409 3300046511 Bacteria 1501
556 Ga0495608_0181406 3300046511 Bacteria 1332
557 Ga0495616_0046573 3300046513 Bacteria 2188
558 Ga0495618_0028886 3300046514 Bacteria 3457
559 Ga0495620_0123436 3300046515 Bacteria 1019
560 Ga0495628_0080746 3300046516 Bacteria 2527
561 Ga0495628_0098228 3300046516 Unclassified 2262
562 Ga0495628_0152709 3300046516 Bacteria 1758
563 Ga0495628_0194701 3300046516 Bacteria 1530
564 Ga0495628_0409143 3300046516 Bacteria 990
565 Ga0495630_0005075 3300046517 Bacteria 9258
566 Ga0495630_0032801 3300046517 Bacteria 3871
567 Ga0495630_0227051 3300046517 Bacteria 1426
568 Ga0495632_0053973 3300046519 Bacteria 1971
569 Ga0495644_0023701 3300046523 Bacteria 2336
570 Ga0495666_0165108 3300046526 Bacteria 1026
571 Ga0495642_0176944 3300046528 Bacteria 928
572 Ga0495652_0003511 3300046529 Bacteria 15422
573 Ga0495652_0008078 3300046529 Bacteria 9634
574 Ga0495652_0033403 3300046529 Bacteria 4491
575 Ga0495652_0054500 3300046529 Bacteria 3405
576 Ga0495652_0108940 3300046529 Bacteria 2231
577 Ga0495652_0183988 3300046529 Bacteria 1601
578 Ga0495652_0201521 3300046529 Bacteria 1510
579 Ga0495665_0000296 3300046531 Bacteria 25045
580 Ga0495665_0008600 3300046531 Bacteria 5540
581 Ga0495665_0079013 3300046531 Bacteria 1731
582 Ga0495665_0118349 3300046531 Bacteria 1388
583 Ga0495665_0165391 3300046531 Bacteria 1152
584 Ga0495640_0003174 3300046533 Bacteria 13241
585 Ga0495640_0014903 3300046533 Bacteria 5862
586 Ga0495640_0026762 3300046533 Bacteria 4163
587 Ga0495640_0052310 3300046533 Bacteria 2805
588 Ga0495640_0065206 3300046533 Bacteria 2460
589 Ga0495586_0038933 3300046535 Bacteria 2555
590 Ga0495586_0057167 3300046535 Bacteria 2116
591 Ga0495586_0063876 3300046535 Bacteria 2006
592 Ga0495586_0307867 3300046535 Bacteria 908
593 Ga0495587_0052927 3300046536 Bacteria 2394
594 Ga0495587_0070865 3300046536 Bacteria 2028
595 Ga0495645_0002855 3300046543 Bacteria 11721
596 Ga0495645_0039232 3300046543 Bacteria 3455
597 Ga0495645_0093557 3300046543 Bacteria 2145
598 Ga0495645_0343013 3300046543 Bacteria 964
599 Ga0495667_0051957 3300046559 Bacteria 2702
600 Ga0495667_0072495 3300046559 Bacteria 2245
601 Ga0495667_0277092 3300046559 Bacteria 1065
602 Ga0495667_0498332 3300046559 Bacteria 763
603 Ga0495668_0085177 3300046616 Bacteria 1733
604 Ga0495634_0000996 3300046642 Bacteria 26710
605 Ga0495634_0003014 3300046642 Bacteria 13712
606 Ga0495634_0010095 3300046642 Bacteria 6931
607 Ga0495634_0176339 3300046642 Bacteria 1341
608 Ga0495635_0001099 3300046663 Bacteria 17970
609 Ga0495635_0010252 3300046663 Bacteria 6552
610 Ga0495635_0019694 3300046663 Bacteria 4699
611 Ga0495635_0084057 3300046663 Bacteria 2178
612 Ga0495635_0156167 3300046663 Bacteria 1553
613 Ga0495635_0157947 3300046663 Bacteria 1543
614 Ga0495635_0233899 3300046663 Bacteria 1241
615 Ga0495661_0261519 3300046665 Bacteria 879
616 Ga0495657_0076401 3300046675 Bacteria 2175
617 Ga0495657_0184146 3300046675 Bacteria 1280
618 Ga0495599_0036271 3300046678 Bacteria 3096
619 Ga0495599_0059309 3300046678 Bacteria 2394
620 Ga0495599_0091474 3300046678 Bacteria 1898
621 Ga0495599_0304816 3300046678 Unclassified 961
622 Ga0495623_0078970 3300046679 Bacteria 2039
623 Ga0495623_0172602 3300046679 Bacteria 1262
624 Ga0495646_0027666 3300046680 Bacteria 3556
625 Ga0495647_0030188 3300046681 Bacteria 2010
626 Ga0495647_0254450 3300046681 Bacteria 782
627 Ga0495658_0000486 3300046683 Bacteria 21786
628 Ga0495658_0111531 3300046683 Bacteria 1645
629 Ga0495658_0113771 3300046683 Bacteria 1630
630 Ga0495613_0003151 3300046689 Bacteria 12354
631 Ga0495613_0105536 3300046689 Bacteria 2034
632 Ga0495613_0165873 3300046689 Bacteria 1569
633 Ga0495613_0177720 3300046689 Bacteria 1508
634 Ga0495613_0246464 3300046689 Bacteria 1248
635 Ga0495613_0302536 3300046689 Bacteria 1107
636 Ga0495613_0703929 3300046689 Bacteria 665
637 Ga0495624_0003661 3300046690 Bacteria 11363
638 Ga0495624_0003734 3300046690 Bacteria 11257
639 Ga0495624_0014126 3300046690 Bacteria 5428
640 Ga0495624_0023494 3300046690 Bacteria 4065
641 Ga0495624_0283362 3300046690 Bacteria 1000
642 Ga0495671_0107071 3300046692 Bacteria 1365
643 Ga0495649_0132126 3300046694 Bacteria 1317
644 Ga0495600_0095524 3300046809 Bacteria 1938
645 Ga0495600_0121307 3300046809 Bacteria 1700
646 Ga0495600_0205485 3300046809 Bacteria 1263
647 Ga0495581_0000222 3300047315 Bacteria 26831
648 Ga0495581_0001725 3300047315 Bacteria 12184
649 Ga0495581_0010469 3300047315 Bacteria 5363
650 Ga0495581_0073228 3300047315 Bacteria 1982
651 Ga0495581_0221113 3300047315 Bacteria 1107
652 Ga0495604_0110125 3300047317 Bacteria 2009
653 Ga0495604_0150384 3300047317 Bacteria 1655
654 Ga0495604_0163044 3300047317 Bacteria 1574
655 Ga0495604_0165053 3300047317 Bacteria 1562
656 Ga0495604_0427712 3300047317 Bacteria 868
657 Ga0495636_0165143 3300047318 Bacteria 999
658 Ga0495674_0000684 3300047319 Bacteria 31976
659 Ga0495674_0002542 3300047319 Bacteria 17767
660 Ga0495674_0047903 3300047319 Bacteria 3786
661 Ga0495674_0048274 3300047319 Bacteria 3768
662 Ga0495674_0067665 3300047319 Bacteria 3093
663 Ga0495676_0051944 3300047321 Bacteria 3275
664 Ga0495676_0109483 3300047321 Bacteria 2030
665 Ga0495676_0125755 3300047321 Bacteria 1858
666 Ga0495680_0134431 3300047322 Bacteria 1814
667 Ga0495680_0399879 3300047322 Bacteria 949
668 Ga0495683_0054121 3300047323 Bacteria 2001
669 Ga0495675_0436981 3300047444 Bacteria 759
670 Ga0495673_0081311 3300047469 Bacteria 1342
671 Ga0495684_0001356 3300047471 Bacteria 19666
672 Ga0495684_0008929 3300047471 Bacteria 7743
673 Ga0495684_0077290 3300047471 Bacteria 2527
674 Ga0495684_0189801 3300047471 Bacteria 1520
675 Ga0495684_0284958 3300047471 Bacteria 1191
676 Ga0495684_0443316 3300047471 Bacteria 904
677 Ga0495593_0002472 3300047673 Bacteria 11113
678 Ga0495593_0013486 3300047673 Bacteria 4661
679 Ga0495593_0107794 3300047673 Bacteria 1424
680 Ga0495593_0180139 3300047673 Bacteria 1064
681 Ga0495602_0162362 3300048088 Bacteria 1743
682 Ga0495602_0260437 3300048088 Bacteria 1287
683 Ga0495602_0364985 3300048088 Bacteria 1038
684 Ga0496100_0060051 3300048903 Bacteria 2501
685 Ga0496100_0183533 3300048903 Bacteria 1514
686 Ga0496100_0862079 3300048903 Unclassified 711
687 Ga0496101_0015335 3300048904 Bacteria 5162
688 Ga0496102_0057108 3300048905 Bacteria 3562
689 Ga0496102_0089931 3300048905 Bacteria 2841
690 Ga0496102_0279630 3300048905 Bacteria 1573
691 Ga0496102_0596175 3300048905 Bacteria 1028
692 Ga0496103_0055653 3300048906 Bacteria 2454
693 Ga0496104_0049951 3300048907 Bacteria 3945
694 Ga0496104_0081666 3300048907 Bacteria 3083
695 Ga0496104_0118363 3300048907 Bacteria 2543
696 Ga0496104_0208886 3300048907 Unclassified 1864
697 Ga0496104_0255718 3300048907 Bacteria 1664
698 Ga0496105_0055927 3300048908 Bacteria 3257
699 Ga0496105_0554485 3300048908 Bacteria 896
700 Ga0496106_0016343 3300048909 Bacteria 5491
701 Ga0496106_0091858 3300048909 Bacteria 2344
702 Ga0496106_0202409 3300048909 Bacteria 1580
703 Ga0496106_0340916 3300048909 Bacteria 1204
704 Ga0496107_0014468 3300048910 Bacteria 5525
705 Ga0496107_0089169 3300048910 Bacteria 2252
706 Ga0496108_0030060 3300048911 Bacteria 4503
707 Ga0496108_0033847 3300048911 Plasmid 4245
708 Ga0496108_0144963 3300048911 Bacteria 2047
709 Ga0496108_0284066 3300048911 Bacteria 1440
710 Ga0496109_0046468 3300048912 Bacteria 3943
711 Ga0496109_0098584 3300048912 Bacteria 2709
712 Ga0496109_0519503 3300048912 Bacteria 1124
713 Ga0496109_0908709 3300048912 Unclassified 818
714 Ga0496109_0982412 3300048912 Bacteria 782
715 Ga0496110_0011665 3300048913 Bacteria 7206
716 Ga0496110_0162615 3300048913 Bacteria 2024
717 Ga0496110_0190953 3300048913 Bacteria 1860
718 Ga0496111_0008785 3300048914 Bacteria 6709
719 Ga0496111_0012582 3300048914 Bacteria 5734
720 Ga0496111_0282833 3300048914 Bacteria 1230
721 Ga0496112_0031182 3300048915 Bacteria 5168
722 Ga0496112_0031780 3300048915 Bacteria 5121
723 Ga0496112_0068274 3300048915 Plasmid 3510
724 Ga0496112_0114552 3300048915 Bacteria 2666
725 Ga0496112_0138858 3300048915 Bacteria 2400
726 Ga0496112_0680993 3300048915 Bacteria 957
727 Ga0496113_0044026 3300048916 Bacteria 3305
728 Ga0496113_0059943 3300048916 Bacteria 2868
729 Ga0496114_0013125 3300048917 Bacteria 6638
730 Ga0496114_0129578 3300048917 Bacteria 2177
731 Ga0496114_0393020 3300048917 Bacteria 1228
732 Ga0496115_0014659 3300048918 Bacteria 5937
733 Ga0496115_0067614 3300048918 Bacteria 2890
734 Ga0496121_0002804 3300048924 Bacteria 25823
735 Ga0496126_0173505 3300048929 Bacteria 1835
736 Ga0501046_0260891 3300049580 Bacteria 1273
737 Ga0501047_0352625 3300049581 Bacteria 1308
738 Ga0501069_0074013 3300049585 Bacteria 1911
739 Ga0501072_0437313 3300049588 Bacteria 1036
740 Ga0501075_0140672 3300049591 Bacteria 1839
741 Ga0501077_0266764 3300049593 Bacteria 1089
742 nmdc:mga0yw44_64371_c1 3300050492 Bacteria 2256
743 nmdc:mga05p37_578_c1 3300050507 Bacteria 40238
744 nmdc:mga09592_3930_c1 3300050508 Bacteria 11973
745 nmdc:mga08y16_47908_c1 3300050511 Bacteria 4474
746 nmdc:mga08y16_641585_c1 3300050511 Bacteria 1067
747 nmdc:mga0n895_387821_c1 3300050512 Bacteria 1413
748 nmdc:mga0n895_412041_c1 3300050512 Bacteria 1366
749 nmdc:mga0n895_44127_c1 3300050512 Bacteria 4348
750 nmdc:mga0n895_574585_c1 3300050512 Bacteria 1131
751 nmdc:mga0rr50_460401_c1 3300050513 Bacteria 1079
752 nmdc:mga08x19_206790_c1 3300050514 Bacteria 1347
753 nmdc:mga0a205_17986_c1 3300050515 Bacteria 6250
754 Ga0495601_0001859 3300053077 Bacteria 11761
755 Ga0495601_0004536 3300053077 Bacteria 8023
756 Ga0495601_0011341 3300053077 Bacteria 5327
757 Ga0495601_0038828 3300053077 Bacteria 2978
758 Ga0495601_0052006 3300053077 Bacteria 2586
759 Ga0495601_0062944 3300053077 Bacteria 2357
760 Ga0495601_0427432 3300053077 Bacteria 858
761 Ga0495612_0002164 3300053078 Bacteria 8082
762 Ga0495612_0002796 3300053078 Bacteria 7215
763 Ga0495612_0060244 3300053078 Bacteria 1571
764 Ga0495595_0025605 3300053084 Bacteria 2616
765 Ga0495595_0034689 3300053084 Bacteria 2283
766 Ga0495595_0070694 3300053084 Bacteria 1649
767 Ga0495595_0075813 3300053084 Bacteria 1596
768 Ga0495595_0076668 3300053084 Unclassified 1587
769 Ga0495595_0134105 3300053084 Bacteria 1212
770 Ga0495619_0006088 3300053085 Bacteria 7643
771 Ga0495619_0006186 3300053085 Bacteria 7587
772 Ga0495619_0006430 3300053085 Bacteria 7443
773 Ga0495619_0015577 3300053085 Bacteria 4811
774 Ga0495619_0018816 3300053085 Bacteria 4385
775 Ga0495619_0037424 3300053085 Bacteria 3161
776 Ga0495619_0071352 3300053085 Bacteria 2324
777 Ga0495619_0188883 3300053085 Bacteria 1426
778 Ga0500583_0002057 3300053092 Bacteria 5953
779 Ga0500595_021079 3300053119 Bacteria 2333
780 Ga0501082_0171098 3300060353 Bacteria 1889
781 2515690630 2515154123 Bacteria 6387382
782 2849083345 2849076700 Bacteria 7039503
783 2937852748 2937848649 Bacteria 6983481
784 2958052129 2958041894 Bacteria 13082850
785 2970472479 2970469710 Bacteria 6969209
786 3004218504 3004211236 Bacteria 7417683
787 3004223650 3004218560 Bacteria 7421728
788 3004276591 3004275668 Bacteria 7114440
789 JGI25404J52841_10014027
790 2214759110
791 ARSoilYngRDRAFT_c00056
792 ARcpr5yngRDRAFT_c000087
793 ARSoilOldRDRAFT_c000087
794 ARCol0oldRDRAFT_c00189
795 ARCol0yngRDRAFT_1000076
796 JGI24751J29686_10007510
797 JGI25404J52841_10003182
798 JGI25404J52841_10006590
799 JGI25404J52841_10008867
800 Ga0065717_1002162
801 Ga0065716_1001866
802 Ga0065704_10143605
803 Ga0065715_10106446
804 Ga0065715_10126637
805 Ga0065707_10106977
806 Ga0065707_10136913
807 Ga0070676_10231106
808 Ga0070690_100551212
809 Ga0070666_10129936
810 Ga0070680_100030343
811 Ga0070680_100047675
812 Ga0070682_100026653
813 Ga0068868_100402225
814 Ga0070660_100023793
815 Ga0070689_100012861
816 Ga0070691_10178556
817 Ga0070687_100368960
818 Ga0070669_100397382
819 Ga0070675_100211972
820 Ga0070671_100000745
821 Ga0070671_100005255
822 Ga0070671_100090152
823 Ga0070671_100169898
824 Ga0070674_100052015
825 Ga0070674_100554656
826 Ga0070673_100020425
827 Ga0070688_100255742
828 Ga0070688_100575917
829 Ga0070659_100241398
830 Ga0070667_100733666
831 Ga0070709_10008513
832 Ga0070709_10097818
833 Ga0070709_10261352
834 Ga0070709_10287636
835 Ga0070714_100057034
836 Ga0070714_100150865
837 Ga0070713_100051794
838 Ga0070713_100093571
839 Ga0070713_100171766
840 Ga0070713_100193288
841 Ga0070713_100368157
842 Ga0070713_100581745
843 Ga0070710_10015607
844 Ga0070710_10017856
845 Ga0070711_100050490
846 Ga0070711_100052580
847 Ga0070711_100125194
848 Ga0070711_100194004
849 Ga0070711_100359264
850 Ga0070711_100584031
851 Ga0070700_100142862
852 Ga0070694_100137317
853 Ga0070663_100113115
854 Ga0070662_100078545
855 Ga0070662_100209464
856 Ga0070681_10024148
857 Ga0070681_10083405
858 Ga0070681_10304738
859 Ga0068867_100556696
860 Ga0068867_100678654
861 Ga0070706_100105465
862 Ga0070706_100730708
863 Ga0070706_101271159
864 Ga0070698_100201202
865 Ga0074259_10685891
866 Ga0070699_100255695
867 Ga0070679_100022095
868 Ga0070679_100074040
869 Ga0070684_100493408
870 Ga0070684_100624942
871 Ga0070697_100012814
872 Ga0070697_100061990
873 Ga0070697_100355631
874 Ga0068853_100198105
875 Ga0068853_100694785
876 Ga0068853_100716567
877 Ga0070672_100097944
878 Ga0070672_100158742
879 Ga0070672_100654542
880 Ga0070686_100045571
881 Ga0070686_100089518
882 Ga0070686_100590509
883 Ga0070686_100605796
884 Ga0070695_100077478
885 Ga0070693_100242487
886 Ga0070693_100334082
887 Ga0070665_100041089
888 Ga0070665_100235078
889 Ga0070665_100944393
890 Ga0070704_100048584
891 Ga0068855_100997918
892 Ga0070664_100179180
893 Ga0070664_100229940
894 Ga0070664_100337223
895 Ga0068857_100493139
896 Ga0068854_100334899
897 Ga0068854_100372973
898 Ga0068856_100169035
899 Ga0068856_100348872
900 Ga0068856_100502288
901 Ga0068856_101024860
902 Ga0070702_100346485
903 Ga0070702_100532259
904 Ga0068852_100032612
905 Ga0068852_100297126
906 Ga0068859_100000579
907 Ga0068859_100038156
908 Ga0068859_100254391
909 Ga0068859_101293982
910 Ga0068864_100218019
911 Ga0068866_10093236
912 Ga0068861_100193618
913 Ga0068851_10190900
914 Ga0068863_100001862
915 Ga0068863_100797586
916 Ga0068858_100002351
917 Ga0068858_100176864
918 Ga0068860_100203573
919 Ga0068860_100357653
920 Ga0068862_100085514
921 Ga0068862_101025186
922 Ga0081455_10000354
923 Ga0081455_10006105
924 Ga0081455_10044470
925 Ga0081455_10059433
926 Ga0081455_10072968
927 Ga0081455_10082946
928 Ga0081455_10119511
929 Ga0081455_10240248
930 Ga0081455_10248572
931 Ga0081540_1000055
932 Ga0081540_1000075
933 Ga0081540_1002306
934 Ga0081540_1003603
935 Ga0081540_1011401
936 Ga0081540_1015638
937 Ga0081540_1020205
938 Ga0081540_1020840
939 Ga0081540_1026165
940 Ga0081540_1027929
941 Ga0081539_10000209
942 Ga0081539_10004192
943 Ga0070717_10027109
944 Ga0070717_10159098
945 Ga0070717_10164544
946 Ga0070717_10181382
947 Ga0070717_10263038
948 Ga0075365_10068220
949 Ga0075365_10173304
950 Ga0070715_10211779
951 Ga0070716_100099163
952 Ga0070716_100111737
953 Ga0070716_100613081
954 Ga0070712_100012839
955 Ga0070712_100025006
956 Ga0070712_100028936
957 Ga0070712_100117691
958 Ga0070712_100215467
959 Ga0070712_100498484
960 Ga0070712_100579418
961 Ga0070712_100792552
962 Ga0097621_100676022
963 Ga0097621_100713919
964 Ga0068871_100481928
965 Ga0075428_100075095
966 Ga0075428_100560431
967 Ga0075433_10083334
968 Ga0075433_10222728
969 Ga0075434_100039041
970 Ga0075434_100123877
971 Ga0075434_100342542
972 Ga0075429_100011921
973 Ga0097620_100000579
974 Ga0097620_100038156
975 Ga0097620_100254372
976 Ga0097620_101293759
977 Ga0075435_100446992
978 Ga0099794_10006930
979 Ga0105250_10083473
980 Ga0105240_10098984
981 Ga0105240_10144979
982 Ga0105240_10527731
983 Ga0111539_10001365
984 Ga0111539_10609924
985 Ga0105245_10056904
986 Ga0105247_10001257
987 Ga0105247_10010609
988 Ga0105247_10035823
989 Ga0114129_10006147
990 Ga0114129_10478663
991 Ga0114129_10597448
992 Ga0105243_10042966
993 Ga0105243_10062475
994 Ga0105243_10101758
995 Ga0105241_10103593
996 Ga0105241_10270902
997 Ga0105241_10299661
998 Ga0105242_10102413
999 Ga0105248_10039393
1000 Ga0105248_10080677
1001 Ga0105248_10360162
1002 Ga0105237_10169403
1003 Ga0105237_10277533
1004 Ga0105238_10029067
1005 Ga0105238_11260141
1006 Ga0105249_10084671
1007 Ga0105249_10509264
1008 Ga0105249_10812959
1009 Ga0099796_10073672
1010 Ga0105239_10032427
1011 Ga0105239_10142809
1012 Ga0105239_11194281
1013 Ga0105246_10085263
1014 Ga0105246_10162775
1015 Ga0105246_10398592
1016 Ga0105246_10471581
1017 Ga0157321_1000258
1018 Ga0157335_1001024
1019 Ga0157326_1015693
1020 Ga0157370_10015231
1021 Ga0157370_10222469
1022 Ga0157369_10815653
1023 Ga0157369_10957912
1024 Ga0157378_10477724
1025 Ga0163162_10121070
1026 Ga0163162_10466678
1027 Ga0163162_10521536
1028 Ga0163162_11457725
1029 Ga0157372_10340657
1030 Ga0157372_10752903
1031 Ga0157375_10057270
1032 Ga0157375_10075075
1033 Ga0157375_10989970
1034 Ga0163163_10022041
1035 Ga0182008_10014572
1036 Ga0157377_10060047
1037 Ga0157377_10391761
1038 Ga0157379_10336707
1039 Ga0157379_10611825
1040 Ga0157379_10686393
1041 Ga0157379_10767490
1042 Ga0157376_10498795
1043 Ga0157376_10523695
1044 Ga0182007_10018951
1045 Ga0163161_10042292
1046 Ga0163161_10382872
1047 Ga0197907_10512701
1048 Ga0206356_11356092
1049 Ga0206351_10203003
1050 Ga0206354_11401222
1051 Ga0206353_10146507
1052 Ga0213873_10022209
1053 Ga0213874_10045108
1054 Ga0224712_10290964
1055 Ga0224712_10353777
1056 Ga0209148_1008961
1057 Ga0209051_1001604
1058 Ga0207692_10023590
1059 Ga0207692_10038188
1060 Ga0207692_10065868
1061 Ga0207692_10101364
1062 Ga0207692_10108267
1063 Ga0207692_10283650
1064 Ga0207642_10125251
1065 Ga0207710_10000321
1066 Ga0207688_10086444
1067 Ga0207688_10336252
1068 Ga0207680_10037074
1069 Ga0207647_10231429
1070 Ga0207685_10115378
1071 Ga0207699_10462742
1072 Ga0207699_10486897
1073 Ga0207705_10463924
1074 Ga0207684_10088723
1075 Ga0207684_10492217
1076 Ga0207654_10056710
1077 Ga0207707_10000754
1078 Ga0207707_10036412
1079 Ga0207707_10157210
1080 Ga0207695_10100066
1081 Ga0207695_10154608
1082 Ga0207695_10278000
1083 Ga0207671_10368916
1084 Ga0207671_10516084
1085 Ga0207693_10001869
1086 Ga0207693_10018489
1087 Ga0207693_10040514
1088 Ga0207693_10045432
1089 Ga0207693_10100752
1090 Ga0207693_10252189
1091 Ga0207693_10426109
1092 Ga0207693_10642886
1093 Ga0207663_10026941
1094 Ga0207663_10034683
1095 Ga0207663_10105511
1096 Ga0207663_10341302
1097 Ga0207660_10080267
1098 Ga0207660_10567490
1099 Ga0207662_10193743
1100 Ga0207657_10101835
1101 Ga0207649_10557998
1102 Ga0207652_10037202
1103 Ga0207681_10268629
1104 Ga0207681_10500128
1105 Ga0207694_10018204
1106 Ga0207650_10010743
1107 Ga0207659_10004652
1108 Ga0207687_10075132
1109 Ga0207687_10153830
1110 Ga0207700_10011038
1111 Ga0207700_10043491
1112 Ga0207700_10371104
1113 Ga0207700_10409601
1114 Ga0207700_10677268
1115 Ga0207664_10044924
1116 Ga0207664_10075674
1117 Ga0207664_10113757
1118 Ga0207664_10179154
1119 Ga0207664_10470945
1120 Ga0207664_10545256
1121 Ga0207664_10580221
1122 Ga0207664_10871105
1123 Ga0207664_10901050
1124 Ga0207644_10004666
1125 Ga0207644_10009370
1126 Ga0207644_10307976
1127 Ga0207706_10067446
1128 Ga0207706_10406582
1129 Ga0207686_10170956
1130 Ga0207709_10132782
1131 Ga0207709_10180470
1132 Ga0207709_10296887
1133 Ga0207670_10247962
1134 Ga0207669_10941357
1135 Ga0207665_10091379
1136 Ga0207665_10153945
1137 Ga0207665_10260810
1138 Ga0207691_10126618
1139 Ga0207691_10160693
1140 Ga0207691_10412210
1141 Ga0207711_10374337
1142 Ga0207711_10543526
1143 Ga0207661_10654240
1144 Ga0207679_10061391
1145 Ga0207679_10635792
1146 Ga0207667_10374241
1147 Ga0207667_11304521
1148 Ga0207651_10012715
1149 Ga0207712_10085297
1150 Ga0207668_10259563
1151 Ga0207640_10441816
1152 Ga0207640_10654688
1153 Ga0207658_10008550
1154 Ga0207658_10205649
1155 Ga0207658_10632175
1156 Ga0207658_10703269
1157 Ga0207677_10568253
1158 Ga0207703_10005117
1159 Ga0207703_10457311
1160 Ga0207639_10174451
1161 Ga0207639_10507643
1162 Ga0207639_11072726
1163 Ga0207678_10067104
1164 Ga0207678_10155277
1165 Ga0207708_10374517
1166 Ga0207702_10059159
1167 Ga0207702_10081019
1168 Ga0207702_11032571
1169 Ga0207641_10027983
1170 Ga0207648_10083146
1171 Ga0207676_10258314
1172 Ga0207674_10072530
1173 Ga0207675_100050193
1174 Ga0207675_100107815
1175 Ga0207683_10447825
1176 Ga0207683_10620120
1177 Ga0207698_10218568
1178 Ga0207698_10932563
1179 Ga0209588_1015403
1180 Ga0207428_10052816
1181 Ga0207428_10513537
1182 Ga0268266_10108350
1183 Ga0268266_11087466
1184 Ga0268265_10516421
1185 Ga0268264_10148467
1186 Ga0307509_10022472
1187 Ga0307509_10083352
1188 Ga0307509_10120381
1189 Ga0265313_10001357
1190 Ga0373930_0003209
1191 Ga0373948_0000835
1192 Ga0373950_0000174
1193 Ga0373959_0003847
1194 Ga0373938_0000152
1195 Ga0373926_0045504
1196 Ga0373926_0077200
1197 Ga0373928_0001004
1198 Ga0373929_0000088
1199 Ga0373940_0000067
1200 Ga0373944_0002667
1201 Ga0373944_0045249
1202 Ga0373949_0000825
1203 Ga0373949_0051539
1204 Ga0373951_0000361
1205 Ga0373952_0000776
1206 Ga0373952_0116121
1207 Ga0373923_0349205
1208 Ga0373932_0000315
1209 Ga0373932_0148679
1210 Ga0373936_0005700
1211 Ga0373936_0173973
1212 Ga0373939_0000202
1213 Ga0373939_0155010
1214 Ga0373941_0000272
1215 Ga0373945_0020386
1216 Ga0373945_0034457
1217 Ga0373945_0051602
1218 Ga0373953_0009905
1219 Ga0373953_0069698
1220 Ga0373954_0010290
1221 Ga0373956_0098647
1222 Ga0373956_0189276
1223 Ga0373957_0069203
1224 Ga0373957_0091428
1225 Ga0373960_0001079
1226 Ga0373943_0002252
1227 Ga0373943_0011264
1228 Ga0373946_0002522
1229 Ga0373946_0007987
1230 Ga0373946_0023104
1231 Ga0373946_0028211
1232 Ga0373955_0060010
1233 Ga0373955_0237150
1234 Ga0373942_0022419
1235 Ga0373961_0001117
1236 Ga0373962_0000443
1237 Ga0373962_0019599
1238 Ga0373924_0100439
1239 Ga0373924_0183178
1240 Ga0373931_0038720
1241 Ga0373931_0047305
1242 Ga0373931_0050173
1243 Ga0373931_0203054
1244 Ga0373935_0000844
1245 Ga0373935_0010594
1246 Ga0373935_0014264
1247 Ga0373935_0019830
1248 Ga0373935_0035725
1249 Ga0373927_0003240
1250 Ga0373927_0004432
1251 Ga0373927_0007662
1252 Ga0373927_0015407
1253 Ga0373927_0043231
1254 Ga0373927_0043279
1255 Ga0373927_0044784
1256 Ga0373927_0211001
1257 Ga0373933_0011508
1258 Ga0373933_0159355
1259 Ga0373947_0000642
1260 Ga0373947_0006874
1261 Ga0373947_0018867
1262 Ga0373947_0053613
1263 Ga0373947_0305604
1264 Ga0373937_0003851
1265 Ga0373937_0020098
1266 Ga0373937_0054905
1267 Ga0373937_0170175
1268 Ga0373937_0353695
1269 Ga0373937_0495660
1270 Ga0373937_0590492
1271 Ga0373925_0000810
1272 Ga0373925_0005823
1273 Ga0373925_0014589
1274 Ga0373925_0026771
1275 Ga0373925_0027980
1276 Ga0373925_0042607
1277 Ga0373925_0163907
1278 Ga0373925_0204456
1279 Ga0373925_0218729
1280 Ga0373925_0301704
1281 Ga0373925_0367744
1282 Ga0373925_0399314
1283 Ga0373925_0801607
1284 Ga0395899_0012745
1285 Ga0395900_0083944
1286 Ga0395900_0604500
1287 Ga0395905_0026470
1288 Ga0395901_0001801
1289 Ga0395901_0084011
1290 Ga0395901_0219603
1291 Ga0436365_1094394
1292 Ga0436365_1294223
1293 Ga0436363_0092417
1294 Ga0436363_0950219
1295 Ga0436363_1669531
1296 Ga0466965_0268823
1297 Ga0453684_0094755
1298 Ga0466959_0569759
1299 Ga0451576_0090531
1300 Ga0495592_0037156
1301 Ga0495592_0049028
1302 Ga0495592_0179425
1303 Ga0495592_0360360
1304 Ga0495603_0002414
1305 Ga0495603_0159737
1306 Ga0495629_0000117
1307 Ga0495629_0009945
1308 Ga0495629_0120581
1309 Ga0495629_0167146
1310 Ga0495629_0334267
1311 Ga0495638_0062504
1312 Ga0495641_0002849
1313 Ga0495641_0012671
1314 Ga0495651_0092642
1315 Ga0495651_0093215
1316 Ga0495651_0350980
1317 Ga0495653_0009694
1318 Ga0495653_0016695
1319 Ga0495653_0147043
1320 Ga0495580_0003260
1321 Ga0495580_0013631
1322 Ga0495582_0000280
1323 Ga0495582_0055587
1324 Ga0495582_0083948
1325 Ga0495605_0058150
1326 Ga0495639_0000751
1327 Ga0495639_0002516
1328 Ga0495639_0006386
1329 Ga0495639_0068160
1330 Ga0495639_0146066
1331 Ga0495639_0224950
1332 Ga0495662_0000078
1333 Ga0495662_0009678
1334 Ga0495662_0057325
1335 Ga0495662_0213356
1336 Ga0495664_0004815
1337 Ga0495664_0145132
1338 Ga0495584_0166292
1339 Ga0495585_0239951
1340 Ga0495594_0043896
1341 Ga0495594_0062693
1342 Ga0495606_0096242
1343 Ga0495608_0147409
1344 Ga0495608_0181406
1345 Ga0495616_0046573
1346 Ga0495618_0028886
1347 Ga0495620_0123436
1348 Ga0495628_0080746
1349 Ga0495628_0098228
1350 Ga0495628_0152709
1351 Ga0495628_0194701
1352 Ga0495628_0409143
1353 Ga0495630_0005075
1354 Ga0495630_0032801
1355 Ga0495630_0227051
1356 Ga0495632_0053973
1357 Ga0495644_0023701
1358 Ga0495666_0165108
1359 Ga0495642_0176944
1360 Ga0495652_0003511
1361 Ga0495652_0008078
1362 Ga0495652_0033403
1363 Ga0495652_0054500
1364 Ga0495652_0108940
1365 Ga0495652_0183988
1366 Ga0495652_0201521
1367 Ga0495665_0000296
1368 Ga0495665_0008600
1369 Ga0495665_0079013
1370 Ga0495665_0118349
1371 Ga0495665_0165391
1372 Ga0495640_0003174
1373 Ga0495640_0014903
1374 Ga0495640_0026762
1375 Ga0495640_0052310
1376 Ga0495640_0065206
1377 Ga0495586_0038933
1378 Ga0495586_0057167
1379 Ga0495586_0063876
1380 Ga0495586_0307867
1381 Ga0495587_0052927
1382 Ga0495587_0070865
1383 Ga0495645_0002855
1384 Ga0495645_0039232
1385 Ga0495645_0093557
1386 Ga0495645_0343013
1387 Ga0495667_0051957
1388 Ga0495667_0072495
1389 Ga0495667_0277092
1390 Ga0495667_0498332
1391 Ga0495668_0085177
1392 Ga0495634_0000996
1393 Ga0495634_0003014
1394 Ga0495634_0010095
1395 Ga0495634_0176339
1396 Ga0495635_0001099
1397 Ga0495635_0010252
1398 Ga0495635_0019694
1399 Ga0495635_0084057
1400 Ga0495635_0156167
1401 Ga0495635_0157947
1402 Ga0495635_0233899
1403 Ga0495661_0261519
1404 Ga0495657_0076401
1405 Ga0495657_0184146
1406 Ga0495599_0036271
1407 Ga0495599_0059309
1408 Ga0495599_0091474
1409 Ga0495599_0304816
1410 Ga0495623_0078970
1411 Ga0495623_0172602
1412 Ga0495646_0027666
1413 Ga0495647_0030188
1414 Ga0495647_0254450
1415 Ga0495658_0000486
1416 Ga0495658_0111531
1417 Ga0495658_0113771
1418 Ga0495613_0003151
1419 Ga0495613_0105536
1420 Ga0495613_0165873
1421 Ga0495613_0177720
1422 Ga0495613_0246464
1423 Ga0495613_0302536
1424 Ga0495613_0703929
1425 Ga0495624_0003661
1426 Ga0495624_0003734
1427 Ga0495624_0014126
1428 Ga0495624_0023494
1429 Ga0495624_0283362
1430 Ga0495671_0107071
1431 Ga0495649_0132126
1432 Ga0495600_0095524
1433 Ga0495600_0121307
1434 Ga0495600_0205485
1435 Ga0495581_0000222
1436 Ga0495581_0001725
1437 Ga0495581_0010469
1438 Ga0495581_0073228
1439 Ga0495581_0221113
1440 Ga0495604_0110125
1441 Ga0495604_0150384
1442 Ga0495604_0163044
1443 Ga0495604_0165053
1444 Ga0495604_0427712
1445 Ga0495636_0165143
1446 Ga0495674_0000684
1447 Ga0495674_0002542
1448 Ga0495674_0047903
1449 Ga0495674_0048274
1450 Ga0495674_0067665
1451 Ga0495676_0051944
1452 Ga0495676_0109483
1453 Ga0495676_0125755
1454 Ga0495680_0134431
1455 Ga0495680_0399879
1456 Ga0495683_0054121
1457 Ga0495675_0436981
1458 Ga0495673_0081311
1459 Ga0495684_0001356
1460 Ga0495684_0008929
1461 Ga0495684_0077290
1462 Ga0495684_0189801
1463 Ga0495684_0284958
1464 Ga0495684_0443316
1465 Ga0495593_0002472
1466 Ga0495593_0013486
1467 Ga0495593_0107794
1468 Ga0495593_0180139
1469 Ga0495602_0162362
1470 Ga0495602_0260437
1471 Ga0495602_0364985
1472 Ga0496100_0060051
1473 Ga0496100_0183533
1474 Ga0496100_0862079
1475 Ga0496101_0015335
1476 Ga0496102_0057108
1477 Ga0496102_0089931
1478 Ga0496102_0279630
1479 Ga0496102_0596175
1480 Ga0496103_0055653
1481 Ga0496104_0049951
1482 Ga0496104_0081666
1483 Ga0496104_0118363
1484 Ga0496104_0208886
1485 Ga0496104_0255718
1486 Ga0496105_0055927
1487 Ga0496105_0554485
1488 Ga0496106_0016343
1489 Ga0496106_0091858
1490 Ga0496106_0202409
1491 Ga0496106_0340916
1492 Ga0496107_0014468
1493 Ga0496107_0089169
1494 Ga0496108_0030060
1495 Ga0496108_0033847
1496 Ga0496108_0144963
1497 Ga0496108_0284066
1498 Ga0496109_0046468
1499 Ga0496109_0098584
1500 Ga0496109_0519503
1501 Ga0496109_0908709
1502 Ga0496109_0982412
1503 Ga0496110_0011665
1504 Ga0496110_0162615
1505 Ga0496110_0190953
1506 Ga0496111_0008785
1507 Ga0496111_0012582
1508 Ga0496111_0282833
1509 Ga0496112_0031182
1510 Ga0496112_0031780
1511 Ga0496112_0068274
1512 Ga0496112_0114552
1513 Ga0496112_0138858
1514 Ga0496112_0680993
1515 Ga0496113_0044026
1516 Ga0496113_0059943
1517 Ga0496114_0013125
1518 Ga0496114_0129578
1519 Ga0496114_0393020
1520 Ga0496115_0014659
1521 Ga0496115_0067614
1522 Ga0496121_0002804
1523 Ga0496126_0173505
1524 Ga0501046_0260891
1525 Ga0501047_0352625
1526 Ga0501069_0074013
1527 Ga0501072_0437313
1528 Ga0501075_0140672
1529 Ga0501077_0266764
1530 nmdc:mga0yw44_64371_c1
1531 nmdc:mga05p37_578_c1
1532 nmdc:mga09592_3930_c1
1533 nmdc:mga08y16_47908_c1
1534 nmdc:mga08y16_641585_c1
1535 nmdc:mga0n895_387821_c1
1536 nmdc:mga0n895_412041_c1
1537 nmdc:mga0n895_44127_c1
1538 nmdc:mga0n895_574585_c1
1539 nmdc:mga0rr50_460401_c1
1540 nmdc:mga08x19_206790_c1
1541 nmdc:mga0a205_17986_c1
1542 Ga0495601_0001859
1543 Ga0495601_0004536
1544 Ga0495601_0011341
1545 Ga0495601_0038828
1546 Ga0495601_0052006
1547 Ga0495601_0062944
1548 Ga0495601_0427432
1549 Ga0495612_0002164
1550 Ga0495612_0002796
1551 Ga0495612_0060244
1552 Ga0495595_0025605
1553 Ga0495595_0034689
1554 Ga0495595_0070694
1555 Ga0495595_0075813
1556 Ga0495595_0076668
1557 Ga0495595_0134105
1558 Ga0495619_0006088
1559 Ga0495619_0006186
1560 Ga0495619_0006430
1561 Ga0495619_0015577
1562 Ga0495619_0018816
1563 Ga0495619_0037424
1564 Ga0495619_0071352
1565 Ga0495619_0188883
1566 Ga0500583_0002057
1567 Ga0500595_021079
1568 Ga0501082_0171098
1569 2515690630
1570 2849083345
1571 2937852748
1572 2958052129
1573 2970472479
1574 3004218504
1575 3004223650
1576 3004276591

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07040

DUF1326

Protein of unknown function (DUF1326)

51

234

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1soy-assembly1.cif.gz_A solution structure of the bacterial frataxin orthologue, cyay 0.6327 126 178
6vda-assembly1.cif.gz_A-2 metal-bound c-terminal domain of czcd transporter from thermotoga maritima 0.6161 79 127
2zzt-assembly1.cif.gz_A-2 crystal structure of the cytosolic domain of the cation diffusion facilitator family protein 0.5986 78 127
5okc-assembly1.cif.gz_H crystal structure of the ctf18-1-8 module from ctf18-rfc 0.5347 128 163
5msm-assembly2.cif.gz_E structure of the dcc1-ctf8-ctf18c trimer 0.527 128 163
ID Description Score Start End Superfamily
af_Q4D0I2_304_459_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.5626 79 127 3.30.70.1350
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.5425 80 125 3.30.300.20
af_A0A0R0JAC1_523_741_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.5344 65 125 3.60.10.10
1vw5j00 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.5247 79 133 3.30.429.10
af_P85515_1_101_2.60.40.1940 Mainly Beta;Sandwich;Immunoglobulin-like; 0.5174 126 143 2.60.40.1940
ID Description Score Start End GO Terms
AF-A0A330HTX0-F1-model_v4 DUF1326 domain-containing protein 0.999 5 208
AF-A0A7R6Y2C9-F1-model_v4 deleted 0.9984 3 208
AF-A0A7R6WUQ5-F1-model_v4 DUF1326 domain-containing protein 0.9981 1 208
AF-A0A502ZP63-F1-model_v4 DUF1326 domain-containing protein 0.9966 5 208
AF-A0A537SA16-F1-model_v4 DUF1326 domain-containing protein 0.9956 3 208

Map