F480818

General Info

Members Datasets Scaffolds Average Seq Length
787 389 781 316

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100160842|Ga0070659_1001608422
Length 332
Sequence MEERVARRSKGFPVKRFADLTEQEVLALAITNEEEDSRIYRGFAEGLREQFPSSAKVFDEMAEEEVHHRTMLFDLYRQKFGDYLPLIRRHDVKDFIPHKSSLWLMRPLILGEVRRFAEKMEEEAQRFYRKAADGARDISVRRLLLELAEAEAGHESLAHKLTEQILTDSARASEDATSRRAFMLQYVQPGLAGLMDGSVSTLAPLFAAAFATHNTWQTFLVGIAASVGAGISMAFAEGLSDDGSLTGRGSSWIRGPVCGVMTAIGGLGHTLPYLIPHFLTATVVSIIVVVIELAIISWIRMRFMDTPFLRAAFQVVVGGTLVFVAGILIGSS

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
3 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
4 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
5 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
6 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
210 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
215 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
219 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
264 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
309 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
310 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
311 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
312 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
315 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
316 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
322 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
331 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
332 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
333 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
334 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
335 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
336 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
361 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
377 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
378 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
379 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
382 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
383 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
384 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0.51
Rhizoplane 7.5
Rhizosphere 89.33
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001159 3300001977 Bacteria 4163
2 JGI24747J21853_1001686 3300001978 Bacteria 1696
3 JGI24737J22298_10003747 3300001990 Bacteria 5350
4 JGI24748J21848_1000922 3300002074 Bacteria 3197
5 JGI24738J21930_10005998 3300002075 Bacteria 2881
6 JGI24749J21850_1007268 3300002076 Bacteria 1542
7 JGI24035J26624_1003158 3300002126 Bacteria 1546
8 JGI24033J26618_1000670 3300002155 Bacteria 3288
9 JGI24034J26672_10006920 3300002239 Bacteria 1644
10 JGI24742J22300_10009688 3300002244 Bacteria 1591
11 JGI25406J46586_10035267 3300003203 Bacteria 1827
12 JGI25405J52794_10006675 3300003911 Bacteria 2112
13 Ga0065715_10016799 3300005293 Bacteria 2708
14 Ga0065715_10127935 3300005293 Bacteria 2076
15 Ga0070658_10039334 3300005327 Bacteria 3814
16 Ga0070676_10204072 3300005328 Bacteria 1297
17 Ga0070683_100248921 3300005329 Bacteria 1690
18 Ga0070690_100040084 3300005330 Bacteria 2961
19 Ga0070670_100024012 3300005331 Bacteria 5245
20 Ga0070670_100046489 3300005331 Bacteria 3733
21 Ga0070677_10017515 3300005333 Bacteria 2567
22 Ga0068869_100000546 3300005334 Bacteria 21018
23 Ga0070666_10003351 3300005335 Bacteria 9717
24 Ga0070666_10024866 3300005335 Bacteria 3903
25 Ga0070680_100102443 3300005336 Bacteria 2377
26 Ga0070680_100133966 3300005336 Bacteria 2074
27 Ga0070680_100137235 3300005336 Bacteria 2049
28 Ga0070680_100164107 3300005336 Bacteria 1867
29 Ga0070682_100003749 3300005337 Bacteria 8450
30 Ga0070682_100008347 3300005337 Bacteria 5840
31 Ga0068868_100076157 3300005338 Bacteria 2682
32 Ga0070660_100032484 3300005339 Bacteria 3928
33 Ga0070689_100011088 3300005340 Bacteria 6447
34 Ga0070687_100002463 3300005343 Bacteria 6956
35 Ga0070661_100001763 3300005344 Bacteria 15010
36 Ga0070661_100208639 3300005344 Bacteria 1495
37 Ga0070692_10004998 3300005345 Bacteria 5601
38 Ga0070668_100029340 3300005347 Bacteria 4178
39 Ga0070668_100285021 3300005347 Bacteria 1381
40 Ga0070669_100257439 3300005353 Bacteria 1391
41 Ga0070669_100326239 3300005353 Bacteria 1241
42 Ga0070675_100148503 3300005354 Bacteria 2008
43 Ga0070671_100000400 3300005355 Bacteria 29909
44 Ga0070671_100016183 3300005355 Bacteria 6031
45 Ga0070671_100017220 3300005355 Bacteria 5850
46 Ga0070671_100342741 3300005355 Bacteria 1275
47 Ga0070674_100003887 3300005356 Bacteria 8456
48 Ga0070673_100003044 3300005364 Bacteria 10371
49 Ga0070673_100049035 3300005364 Bacteria 3295
50 Ga0070673_100086054 3300005364 Bacteria 2560
51 Ga0070688_100041330 3300005365 Bacteria 2829
52 Ga0070688_100181830 3300005365 Bacteria 1459
53 Ga0070659_100011935 3300005366 Bacteria 6432
54 Ga0070659_100015673 3300005366 Bacteria 5678
55 Ga0070659_100160842 3300005366 Bacteria 1836
56 Ga0070667_100019668 3300005367 Bacteria 5601
57 Ga0070667_100029206 3300005367 Bacteria 4593
58 Ga0070703_10001633 3300005406 Bacteria 6661
59 Ga0070709_10027418 3300005434 Bacteria 3386
60 Ga0070709_10072248 3300005434 Bacteria 2230
61 Ga0070709_10089154 3300005434 Bacteria 2030
62 Ga0070714_100004751 3300005435 Bacteria 10286
63 Ga0070714_100031618 3300005435 Bacteria 4418
64 Ga0070714_100109397 3300005435 Bacteria 2445
65 Ga0070714_100140294 3300005435 Bacteria 2169
66 Ga0070714_100229489 3300005435 Bacteria 1710
67 Ga0070714_100369296 3300005435 Bacteria 1350
68 Ga0070713_100007671 3300005436 Bacteria 7594
69 Ga0070713_100010726 3300005436 Bacteria 6635
70 Ga0070710_10002075 3300005437 Bacteria 9497
71 Ga0070710_10011385 3300005437 Bacteria 4394
72 Ga0070710_10012917 3300005437 Bacteria 4163
73 Ga0070710_10033554 3300005437 Bacteria 2788
74 Ga0070711_100005015 3300005439 Bacteria 7869
75 Ga0070711_100007887 3300005439 Bacteria 6491
76 Ga0070711_100011777 3300005439 Bacteria 5441
77 Ga0070711_100019306 3300005439 Bacteria 4372
78 Ga0070711_100202919 3300005439 Bacteria 1531
79 Ga0070711_100236608 3300005439 Bacteria 1426
80 Ga0070705_100006364 3300005440 Bacteria 5785
81 Ga0070694_100036409 3300005444 Bacteria 3260
82 Ga0070708_100192603 3300005445 Bacteria 1907
83 Ga0070678_100058654 3300005456 Bacteria 2826
84 Ga0070681_10018300 3300005458 Bacteria 7002
85 Ga0070681_10105774 3300005458 Bacteria 2756
86 Ga0070681_10192416 3300005458 Bacteria 1959
87 Ga0070681_10332042 3300005458 Bacteria 1430
88 Ga0070681_10497225 3300005458 Bacteria 1132
89 Ga0068867_100017455 3300005459 Bacteria 5098
90 Ga0070685_10017509 3300005466 Bacteria 3837
91 Ga0070679_100063969 3300005530 Bacteria 3666
92 Ga0070679_100579055 3300005530 Bacteria 1066
93 Ga0070684_100036616 3300005535 Bacteria 4205
94 Ga0070684_100375809 3300005535 Bacteria 1308
95 Ga0070697_100023727 3300005536 Bacteria 4880
96 Ga0068853_100051046 3300005539 Bacteria 3559
97 Ga0068853_100077862 3300005539 Unclassified 2897
98 Ga0070672_100000643 3300005543 Bacteria 20456
99 Ga0070672_100127325 3300005543 Unclassified 2090
100 Ga0070686_100001304 3300005544 Bacteria 14085
101 Ga0070686_100010740 3300005544 Bacteria 5175
102 Ga0070695_100001486 3300005545 Bacteria 13009
103 Ga0070695_100004408 3300005545 Bacteria 8263
104 Ga0070695_100022935 3300005545 Bacteria 3831
105 Ga0070696_100143811 3300005546 Bacteria 1745
106 Ga0070693_100002192 3300005547 Bacteria 8954
107 Ga0070693_100027483 3300005547 Bacteria 3085
108 Ga0070693_100061809 3300005547 Bacteria 2179
109 Ga0070665_100056218 3300005548 Bacteria 3946
110 Ga0068855_100164557 3300005563 Bacteria 2515
111 Ga0068855_100170700 3300005563 Bacteria 2463
112 Ga0068855_100212389 3300005563 Bacteria 2174
113 Ga0068855_100227338 3300005563 Bacteria 2091
114 Ga0070664_100106672 3300005564 Bacteria 2441
115 Ga0068857_100010309 3300005577 Bacteria 8117
116 Ga0068857_100301999 3300005577 Bacteria 1476
117 Ga0068854_100019339 3300005578 Bacteria 4588
118 Ga0068856_100005954 3300005614 Bacteria 12005
119 Ga0068856_100035670 3300005614 Bacteria 4874
120 Ga0068856_100233903 3300005614 Bacteria 1853
121 Ga0068856_100268798 3300005614 Bacteria 1721
122 Ga0070702_100010184 3300005615 Bacteria 4621
123 Ga0070702_100091105 3300005615 Bacteria 1849
124 Ga0068852_100036031 3300005616 Bacteria 4135
125 Ga0068852_100121781 3300005616 Bacteria 2390
126 Ga0068864_100004096 3300005618 Bacteria 11968
127 Ga0068864_100017192 3300005618 Bacteria 6032
128 Ga0068866_10054983 3300005718 Bacteria 2042
129 Ga0068870_10002536 3300005840 Bacteria 7629
130 Ga0068863_100011785 3300005841 Bacteria 8451
131 Ga0068863_100041941 3300005841 Bacteria 4349
132 Ga0068858_100027284 3300005842 Bacteria 5306
133 Ga0068858_100049561 3300005842 Bacteria 3889
134 Ga0068858_100059547 3300005842 Bacteria 3529
135 Ga0068860_100031698 3300005843 Bacteria 5081
136 Ga0068860_100072141 3300005843 Bacteria 3281
137 Ga0068860_100177201 3300005843 Bacteria 2060
138 Ga0081455_10000081 3300005937 Bacteria 103752
139 Ga0081455_10006099 3300005937 Bacteria 13031
140 Ga0081455_10012001 3300005937 Bacteria 8669
141 Ga0081455_10012659 3300005937 Bacteria 8398
142 Ga0081455_10073907 3300005937 Bacteria 2817
143 Ga0081455_10080569 3300005937 Bacteria 2668
144 Ga0081540_1010241 3300005983 Bacteria 6368
145 Ga0070717_10000980 3300006028 Bacteria 19102
146 Ga0070717_10105419 3300006028 Bacteria 2399
147 Ga0075365_10206831 3300006038 Bacteria 1376
148 Ga0075432_10001738 3300006058 Bacteria 7172
149 Ga0070715_10001654 3300006163 Bacteria 6605
150 Ga0070715_10002687 3300006163 Bacteria 5509
151 Ga0070716_100018566 3300006173 Bacteria 3626
152 Ga0070716_100044250 3300006173 Bacteria 2493
153 Ga0070716_100085376 3300006173 Bacteria 1896
154 Ga0070712_100011997 3300006175 Bacteria 5506
155 Ga0070712_100045208 3300006175 Bacteria 3040
156 Ga0075367_10060427 3300006178 Bacteria 2260
157 Ga0075367_10099118 3300006178 Bacteria 1780
158 Ga0097621_100197389 3300006237 Bacteria 1745
159 Ga0068871_100002394 3300006358 Bacteria 12790
160 Ga0068871_100012591 3300006358 Bacteria 6244
161 Ga0075428_100002359 3300006844 Bacteria 20499
162 Ga0075430_100000424 3300006846 Bacteria 31568
163 Ga0075430_100139760 3300006846 Bacteria 2017
164 Ga0075431_100001606 3300006847 Bacteria 21079
165 Ga0075431_100054071 3300006847 Bacteria 4140
166 Ga0075431_100598529 3300006847 Bacteria 1087
167 Ga0075433_10000012 3300006852 Bacteria 71065
168 Ga0075433_10030391 3300006852 Bacteria 4609
169 Ga0075433_10104642 3300006852 Bacteria 2507
170 Ga0075433_10161753 3300006852 Bacteria 1993
171 Ga0075434_100000692 3300006871 Bacteria 26317
172 Ga0075434_100035497 3300006871 Bacteria 4929
173 Ga0075434_100046300 3300006871 Bacteria 4316
174 Ga0075434_100116442 3300006871 Bacteria 2685
175 Ga0075434_100209513 3300006871 Bacteria 1969
176 Ga0075434_100259838 3300006871 Bacteria 1755
177 Ga0075434_100408739 3300006871 Bacteria 1378
178 Ga0075429_100000558 3300006880 Bacteria 28507
179 Ga0075436_100002445 3300006914 Bacteria 12802
180 Ga0075436_100049129 3300006914 Bacteria 2911
181 Ga0075436_100065592 3300006914 Bacteria 2509
182 Ga0075436_100282494 3300006914 Bacteria 1187
183 Ga0079104_1000033 3300006946 Bacteria 202636
184 Ga0075435_100001906 3300007076 Bacteria 13571
185 Ga0075435_100010893 3300007076 Bacteria 6662
186 Ga0075435_100015701 3300007076 Bacteria 5696
187 Ga0075435_100029529 3300007076 Bacteria 4303
188 Ga0075435_100058325 3300007076 Bacteria 3126
189 Ga0075435_100160557 3300007076 Bacteria 1893
190 Ga0105251_10009318 3300009011 Bacteria 5808
191 Ga0105244_10059776 3300009036 Bacteria 1921
192 Ga0105240_10083193 3300009093 Bacteria 3928
193 Ga0105240_10293290 3300009093 Bacteria 1863
194 Ga0105240_10333055 3300009093 Bacteria 1727
195 Ga0105240_10640716 3300009093 Bacteria 1166
196 Ga0111539_10003218 3300009094 Bacteria 21598
197 Ga0111539_10040187 3300009094 Bacteria 5632
198 Ga0105245_10001227 3300009098 Bacteria 23145
199 Ga0105245_10102473 3300009098 Unclassified 2651
200 Ga0105245_10166045 3300009098 Bacteria 2098
201 Ga0105247_10007843 3300009101 Bacteria 6531
202 Ga0114129_10000803 3300009147 Bacteria 40282
203 Ga0114129_10006740 3300009147 Bacteria 16309
204 Ga0114129_10341877 3300009147 Bacteria 1985
205 Ga0105243_10006687 3300009148 Bacteria 8902
206 Ga0105243_10008944 3300009148 Bacteria 7657
207 Ga0105241_10002078 3300009174 Bacteria 15128
208 Ga0105241_10145543 3300009174 Bacteria 1933
209 Ga0105242_10012319 3300009176 Bacteria 6580
210 Ga0105242_10022262 3300009176 Bacteria 4982
211 Ga0105242_10071893 3300009176 Bacteria 2872
212 Ga0105248_10016502 3300009177 Bacteria 8130
213 Ga0105248_10090176 3300009177 Bacteria 3452
214 Ga0105248_10091208 3300009177 Bacteria 3432
215 Ga0105248_10153484 3300009177 Bacteria 2598
216 Ga0105248_10206505 3300009177 Unclassified 2213
217 Ga0105237_10028276 3300009545 Bacteria 5713
218 Ga0105237_10201037 3300009545 Unclassified 1993
219 Ga0105237_10330868 3300009545 Bacteria 1527
220 Ga0105238_10034096 3300009551 Bacteria 5180
221 Ga0105238_10039765 3300009551 Bacteria 4769
222 Ga0105238_10072890 3300009551 Bacteria 3429
223 Ga0105249_10056093 3300009553 Bacteria 3607
224 Ga0105249_10084429 3300009553 Bacteria 2957
225 Ga0105239_10071027 3300010375 Bacteria 3824
226 Ga0105246_10017784 3300011119 Bacteria 4521
227 Ga0105246_10018580 3300011119 Bacteria 4433
228 Ga0157373_10053046 3300013100 Bacteria 2883
229 Ga0157373_10057970 3300013100 Bacteria 2746
230 Ga0157371_10036077 3300013102 Bacteria 3541
231 Ga0157371_10110696 3300013102 Bacteria 1949
232 Ga0157371_10212913 3300013102 Bacteria 1387
233 Ga0157370_10066661 3300013104 Bacteria 3404
234 Ga0157370_10084465 3300013104 Bacteria 2984
235 Ga0157370_10290506 3300013104 Bacteria 1510
236 Ga0157369_10125307 3300013105 Bacteria 2724
237 Ga0157374_10001167 3300013296 Bacteria 22404
238 Ga0157374_10123181 3300013296 Bacteria 2504
239 Ga0163162_10081228 3300013306 Bacteria 3312
240 Ga0163162_10172458 3300013306 Bacteria 2288
241 Ga0163162_10274268 3300013306 Bacteria 1818
242 Ga0157372_10175216 3300013307 Bacteria 2482
243 Ga0157372_10183661 3300013307 Bacteria 2422
244 Ga0157372_10254806 3300013307 Bacteria 2037
245 Ga0157375_10024045 3300013308 Bacteria 5632
246 Ga0163163_10004077 3300014325 Bacteria 12455
247 Ga0163163_10011690 3300014325 Bacteria 7972
248 Ga0163163_10127494 3300014325 Bacteria 2583
249 Ga0157380_10187910 3300014326 Bacteria 1821
250 Ga0182008_10047790 3300014497 Bacteria 2126
251 Ga0157377_10005174 3300014745 Bacteria 6102
252 Ga0157379_10015293 3300014968 Bacteria 6730
253 Ga0157379_10019074 3300014968 Bacteria 6056
254 Ga0157379_10045579 3300014968 Bacteria 3913
255 Ga0157379_10069112 3300014968 Bacteria 3158
256 Ga0157376_10008081 3300014969 Bacteria 7561
257 Ga0157376_10008909 3300014969 Bacteria 7265
258 Ga0163161_10023558 3300017792 Bacteria 4343
259 Ga0163161_10050839 3300017792 Bacteria 3001
260 Ga0207666_1000303 3300025271 Bacteria 6893
261 Ga0207673_1000268 3300025290 Bacteria 5313
262 Ga0207697_10010266 3300025315 Bacteria 4011
263 Ga0207713_1012260 3300025735 Bacteria 4599
264 Ga0207653_10001180 3300025885 Bacteria 8537
265 Ga0207682_10000169 3300025893 Bacteria 30010
266 Ga0207692_10029091 3300025898 Bacteria 2622
267 Ga0207710_10000382 3300025900 Bacteria 30360
268 Ga0207710_10009676 3300025900 Bacteria 4051
269 Ga0207688_10005457 3300025901 Bacteria 6913
270 Ga0207680_10005813 3300025903 Bacteria 5920
271 Ga0207647_10018922 3300025904 Bacteria 4642
272 Ga0207699_10003983 3300025906 Bacteria 7064
273 Ga0207645_10013151 3300025907 Bacteria 5588
274 Ga0207643_10000004 3300025908 Bacteria 187006
275 Ga0207705_10362780 3300025909 Bacteria 1117
276 Ga0207654_10004998 3300025911 Bacteria 6704
277 Ga0207707_10054511 3300025912 Bacteria 3481
278 Ga0207707_10079866 3300025912 Bacteria 2856
279 Ga0207707_10273712 3300025912 Bacteria 1463
280 Ga0207707_10292798 3300025912 Bacteria 1408
281 Ga0207707_10348390 3300025912 Bacteria 1276
282 Ga0207695_10088462 3300025913 Bacteria 3117
283 Ga0207695_10229620 3300025913 Bacteria 1761
284 Ga0207693_10001228 3300025915 Bacteria 22855
285 Ga0207693_10037515 3300025915 Bacteria 3819
286 Ga0207693_10086622 3300025915 Unclassified 2454
287 Ga0207663_10008842 3300025916 Bacteria 5293
288 Ga0207663_10023493 3300025916 Bacteria 3539
289 Ga0207663_10039328 3300025916 Bacteria 2865
290 Ga0207663_10076093 3300025916 Bacteria 2180
291 Ga0207660_10002588 3300025917 Bacteria 11865
292 Ga0207660_10258602 3300025917 Bacteria 1376
293 Ga0207660_10343333 3300025917 Bacteria 1195
294 Ga0207662_10000392 3300025918 Bacteria 19588
295 Ga0207662_10009869 3300025918 Bacteria 5268
296 Ga0207657_10002007 3300025919 Bacteria 22003
297 Ga0207657_10050436 3300025919 Bacteria 3622
298 Ga0207657_10089083 3300025919 Bacteria 2578
299 Ga0207657_10121258 3300025919 Unclassified 2151
300 Ga0207649_10003920 3300025920 Bacteria 8119
301 Ga0207649_10020993 3300025920 Bacteria 3751
302 Ga0207652_10096428 3300025921 Bacteria 2606
303 Ga0207652_10101001 3300025921 Bacteria 2547
304 Ga0207652_10191138 3300025921 Bacteria 1841
305 Ga0207652_10200343 3300025921 Bacteria 1797
306 Ga0207681_10020237 3300025923 Bacteria 4213
307 Ga0207681_10138116 3300025923 Bacteria 1812
308 Ga0207694_10059618 3300025924 Bacteria 2969
309 Ga0207694_10112628 3300025924 Bacteria 2165
310 Ga0207650_10004443 3300025925 Bacteria 9579
311 Ga0207659_10000038 3300025926 Bacteria 93848
312 Ga0207687_10007503 3300025927 Bacteria 7173
313 Ga0207687_10019017 3300025927 Bacteria 4545
314 Ga0207687_10022230 3300025927 Bacteria 4219
315 Ga0207687_10413340 3300025927 Bacteria 1112
316 Ga0207700_10002133 3300025928 Bacteria 11319
317 Ga0207664_10389635 3300025929 Bacteria 1238
318 Ga0207664_10428049 3300025929 Bacteria 1179
319 Ga0207644_10002653 3300025931 Bacteria 11522
320 Ga0207644_10014180 3300025931 Bacteria 5331
321 Ga0207644_10257919 3300025931 Bacteria 1393
322 Ga0207690_10008630 3300025932 Bacteria 6043
323 Ga0207706_10015380 3300025933 Bacteria 6913
324 Ga0207686_10005483 3300025934 Bacteria 6807
325 Ga0207686_10008322 3300025934 Bacteria 5596
326 Ga0207709_10000645 3300025935 Bacteria 28329
327 Ga0207709_10005944 3300025935 Bacteria 6881
328 Ga0207670_10026558 3300025936 Bacteria 3650
329 Ga0207670_10084696 3300025936 Bacteria 2226
330 Ga0207669_10039382 3300025937 Bacteria 2731
331 Ga0207704_10001273 3300025938 Bacteria 11282
332 Ga0207704_10160169 3300025938 Bacteria 1600
333 Ga0207704_10230260 3300025938 Bacteria 1377
334 Ga0207665_10000541 3300025939 Bacteria 25458
335 Ga0207665_10073437 3300025939 Bacteria 2339
336 Ga0207665_10089965 3300025939 Bacteria 2127
337 Ga0207665_10136395 3300025939 Bacteria 1746
338 Ga0207691_10016931 3300025940 Bacteria 6917
339 Ga0207691_10093273 3300025940 Unclassified 2696
340 Ga0207711_10002645 3300025941 Bacteria 15844
341 Ga0207711_10008404 3300025941 Bacteria 8635
342 Ga0207711_10188165 3300025941 Bacteria 1880
343 Ga0207689_10013698 3300025942 Bacteria 6913
344 Ga0207689_10044297 3300025942 Bacteria 3678
345 Ga0207689_10399240 3300025942 Bacteria 1146
346 Ga0207661_10094127 3300025944 Unclassified 2502
347 Ga0207661_10146059 3300025944 Bacteria 2040
348 Ga0207661_10167727 3300025944 Bacteria 1909
349 Ga0207679_10000673 3300025945 Bacteria 22925
350 Ga0207667_10162417 3300025949 Bacteria 2297
351 Ga0207667_10236644 3300025949 Bacteria 1869
352 Ga0207667_10483851 3300025949 Bacteria 1256
353 Ga0207651_10004796 3300025960 Bacteria 6878
354 Ga0207651_10025240 3300025960 Bacteria 3692
355 Ga0207651_10034700 3300025960 Bacteria 3271
356 Ga0207712_10104383 3300025961 Bacteria 2113
357 Ga0207712_10177581 3300025961 Bacteria 1670
358 Ga0207668_10000300 3300025972 Bacteria 32440
359 Ga0207668_10267865 3300025972 Unclassified 1395
360 Ga0207640_10013982 3300025981 Bacteria 4610
361 Ga0207658_10106936 3300025986 Bacteria 2204
362 Ga0207658_10267483 3300025986 Bacteria 1459
363 Ga0207677_10052019 3300026023 Bacteria 2780
364 Ga0207677_10275121 3300026023 Bacteria 1379
365 Ga0207703_10001822 3300026035 Bacteria 19007
366 Ga0207703_10015219 3300026035 Bacteria 6002
367 Ga0207703_10139922 3300026035 Bacteria 2099
368 Ga0207639_10070130 3300026041 Unclassified 2737
369 Ga0207639_10148777 3300026041 Bacteria 1959
370 Ga0207678_10001349 3300026067 Bacteria 22608
371 Ga0207708_10010365 3300026075 Bacteria 6919
372 Ga0207702_10088874 3300026078 Bacteria 2701
373 Ga0207641_10301118 3300026088 Unclassified 1514
374 Ga0207648_10015829 3300026089 Bacteria 6913
375 Ga0207676_10001979 3300026095 Bacteria 14919
376 Ga0207674_10022363 3300026116 Bacteria 6790
377 Ga0207674_10165967 3300026116 Bacteria 2162
378 Ga0207675_100016410 3300026118 Bacteria 6915
379 Ga0207683_10000138 3300026121 Bacteria 60113
380 Ga0207683_10009051 3300026121 Bacteria 8486
381 Ga0207683_10016053 3300026121 Bacteria 6372
382 Ga0207698_10085087 3300026142 Bacteria 2566
383 Ga0209973_1006386 3300027252 Bacteria 1285
384 Ga0209966_1006273 3300027695 Bacteria 2061
385 Ga0209998_10001517 3300027717 Bacteria 5581
386 Ga0209974_10007950 3300027876 Bacteria 3637
387 Ga0207428_10000137 3300027907 Bacteria 98535
388 Ga0207428_10000501 3300027907 Bacteria 46798
389 Ga0268266_10001262 3300028379 Bacteria 30924
390 Ga0268266_10124169 3300028379 Bacteria 2301
391 Ga0268265_10112629 3300028380 Bacteria 2224
392 Ga0268265_10287661 3300028380 Unclassified 1474
393 Ga0268264_10063392 3300028381 Bacteria 3106
394 Ga0268264_10217987 3300028381 Bacteria 1755
395 Ga0265318_10036446 3300028577 Bacteria 1887
396 Ga0265338_10057618 3300028800 Bacteria 3435
397 Ga0265320_10001751 3300031240 Bacteria 15379
398 Ga0265325_10000073 3300031241 Bacteria 70109
399 Ga0265325_10001135 3300031241 Bacteria 19104
400 Ga0265325_10028736 3300031241 Bacteria 2994
401 Ga0265325_10040658 3300031241 Bacteria 2441
402 Ga0265325_10068229 3300031241 Bacteria 1790
403 Ga0265340_10040674 3300031247 Bacteria 2289
404 Ga0265340_10153859 3300031247 Bacteria 1047
405 Ga0265339_10031148 3300031249 Bacteria 3015
406 Ga0265339_10042095 3300031249 Bacteria 2530
407 Ga0265316_10026938 3300031344 Bacteria 4771
408 Ga0265316_10055119 3300031344 Bacteria 3111
409 Ga0307513_10156600 3300031456 Bacteria 2177
410 Ga0265313_10000716 3300031595 Bacteria 34149
411 Ga0265313_10006520 3300031595 Bacteria 8247
412 Ga0265313_10013800 3300031595 Bacteria 4818
413 Ga0265313_10013961 3300031595 Bacteria 4781
414 Ga0265313_10020135 3300031595 Bacteria 3688
415 Ga0265313_10056708 3300031595 Bacteria 1852
416 Ga0316575_10021421 3300031665 Bacteria 2488
417 Ga0316579_10039950 3300031691 Bacteria 2175
418 Ga0265314_10164738 3300031711 Bacteria 1345
419 Ga0265342_10000308 3300031712 Bacteria 55378
420 Ga0265342_10007094 3300031712 Bacteria 8253
421 Ga0316583_10013697 3300032133 Bacteria 2926
422 Ga0316583_10051472 3300032133 Bacteria 1449
423 Ga0373938_0003594 3300034957 Bacteria 2553
424 Ga0373926_0000307 3300035083 Bacteria 12124
425 Ga0373926_0002849 3300035083 Bacteria 5537
426 Ga0373934_0009944 3300035086 Bacteria 3569
427 Ga0373944_0000747 3300035089 Bacteria 7899
428 Ga0373949_0004634 3300035090 Unclassified 3130
429 Ga0373952_0000958 3300035092 Bacteria 5239
430 Ga0373952_0003763 3300035092 Bacteria 2742
431 Ga0373923_0002801 3300035111 Bacteria 5456
432 Ga0373923_0025925 3300035111 Bacteria 2328
433 Ga0373923_0036552 3300035111 Bacteria 2005
434 Ga0373932_0018265 3300035112 Bacteria 1811
435 Ga0373932_0019923 3300035112 Bacteria 1753
436 Ga0373936_0003188 3300035113 Bacteria 6147
437 Ga0373936_0061809 3300035113 Bacteria 1530
438 Ga0373939_0000167 3300035114 Bacteria 18254
439 Ga0373939_0001060 3300035114 Bacteria 6784
440 Ga0373941_0008094 3300035115 Bacteria 2600
441 Ga0373945_0000024 3300035116 Bacteria 30607
442 Ga0373945_0034814 3300035116 Bacteria 1796
443 Ga0373953_0010186 3300035117 Bacteria 3260
444 Ga0373953_0018966 3300035117 Bacteria 2553
445 Ga0373953_0046524 3300035117 Bacteria 1742
446 Ga0373954_0010267 3300035118 Bacteria 4130
447 Ga0373956_0012714 3300035119 Bacteria 3494
448 Ga0373956_0015207 3300035119 Bacteria 3220
449 Ga0373957_0014956 3300035120 Bacteria 2661
450 Ga0373960_0010409 3300035121 Bacteria 2270
451 Ga0373943_0003950 3300035170 Bacteria 6751
452 Ga0373943_0006014 3300035170 Bacteria 5447
453 Ga0373946_0000503 3300035171 Bacteria 12938
454 Ga0373946_0012060 3300035171 Bacteria 3232
455 Ga0373955_0010594 3300035172 Bacteria 4360
456 Ga0373955_0012923 3300035172 Bacteria 4024
457 Ga0373955_0094137 3300035172 Bacteria 1711
458 Ga0373942_0010013 3300035207 Bacteria 2223
459 Ga0373961_0040393 3300035241 Bacteria 1344
460 Ga0373962_0003809 3300035242 Bacteria 3625
461 Ga0373962_0021487 3300035242 Bacteria 1703
462 Ga0373924_0002384 3300035410 Bacteria 6326
463 Ga0373924_0008537 3300035410 Bacteria 3728
464 Ga0373931_0002836 3300035691 Bacteria 7730
465 Ga0373931_0015561 3300035691 Bacteria 3734
466 Ga0373931_0080738 3300035691 Bacteria 1794
467 Ga0373935_0004347 3300035692 Bacteria 8314
468 Ga0373935_0019290 3300035692 Bacteria 4158
469 Ga0373935_0031623 3300035692 Bacteria 3285
470 Ga0373927_0002644 3300035695 Bacteria 13050
471 Ga0373927_0025011 3300035695 Bacteria 3903
472 Ga0373933_0011976 3300035724 Bacteria 4788
473 Ga0373933_0033264 3300035724 Bacteria 2997
474 Ga0373947_0001717 3300035725 Bacteria 13399
475 Ga0373947_0006930 3300035725 Bacteria 6568
476 Ga0373947_0033880 3300035725 Bacteria 3018
477 Ga0373947_0206113 3300035725 Bacteria 1288
478 Ga0373937_0007576 3300036401 Bacteria 9400
479 Ga0373937_0010057 3300036401 Bacteria 8248
480 Ga0373937_0060239 3300036401 Bacteria 3489
481 Ga0373937_0208874 3300036401 Bacteria 1836
482 Ga0373925_0009737 3300037068 Bacteria 6985
483 Ga0373925_0162543 3300037068 Bacteria 1759
484 Ga0373925_0175271 3300037068 Bacteria 1694
485 Ga0373925_0440104 3300037068 Bacteria 1067
486 Ga0395899_0036141 3300037312 Bacteria 3707
487 Ga0395900_0005226 3300037418 Bacteria 13621
488 Ga0395898_0041183 3300037466 Bacteria 4563
489 Ga0395898_0071635 3300037466 Bacteria 3349
490 Ga0395898_0097810 3300037466 Bacteria 2818
491 Ga0436364_1033575 3300037853 Bacteria 2183
492 Ga0436364_1402500 3300037853 Bacteria 1579
493 Ga0395901_0059145 3300038443 Bacteria 3987
494 Ga0436365_0713111 3300039437 Bacteria 3753
495 Ga0436360_0289177 3300039438 Bacteria 1400
496 Ga0436361_1211214 3300039447 Bacteria 2074
497 Ga0439448_0020540 3300042005 Bacteria 2044
498 Ga0439460_0022983 3300042461 Bacteria 1715
499 Ga0451577_0071195 3300042876 Bacteria 3101
500 Ga0466966_0036234 3300044684 Bacteria 3186
501 Ga0466961_0151821 3300044693 Bacteria 1446
502 Ga0466963_0057036 3300044694 Bacteria 2600
503 Ga0453684_0091371 3300044712 Bacteria 3758
504 Ga0466957_0191744 3300044842 Bacteria 1339
505 Ga0466959_0165525 3300045049 Bacteria 1553
506 Ga0466967_0011672 3300045976 Bacteria 6674
507 Ga0495617_030003 3300046452 Bacteria 1828
508 Ga0495592_0006111 3300046454 Bacteria 8952
509 Ga0495592_0017486 3300046454 Bacteria 5448
510 Ga0495603_0003742 3300046455 Bacteria 9045
511 Ga0495603_0005609 3300046455 Bacteria 7498
512 Ga0495629_0000753 3300046459 Bacteria 26186
513 Ga0495629_0045372 3300046459 Bacteria 3083
514 Ga0495629_0124027 3300046459 Bacteria 1799
515 Ga0495638_0072158 3300046460 Bacteria 2111
516 Ga0495641_0004791 3300046461 Bacteria 9417
517 Ga0495651_0001426 3300046462 Bacteria 18541
518 Ga0495651_0002939 3300046462 Bacteria 13180
519 Ga0495653_0014789 3300046463 Bacteria 6364
520 Ga0495653_0037014 3300046463 Bacteria 3838
521 Ga0495653_0063884 3300046463 Bacteria 2776
522 Ga0495653_0087496 3300046463 Bacteria 2288
523 Ga0495580_0007742 3300046472 Bacteria 8610
524 Ga0495582_0007911 3300046473 Bacteria 5875
525 Ga0495582_0058793 3300046473 Bacteria 2120
526 Ga0495639_0008291 3300046475 Bacteria 4459
527 Ga0495639_0015775 3300046475 Unclassified 3276
528 Ga0495639_0082540 3300046475 Bacteria 1498
529 Ga0495662_0008720 3300046476 Bacteria 4985
530 Ga0495662_0016049 3300046476 Bacteria 3632
531 Ga0495664_0003487 3300046477 Bacteria 8563
532 Ga0495584_0008365 3300046491 Bacteria 5359
533 Ga0495584_0037411 3300046491 Bacteria 2453
534 Ga0495585_0006802 3300046492 Bacteria 7057
535 Ga0495594_0003931 3300046499 Bacteria 7644
536 Ga0495594_0009417 3300046499 Bacteria 5045
537 Ga0495594_0009717 3300046499 Bacteria 4977
538 Ga0495607_0004637 3300046501 Bacteria 10064
539 Ga0495608_0013047 3300046511 Bacteria 5765
540 Ga0495608_0014069 3300046511 Bacteria 5553
541 Ga0495608_0061288 3300046511 Bacteria 2474
542 Ga0495618_0003047 3300046514 Bacteria 10585
543 Ga0495618_0013518 3300046514 Bacteria 4965
544 Ga0495628_0019182 3300046516 Bacteria 5655
545 Ga0495628_0032294 3300046516 Bacteria 4227
546 Ga0495630_0006135 3300046517 Bacteria 8521
547 Ga0495630_0079495 3300046517 Bacteria 2473
548 Ga0495637_0012831 3300046520 Bacteria 3997
549 Ga0495637_0046007 3300046520 Bacteria 1848
550 Ga0495644_0003881 3300046523 Bacteria 5883
551 Ga0495666_0000788 3300046526 Bacteria 14672
552 Ga0495666_0046412 3300046526 Bacteria 2094
553 Ga0495652_0017441 3300046529 Bacteria 6405
554 Ga0495652_0018691 3300046529 Bacteria 6177
555 Ga0495654_0000070 3300046530 Bacteria 117357
556 Ga0495665_0000227 3300046531 Bacteria 28192
557 Ga0495665_0191071 3300046531 Bacteria 1062
558 Ga0495640_0027438 3300046533 Bacteria 4107
559 Ga0495640_0035420 3300046533 Bacteria 3532
560 Ga0495587_0004130 3300046536 Bacteria 9600
561 Ga0495587_0008487 3300046536 Bacteria 6603
562 Ga0495587_0061412 3300046536 Bacteria 2202
563 Ga0495609_0005483 3300046538 Bacteria 6645
564 Ga0495645_0010540 3300046543 Bacteria 6484
565 Ga0495622_0005976 3300046557 Bacteria 5654
566 Ga0495633_0002067 3300046558 Bacteria 14446
567 Ga0495667_0001790 3300046559 Bacteria 14251
568 Ga0495667_0078718 3300046559 Bacteria 2143
569 Ga0495656_0000293 3300046615 Bacteria 17434
570 Ga0495634_0010910 3300046642 Bacteria 6632
571 Ga0495635_0018551 3300046663 Bacteria 4853
572 Ga0495659_0001622 3300046664 Bacteria 7559
573 Ga0495659_0002627 3300046664 Bacteria 5796
574 Ga0495661_0010629 3300046665 Bacteria 6275
575 Ga0495588_0001913 3300046674 Bacteria 8890
576 Ga0495588_0040109 3300046674 Bacteria 2387
577 Ga0495588_0127826 3300046674 Bacteria 1340
578 Ga0495657_0012549 3300046675 Bacteria 6290
579 Ga0495657_0042837 3300046675 Bacteria 3088
580 Ga0495599_0015010 3300046678 Bacteria 4801
581 Ga0495623_0125668 3300046679 Bacteria 1540
582 Ga0495646_0001140 3300046680 Bacteria 15502
583 Ga0495646_0002961 3300046680 Bacteria 10519
584 Ga0495647_0000989 3300046681 Bacteria 8641
585 Ga0495647_0047755 3300046681 Bacteria 1653
586 Ga0495647_0127768 3300046681 Bacteria 1074
587 Ga0495658_0000543 3300046683 Bacteria 20578
588 Ga0495658_0004438 3300046683 Bacteria 6902
589 Ga0495658_0004686 3300046683 Bacteria 6726
590 Ga0495613_0002489 3300046689 Bacteria 13900
591 Ga0495613_0050781 3300046689 Bacteria 3058
592 Ga0495613_0072220 3300046689 Bacteria 2515
593 Ga0495624_0009130 3300046690 Bacteria 6876
594 Ga0495670_0001083 3300046691 Bacteria 13211
595 Ga0495600_0010740 3300046809 Bacteria 5692
596 Ga0495581_0018686 3300047315 Bacteria 4025
597 Ga0495604_0003959 3300047317 Bacteria 11793
598 Ga0495604_0053061 3300047317 Bacteria 3136
599 Ga0495604_0075834 3300047317 Bacteria 2531
600 Ga0495674_0018711 3300047319 Bacteria 6447
601 Ga0495674_0060468 3300047319 Bacteria 3305
602 Ga0495676_0030918 3300047321 Bacteria 4535
603 Ga0495676_0054653 3300047321 Bacteria 3172
604 Ga0495676_0150273 3300047321 Bacteria 1658
605 Ga0495680_0015238 3300047322 Bacteria 6637
606 Ga0495680_0022375 3300047322 Bacteria 5268
607 Ga0495680_0045737 3300047322 Bacteria 3455
608 Ga0495680_0107613 3300047322 Bacteria 2070
609 Ga0495680_0297981 3300047322 Bacteria 1133
610 Ga0495675_0001398 3300047444 Bacteria 14624
611 Ga0495675_0046094 3300047444 Bacteria 2776
612 Ga0495685_047254 3300047447 Bacteria 1464
613 Ga0495684_0003544 3300047471 Bacteria 12202
614 Ga0495684_0091259 3300047471 Bacteria 2307
615 Ga0495684_0279169 3300047471 Bacteria 1206
616 Ga0495593_0003809 3300047673 Bacteria 9007
617 Ga0495593_0038641 3300047673 Unclassified 2577
618 Ga0495593_0056214 3300047673 Bacteria 2069
619 Ga0495602_0027639 3300048088 Bacteria 5448
620 Ga0495602_0051565 3300048088 Bacteria 3663
621 Ga0495602_0066933 3300048088 Bacteria 3093
622 Ga0495614_0022916 3300048089 Bacteria 2692
623 Ga0495614_0043034 3300048089 Bacteria 1936
624 Ga0496100_0001173 3300048903 Bacteria 12746
625 Ga0496100_0017497 3300048903 Bacteria 4232
626 Ga0496100_0047791 3300048903 Bacteria 2759
627 Ga0496101_0011631 3300048904 Bacteria 5845
628 Ga0496101_0047399 3300048904 Bacteria 3085
629 Ga0496101_0236279 3300048904 Bacteria 1421
630 Ga0496102_0009243 3300048905 Bacteria 8455
631 Ga0496102_0015422 3300048905 Bacteria 6656
632 Ga0496102_0016185 3300048905 Bacteria 6516
633 Ga0496102_0143773 3300048905 Bacteria 2237
634 Ga0496102_0320748 3300048905 Bacteria 1459
635 Ga0496103_0011411 3300048906 Bacteria 5264
636 Ga0496104_0001459 3300048907 Bacteria 20443
637 Ga0496104_0002184 3300048907 Bacteria 16947
638 Ga0496104_0467694 3300048907 Bacteria 1172
639 Ga0496105_0003206 3300048908 Bacteria 12045
640 Ga0496105_0068206 3300048908 Bacteria 2938
641 Ga0496105_0080325 3300048908 Bacteria 2693
642 Ga0496105_0286227 3300048908 Bacteria 1328
643 Ga0496106_0081055 3300048909 Bacteria 2493
644 Ga0496106_0347936 3300048909 Bacteria 1190
645 Ga0496107_0009730 3300048910 Bacteria 6667
646 Ga0496107_0016951 3300048910 Bacteria 5122
647 Ga0496107_0022673 3300048910 Bacteria 4438
648 Ga0496108_0002474 3300048911 Bacteria 14790
649 Ga0496108_0037785 3300048911 Bacteria 4023
650 Ga0496108_0102293 3300048911 Bacteria 2445
651 Ga0496108_0139082 3300048911 Bacteria 2091
652 Ga0496108_0251516 3300048911 Bacteria 1537
653 Ga0496109_0001010 3300048912 Bacteria 23241
654 Ga0496109_0004575 3300048912 Bacteria 11545
655 Ga0496109_0009961 3300048912 Bacteria 8116
656 Ga0496109_0016091 3300048912 Bacteria 6536
657 Ga0496109_0087451 3300048912 Bacteria 2879
658 Ga0496109_0094444 3300048912 Bacteria 2768
659 Ga0496109_0154503 3300048912 Bacteria 2149
660 Ga0496110_0002704 3300048913 Bacteria 13402
661 Ga0496110_0003213 3300048913 Bacteria 12442
662 Ga0496110_0063136 3300048913 Bacteria 3272
663 Ga0496110_0144635 3300048913 Bacteria 2150
664 Ga0496111_0000245 3300048914 Bacteria 26053
665 Ga0496111_0055333 3300048914 Bacteria 2869
666 Ga0496111_0086834 3300048914 Bacteria 2289
667 Ga0496112_0003218 3300048915 Bacteria 13448
668 Ga0496112_0017506 3300048915 Bacteria 6734
669 Ga0496112_0079598 3300048915 Bacteria 3241
670 Ga0496112_0093480 3300048915 Bacteria 2977
671 Ga0496112_0182491 3300048915 Bacteria 2062
672 Ga0496112_0782149 3300048915 Bacteria 880
673 Ga0496113_0045479 3300048916 Bacteria 3256
674 Ga0496113_0065905 3300048916 Bacteria 2742
675 Ga0496113_0174178 3300048916 Bacteria 1704
676 Ga0496114_0004868 3300048917 Bacteria 10455
677 Ga0496114_0025726 3300048917 Bacteria 4812
678 Ga0496115_0032160 3300048918 Bacteria 4138
679 Ga0496115_0033864 3300048918 Bacteria 4036
680 Ga0496115_0054212 3300048918 Bacteria 3219
681 Ga0496115_0064373 3300048918 Bacteria 2959
682 Ga0496115_0073942 3300048918 Bacteria 2767
683 Ga0496121_0014314 3300048924 Bacteria 8433
684 Ga0496124_0098935 3300048927 Bacteria 2366
685 Ga0501032_0049697 3300049569 Bacteria 2829
686 Ga0501032_0162697 3300049569 Bacteria 1465
687 Ga0501033_0020324 3300049570 Bacteria 5016
688 Ga0501034_0019426 3300049571 Bacteria 6950
689 Ga0501034_0062652 3300049571 Bacteria 3734
690 Ga0501034_0068301 3300049571 Bacteria 3565
691 Ga0501034_0083871 3300049571 Bacteria 3188
692 Ga0501034_0174406 3300049571 Bacteria 2116
693 Ga0501036_0105971 3300049572 Bacteria 2377
694 Ga0501038_0008011 3300049574 Bacteria 9733
695 Ga0501039_0118326 3300049575 Bacteria 2075
696 Ga0501043_0024721 3300049579 Bacteria 4710
697 Ga0501047_0019004 3300049581 Bacteria 6592
698 Ga0501047_0099931 3300049581 Bacteria 2780
699 Ga0501047_0156998 3300049581 Bacteria 2148
700 Ga0501047_0472836 3300049581 Bacteria 1081
701 Ga0501069_0010183 3300049585 Bacteria 4972
702 Ga0501069_0011329 3300049585 Bacteria 4729
703 Ga0501069_0050211 3300049585 Bacteria 2319
704 Ga0501070_0000711 3300049586 Bacteria 30493
705 Ga0501070_0027953 3300049586 Bacteria 4731
706 Ga0501070_0031315 3300049586 Bacteria 4457
707 Ga0501070_0039662 3300049586 Bacteria 3926
708 Ga0501070_0062742 3300049586 Bacteria 3078
709 Ga0501070_0074935 3300049586 Bacteria 2801
710 Ga0501071_0040292 3300049587 Bacteria 3342
711 Ga0501073_0075486 3300049589 Bacteria 2346
712 Ga0501076_0024247 3300049592 Bacteria 4687
713 Ga0501077_0022557 3300049593 Bacteria 3987
714 Ga0501079_0012760 3300049741 Bacteria 6419
715 Ga0501079_0253819 3300049741 Bacteria 1374
716 Ga0501080_0054441 3300049742 Bacteria 3726
717 Ga0501080_0170176 3300049742 Bacteria 2009
718 Ga0501083_0077357 3300049744 Bacteria 2208
719 Ga0501035_0000703 3300049822 Bacteria 36519
720 Ga0501035_0054522 3300049822 Bacteria 3572
721 Ga0501035_0089270 3300049822 Bacteria 2715
722 nmdc:mga0yw44_255353_c1 3300050492 Bacteria 1167
723 nmdc:mga0yw44_269162_c1 3300050492 Bacteria 1137
724 nmdc:mga06z11_7241_c1 3300050494 Bacteria 4555
725 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
726 nmdc:mga05p37_7273_c1 3300050507 Bacteria 13063
727 nmdc:mga09592_1181_c1 3300050508 Bacteria 20837
728 nmdc:mga0qj67_116117_c1 3300050509 Bacteria 2163
729 nmdc:mga0qj67_341_c1 3300050509 Bacteria 32144
730 nmdc:mga0qj67_66211_c1 3300050509 Bacteria 2877
731 nmdc:mga06r32_122581_c1 3300050510 Bacteria 2565
732 nmdc:mga06r32_404_c1 3300050510 Bacteria 36414
733 nmdc:mga08y16_615_c1 3300050511 Bacteria 33272
734 nmdc:mga0n895_134690_c1 3300050512 Bacteria 2497
735 nmdc:mga0n895_14593_c1 3300050512 Bacteria 7141
736 nmdc:mga0n895_181038_c1 3300050512 Bacteria 2139
737 nmdc:mga0n895_186795_c1 3300050512 Bacteria 2103
738 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
739 nmdc:mga0n895_58568_c1 3300050512 Bacteria 3798
740 nmdc:mga0n895_88860_c1 3300050512 Bacteria 3090
741 nmdc:mga0rr50_11111_c1 3300050513 Bacteria 5746
742 nmdc:mga0rr50_18578_c1 3300050513 Bacteria 4673
743 nmdc:mga0rr50_3991_c1 3300050513 Bacteria 8597
744 nmdc:mga0rr50_65273_c1 3300050513 Bacteria 2756
745 nmdc:mga0rr50_8186_c1 3300050513 Bacteria 6493
746 nmdc:mga08x19_288301_c1 3300050514 Bacteria 1138
747 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
748 nmdc:mga0a205_194120_c1 3300050515 Bacteria 1921
749 nmdc:mga0a205_41845_c1 3300050515 Bacteria 4414
750 nmdc:mga0a205_59009_c1 3300050515 Bacteria 3707
751 nmdc:mga0a205_89831_c1 3300050515 Bacteria 2969
752 Ga0495601_0007271 3300053077 Bacteria 6494
753 Ga0495601_0009898 3300053077 Bacteria 5646
754 Ga0495601_0052763 3300053077 Bacteria 2568
755 Ga0495601_0271790 3300053077 Bacteria 1106
756 Ga0495612_0000562 3300053078 Bacteria 14913
757 Ga0495612_0006546 3300053078 Bacteria 4786
758 Ga0495612_0056313 3300053078 Bacteria 1622
759 Ga0495612_0112990 3300053078 Bacteria 1164
760 Ga0495655_0029679 3300053083 Bacteria 1316
761 Ga0495595_0001568 3300053084 Bacteria 8924
762 Ga0495595_0019721 3300053084 Bacteria 2928
763 Ga0495595_0023779 3300053084 Bacteria 2701
764 Ga0495595_0123462 3300053084 Bacteria 1262
765 Ga0495619_0000045 3300053085 Bacteria 108543
766 Ga0495619_0000388 3300053085 Bacteria 30051
767 Ga0495619_0013931 3300053085 Bacteria 5073
768 Ga0495619_0017164 3300053085 Bacteria 4584
769 Ga0495619_0032275 3300053085 Bacteria 3397
770 Ga0500643_005338 3300053087 Bacteria 5559
771 Ga0500644_0000570 3300053088 Bacteria 14410
772 Ga0500566_0027276 3300053094 Bacteria 3343
773 Ga0500595_000002 3300053119 Bacteria 1074388
774 Ga0500616_0000002 3300053153 Bacteria 1611257
775 Ga0500645_000156 3300053730 Bacteria 53110
776 Ga0501084_0003196 3300054114 Bacteria 13261
777 Ga0501084_0043312 3300054114 Bacteria 3766
778 Ga0501084_0229438 3300054114 Bacteria 1567
779 Ga0501082_0005740 3300060353 Bacteria 10768
780 Ga0501082_0177158 3300060353 Bacteria 1854
781 Ga0530510_0191855 3300061734 Bacteria 1517

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0347936 Ga0496106_0347936_360_1175 259
2 3300035111 Ga0373923_0036552 Ga0373923_0036552_1172_1990 272
3 3300048915 Ga0496112_0782149 Ga0496112_0782149_19_843 274
4 3300031249 Ga0265339_10031148 Ga0265339_100311484 288
5 3300031595 Ga0265313_10006520 Ga0265313_100065205 288
6 3300042461 Ga0439460_0022983 Ga0439460_0022983_649_1608 290
7 3300031344 Ga0265316_10055119 Ga0265316_100551192 291
8 3300042876 Ga0451577_0071195 Ga0451577_0071195_778_1740 293
9 3300044712 Ga0453684_0091371 Ga0453684_0091371_630_1592 293
10 3300013102 Ga0157371_10212913 Ga0157371_102129132 295
11 3300049579 Ga0501043_0024721 Ga0501043_0024721_1320_2282 296
12 3300006847 Ga0075431_100054071 Ga0075431_1000540715 297
13 3300050509 nmdc:mga0qj67_116117_c1 nmdc:mga0qj67_116117_c1_610_1563 297
14 3300046463 Ga0495653_0063884 Ga0495653_0063884_268_1227 298
15 3300046520 Ga0495637_0046007 Ga0495637_0046007_742_1695 298
16 3300046533 Ga0495640_0027438 Ga0495640_0027438_1159_2118 298
17 3300046664 Ga0495659_0002627 Ga0495659_0002627_2149_3102 298
18 3300047317 Ga0495604_0075834 Ga0495604_0075834_562_1521 298
19 3300047319 Ga0495674_0018711 Ga0495674_0018711_1650_2609 298
20 3300047322 Ga0495680_0022375 Ga0495680_0022375_2416_3375 298
21 3300053078 Ga0495612_0006546 Ga0495612_0006546_3436_4395 298
22 3300053085 Ga0495619_0000045 Ga0495619_0000045_19269_20228 298
23 3300006846 Ga0075430_100139760 Ga0075430_1001397602 299
24 3300050509 nmdc:mga0qj67_66211_c1 nmdc:mga0qj67_66211_c1_258_1214 299
25 3300050510 nmdc:mga06r32_122581_c1 nmdc:mga06r32_122581_c1_1216_2172 299
26 3300005336 Ga0070680_100164107 Ga0070680_1001641073 300
27 3300005344 Ga0070661_100208639 Ga0070661_1002086391 300
28 3300005347 Ga0070668_100285021 Ga0070668_1002850211 300
29 3300005355 Ga0070671_100017220 Ga0070671_1000172207 300
30 3300005458 Ga0070681_10018300 Ga0070681_100183009 300
31 3300005546 Ga0070696_100143811 Ga0070696_1001438112 300
32 3300005547 Ga0070693_100061809 Ga0070693_1000618092 300
33 3300005563 Ga0068855_100227338 Ga0068855_1002273383 300
34 3300005843 Ga0068860_100072141 Ga0068860_1000721413 300
35 3300006871 Ga0075434_100046300 Ga0075434_1000463003 300
36 3300007076 Ga0075435_100058325 Ga0075435_1000583252 300
37 3300025912 Ga0207707_10054511 Ga0207707_100545112 300
38 3300025921 Ga0207652_10096428 Ga0207652_100964282 300
39 3300025938 Ga0207704_10160169 Ga0207704_101601692 300
40 3300035112 Ga0373932_0018265 Ga0373932_0018265_444_1403 300
41 3300035691 Ga0373931_0015561 Ga0373931_0015561_493_1491 300
42 3300050513 nmdc:mga0rr50_65273_c1 nmdc:mga0rr50_65273_c1_899_1897 300
43 3300031456 Ga0307513_10156600 Ga0307513_101566002 301
44 3300013306 Ga0163162_10274268 Ga0163162_102742681 303
45 3300014968 Ga0157379_10069112 Ga0157379_100691122 303
46 3300025927 Ga0207687_10413340 Ga0207687_104133401 303
47 3300025961 Ga0207712_10177581 Ga0207712_101775812 303
48 3300025986 Ga0207658_10106936 Ga0207658_101069361 303
49 3300048905 Ga0496102_0016185 Ga0496102_0016185_1431_2390 303
50 3300048918 Ga0496115_0033864 Ga0496115_0033864_1601_2560 303
51 3300035083 Ga0373926_0000307 Ga0373926_0000307_6575_7534 304
52 3300035086 Ga0373934_0009944 Ga0373934_0009944_2472_3431 304
53 3300035089 Ga0373944_0000747 Ga0373944_0000747_1724_2683 304
54 3300035111 Ga0373923_0002801 Ga0373923_0002801_3598_4557 304
55 3300035113 Ga0373936_0003188 Ga0373936_0003188_4367_5326 304
56 3300035116 Ga0373945_0000024 Ga0373945_0000024_28017_28976 304
57 3300035170 Ga0373943_0006014 Ga0373943_0006014_1653_2612 304
58 3300035171 Ga0373946_0000503 Ga0373946_0000503_6693_7652 304
59 3300035172 Ga0373955_0012923 Ga0373955_0012923_1042_2001 304
60 3300035410 Ga0373924_0008537 Ga0373924_0008537_821_1780 304
61 3300035692 Ga0373935_0004347 Ga0373935_0004347_4997_5956 304
62 3300035695 Ga0373927_0025011 Ga0373927_0025011_1525_2484 304
63 3300035724 Ga0373933_0011976 Ga0373933_0011976_1102_2061 304
64 3300035725 Ga0373947_0006930 Ga0373947_0006930_5345_6304 304
65 3300036401 Ga0373937_0007576 Ga0373937_0007576_5148_6107 304
66 3300037068 Ga0373925_0162543 Ga0373925_0162543_614_1573 304
67 3300046452 Ga0495617_030003 Ga0495617_030003_82_1041 304
68 3300046454 Ga0495592_0006111 Ga0495592_0006111_2376_3335 304
69 3300046455 Ga0495603_0003742 Ga0495603_0003742_6189_7148 304
70 3300046459 Ga0495629_0045372 Ga0495629_0045372_1548_2507 304
71 3300046461 Ga0495641_0004791 Ga0495641_0004791_4484_5443 304
72 3300046462 Ga0495651_0002939 Ga0495651_0002939_8979_9938 304
73 3300046463 Ga0495653_0014789 Ga0495653_0014789_614_1573 304
74 3300046472 Ga0495580_0007742 Ga0495580_0007742_4223_5182 304
75 3300046473 Ga0495582_0007911 Ga0495582_0007911_1766_2725 304
76 3300046475 Ga0495639_0008291 Ga0495639_0008291_2887_3846 304
77 3300046476 Ga0495662_0008720 Ga0495662_0008720_1191_2150 304
78 3300046477 Ga0495664_0003487 Ga0495664_0003487_3168_4127 304
79 3300046491 Ga0495584_0008365 Ga0495584_0008365_1212_2171 304
80 3300046492 Ga0495585_0006802 Ga0495585_0006802_4506_5465 304
81 3300046499 Ga0495594_0003931 Ga0495594_0003931_265_1224 304
82 3300046501 Ga0495607_0004637 Ga0495607_0004637_3293_4252 304
83 3300046511 Ga0495608_0014069 Ga0495608_0014069_313_1272 304
84 3300046514 Ga0495618_0013518 Ga0495618_0013518_1547_2506 304
85 3300046516 Ga0495628_0032294 Ga0495628_0032294_712_1671 304
86 3300046517 Ga0495630_0006135 Ga0495630_0006135_2964_3923 304
87 3300046520 Ga0495637_0012831 Ga0495637_0012831_198_1157 304
88 3300046523 Ga0495644_0003881 Ga0495644_0003881_3357_4316 304
89 3300046526 Ga0495666_0000788 Ga0495666_0000788_8339_9298 304
90 3300046529 Ga0495652_0018691 Ga0495652_0018691_3646_4605 304
91 3300046531 Ga0495665_0000227 Ga0495665_0000227_16832_17791 304
92 3300046533 Ga0495640_0035420 Ga0495640_0035420_1980_2939 304
93 3300046536 Ga0495587_0008487 Ga0495587_0008487_2025_2984 304
94 3300046538 Ga0495609_0005483 Ga0495609_0005483_3982_4941 304
95 3300046557 Ga0495622_0005976 Ga0495622_0005976_3879_4838 304
96 3300046558 Ga0495633_0002067 Ga0495633_0002067_5076_6035 304
97 3300046559 Ga0495667_0001790 Ga0495667_0001790_8510_9469 304
98 3300046615 Ga0495656_0000293 Ga0495656_0000293_1050_2009 304
99 3300046642 Ga0495634_0010910 Ga0495634_0010910_5510_6469 304
100 3300046663 Ga0495635_0018551 Ga0495635_0018551_1980_2939 304
101 3300046664 Ga0495659_0001622 Ga0495659_0001622_5589_6548 304
102 3300046665 Ga0495661_0010629 Ga0495661_0010629_4712_5671 304
103 3300046674 Ga0495588_0001913 Ga0495588_0001913_3429_4388 304
104 3300046678 Ga0495599_0015010 Ga0495599_0015010_3343_4302 304
105 3300046680 Ga0495646_0001140 Ga0495646_0001140_5472_6431 304
106 3300046681 Ga0495647_0000989 Ga0495647_0000989_1622_2581 304
107 3300046683 Ga0495658_0004438 Ga0495658_0004438_4305_5264 304
108 3300046689 Ga0495613_0002489 Ga0495613_0002489_10767_11726 304
109 3300046690 Ga0495624_0009130 Ga0495624_0009130_4393_5352 304
110 3300046691 Ga0495670_0001083 Ga0495670_0001083_9656_10615 304
111 3300046809 Ga0495600_0010740 Ga0495600_0010740_3296_4255 304
112 3300047317 Ga0495604_0053061 Ga0495604_0053061_1669_2628 304
113 3300047319 Ga0495674_0060468 Ga0495674_0060468_1525_2484 304
114 3300047321 Ga0495676_0150273 Ga0495676_0150273_435_1394 304
115 3300047322 Ga0495680_0107613 Ga0495680_0107613_26_985 304
116 3300047471 Ga0495684_0003544 Ga0495684_0003544_2026_2985 304
117 3300047673 Ga0495593_0003809 Ga0495593_0003809_2385_3344 304
118 3300048088 Ga0495602_0066933 Ga0495602_0066933_1357_2316 304
119 3300048089 Ga0495614_0043034 Ga0495614_0043034_156_1115 304
120 3300050492 nmdc:mga0yw44_269162_c1 nmdc:mga0yw44_269162_c1_73_1029 304
121 3300053077 Ga0495601_0009898 Ga0495601_0009898_4074_5033 304
122 3300053078 Ga0495612_0000562 Ga0495612_0000562_910_1869 304
123 3300053084 Ga0495595_0001568 Ga0495595_0001568_3528_4487 304
124 3300053085 Ga0495619_0017164 Ga0495619_0017164_790_1749 304
125 3300046475 Ga0495639_0015775 Ga0495639_0015775_553_1470 305
126 3300005434 Ga0070709_10027418 Ga0070709_100274183 306
127 3300005435 Ga0070714_100004751 Ga0070714_1000047516 306
128 3300005436 Ga0070713_100007671 Ga0070713_1000076715 306
129 3300005437 Ga0070710_10012917 Ga0070710_100129173 306
130 3300005439 Ga0070711_100005015 Ga0070711_1000050157 306
131 3300005614 Ga0068856_100035670 Ga0068856_1000356705 306
132 3300006028 Ga0070717_10105419 Ga0070717_101054192 306
133 3300006163 Ga0070715_10001654 Ga0070715_100016546 306
134 3300006173 Ga0070716_100044250 Ga0070716_1000442502 306
135 3300006847 Ga0075431_100598529 Ga0075431_1005985291 306
136 3300006852 Ga0075433_10161753 Ga0075433_101617532 306
137 3300006871 Ga0075434_100209513 Ga0075434_1002095132 306
138 3300009147 Ga0114129_10341877 Ga0114129_103418772 306
139 3300048903 Ga0496100_0001173 Ga0496100_0001173_9168_10124 306
140 3300048905 Ga0496102_0015422 Ga0496102_0015422_4481_5437 306
141 3300048907 Ga0496104_0001459 Ga0496104_0001459_3802_4758 306
142 3300048908 Ga0496105_0080325 Ga0496105_0080325_444_1400 306
143 3300048910 Ga0496107_0009730 Ga0496107_0009730_65_1021 306
144 3300048911 Ga0496108_0002474 Ga0496108_0002474_13416_14372 306
145 3300048912 Ga0496109_0087451 Ga0496109_0087451_241_1197 306
146 3300048913 Ga0496110_0003213 Ga0496110_0003213_8405_9361 306
147 3300048915 Ga0496112_0017506 Ga0496112_0017506_5470_6426 306
148 3300048916 Ga0496113_0045479 Ga0496113_0045479_2130_3086 306
149 3300048918 Ga0496115_0073942 Ga0496115_0073942_578_1534 306
150 3300050512 nmdc:mga0n895_181038_c1 nmdc:mga0n895_181038_c1_509_1474 306
151 3300005439 Ga0070711_100236608 Ga0070711_1002366082 307
152 3300048908 Ga0496105_0068206 Ga0496105_0068206_1236_2189 307
153 3300048909 Ga0496106_0081055 Ga0496106_0081055_197_1153 307
154 3300048911 Ga0496108_0102293 Ga0496108_0102293_344_1297 307
155 3300048912 Ga0496109_0154503 Ga0496109_0154503_606_1559 307
156 3300048915 Ga0496112_0182491 Ga0496112_0182491_35_988 307
157 3300049571 Ga0501034_0019426 Ga0501034_0019426_4852_5814 307
158 3300049586 Ga0501070_0031315 Ga0501070_0031315_1214_2176 307
159 3300050512 nmdc:mga0n895_88860_c1 nmdc:mga0n895_88860_c1_1048_2004 307
160 3300005937 Ga0081455_10012659 Ga0081455_100126592 309
161 3300005434 Ga0070709_10072248 Ga0070709_100722482 310
162 3300005435 Ga0070714_100109397 Ga0070714_1001093971 310
163 3300005437 Ga0070710_10011385 Ga0070710_100113854 310
164 3300005439 Ga0070711_100019306 Ga0070711_1000193064 310
165 3300025898 Ga0207692_10029091 Ga0207692_100290913 310
166 3300025916 Ga0207663_10023493 Ga0207663_100234932 310
167 3300037853 Ga0436364_1033575 Ga0436364_1033575_793_1746 310
168 3300037853 Ga0436364_1402500 Ga0436364_1402500_12_965 310
169 3300039437 Ga0436365_0713111 Ga0436365_0713111_1703_2656 310
170 3300039447 Ga0436361_1211214 Ga0436361_1211214_308_1261 310
171 3300046536 Ga0495587_0061412 Ga0495587_0061412_172_1125 310
172 3300053078 Ga0495612_0112990 Ga0495612_0112990_70_1023 310
173 3300053084 Ga0495595_0123462 Ga0495595_0123462_60_1022 310
174 3300053085 Ga0495619_0032275 Ga0495619_0032275_2289_3242 310
175 3300025916 Ga0207663_10076093 Ga0207663_100760933 312
176 3300048916 Ga0496113_0065905 Ga0496113_0065905_476_1429 312
177 3300005437 Ga0070710_10033554 Ga0070710_100335542 313
178 3300005439 Ga0070711_100202919 Ga0070711_1002029192 313
179 3300006038 Ga0075365_10206831 Ga0075365_102068312 313
180 3300006175 Ga0070712_100045208 Ga0070712_1000452082 313
181 3300025916 Ga0207663_10039328 Ga0207663_100393282 313
182 3300046460 Ga0495638_0072158 Ga0495638_0072158_29_985 313
183 iso_pu_bacteria 2643221547 2643757320 315
184 3300005353 Ga0070669_100326239 Ga0070669_1003262391 317
185 3300005615 Ga0070702_100091105 Ga0070702_1000911053 317
186 3300009098 Ga0105245_10166045 Ga0105245_101660453 317
187 3300009177 Ga0105248_10153484 Ga0105248_101534843 317
188 3300025918 Ga0207662_10009869 Ga0207662_100098696 317
189 3300025923 Ga0207681_10138116 Ga0207681_101381161 317
190 3300026023 Ga0207677_10275121 Ga0207677_102751211 317
191 3300003203 JGI25406J46586_10035267 JGI25406J46586_100352672 318
192 3300005536 Ga0070697_100023727 Ga0070697_1000237277 318
193 3300005545 Ga0070695_100001486 Ga0070695_1000014863 318
194 3300005937 Ga0081455_10006099 Ga0081455_100060996 318
195 3300006871 Ga0075434_100259838 Ga0075434_1002598382 318
196 3300006914 Ga0075436_100002445 Ga0075436_1000024456 318
197 3300006914 Ga0075436_100049129 Ga0075436_1000491293 318
198 3300006946 Ga0079104_1000033 Ga0079104_10000332 318
199 3300007076 Ga0075435_100001906 Ga0075435_1000019066 318
200 3300025939 Ga0207665_10089965 Ga0207665_100899652 318
201 3300025942 Ga0207689_10399240 Ga0207689_103992401 318
202 3300028577 Ga0265318_10036446 Ga0265318_100364462 318
203 3300031240 Ga0265320_10001751 Ga0265320_100017516 318
204 3300035111 Ga0373923_0025925 Ga0373923_0025925_900_1856 318
205 3300039438 Ga0436360_0289177 Ga0436360_0289177_208_1185 318
206 3300046530 Ga0495654_0000070 Ga0495654_0000070_106033_107031 318
207 3300047447 Ga0495685_047254 Ga0495685_047254_121_1077 318
208 3300048907 Ga0496104_0467694 Ga0496104_0467694_103_1059 318
209 3300048908 Ga0496105_0286227 Ga0496105_0286227_228_1184 318
210 3300048911 Ga0496108_0251516 Ga0496108_0251516_163_1119 318
211 3300048912 Ga0496109_0001010 Ga0496109_0001010_21851_22807 318
212 3300048913 Ga0496110_0002704 Ga0496110_0002704_369_1325 318
213 3300048914 Ga0496111_0000245 Ga0496111_0000245_21461_22417 318
214 3300048915 Ga0496112_0003218 Ga0496112_0003218_419_1375 318
215 3300048924 Ga0496121_0014314 Ga0496121_0014314_4532_5518 318
216 3300048927 Ga0496124_0098935 Ga0496124_0098935_732_1718 318
217 3300049592 Ga0501076_0024247 Ga0501076_0024247_3471_4427 318
218 3300049593 Ga0501077_0022557 Ga0501077_0022557_2839_3795 318
219 3300049741 Ga0501079_0012760 Ga0501079_0012760_4738_5694 318
220 3300049742 Ga0501080_0054441 Ga0501080_0054441_1486_2442 318
221 3300050492 nmdc:mga0yw44_255353_c1 nmdc:mga0yw44_255353_c1_45_1001 318
222 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_111031_111987 318
223 3300053083 Ga0495655_0029679 Ga0495655_0029679_36_1004 318
224 3300054114 Ga0501084_0003196 Ga0501084_0003196_9106_10062 318
225 3300060353 Ga0501082_0005740 Ga0501082_0005740_4638_5594 318
226 3300061734 Ga0530510_0191855 Ga0530510_0191855_275_1231 318
227 iso_pu_bacteria 2821123053 2821123280 318
228 iso_pu_bacteria 2838736955 2838739697 318
229 iso_pu_bacteria 2841840854 2841844179 318
230 iso_pu_bacteria 2842140634 2842143900 318
231 iso_pu_bacteria 2857531043 2857533768 318
232 3300001977 JGI24746J21847_1001159 JGI24746J21847_10011594 319
233 3300001978 JGI24747J21853_1001686 JGI24747J21853_10016862 319
234 3300001990 JGI24737J22298_10003747 JGI24737J22298_100037475 319
235 3300002074 JGI24748J21848_1000922 JGI24748J21848_10009224 319
236 3300002075 JGI24738J21930_10005998 JGI24738J21930_100059983 319
237 3300002076 JGI24749J21850_1007268 JGI24749J21850_10072682 319
238 3300002126 JGI24035J26624_1003158 JGI24035J26624_10031582 319
239 3300002155 JGI24033J26618_1000670 JGI24033J26618_10006702 319
240 3300002239 JGI24034J26672_10006920 JGI24034J26672_100069202 319
241 3300002244 JGI24742J22300_10009688 JGI24742J22300_100096882 319
242 3300003911 JGI25405J52794_10006675 JGI25405J52794_100066752 319
243 3300005293 Ga0065715_10016799 Ga0065715_100167992 319
244 3300005293 Ga0065715_10127935 Ga0065715_101279351 319
245 3300005327 Ga0070658_10039334 Ga0070658_100393342 319
246 3300005328 Ga0070676_10204072 Ga0070676_102040721 319
247 3300005329 Ga0070683_100248921 Ga0070683_1002489212 319
248 3300005330 Ga0070690_100040084 Ga0070690_1000400843 319
249 3300005331 Ga0070670_100024012 Ga0070670_1000240125 319
250 3300005331 Ga0070670_100046489 Ga0070670_1000464892 319
251 3300005333 Ga0070677_10017515 Ga0070677_100175152 319
252 3300005334 Ga0068869_100000546 Ga0068869_1000005462 319
253 3300005335 Ga0070666_10003351 Ga0070666_100033512 319
254 3300005335 Ga0070666_10024866 Ga0070666_100248662 319
255 3300005336 Ga0070680_100102443 Ga0070680_1001024431 319
256 3300005336 Ga0070680_100133966 Ga0070680_1001339662 319
257 3300005336 Ga0070680_100137235 Ga0070680_1001372352 319
258 3300005337 Ga0070682_100003749 Ga0070682_1000037493 319
259 3300005337 Ga0070682_100008347 Ga0070682_1000083472 319
260 3300005338 Ga0068868_100076157 Ga0068868_1000761572 319
261 3300005339 Ga0070660_100032484 Ga0070660_1000324844 319
262 3300005340 Ga0070689_100011088 Ga0070689_1000110884 319
263 3300005343 Ga0070687_100002463 Ga0070687_1000024632 319
264 3300005344 Ga0070661_100001763 Ga0070661_1000017635 319
265 3300005345 Ga0070692_10004998 Ga0070692_100049982 319
266 3300005347 Ga0070668_100029340 Ga0070668_1000293402 319
267 3300005353 Ga0070669_100257439 Ga0070669_1002574392 319
268 3300005354 Ga0070675_100148503 Ga0070675_1001485032 319
269 3300005355 Ga0070671_100000400 Ga0070671_10000040027 319
270 3300005355 Ga0070671_100016183 Ga0070671_1000161835 319
271 3300005355 Ga0070671_100342741 Ga0070671_1003427412 319
272 3300005356 Ga0070674_100003887 Ga0070674_1000038874 319
273 3300005364 Ga0070673_100003044 Ga0070673_1000030446 319
274 3300005364 Ga0070673_100049035 Ga0070673_1000490352 319
275 3300005364 Ga0070673_100086054 Ga0070673_1000860542 319
276 3300005365 Ga0070688_100041330 Ga0070688_1000413302 319
277 3300005365 Ga0070688_100181830 Ga0070688_1001818302 319
278 3300005366 Ga0070659_100011935 Ga0070659_1000119357 319
279 3300005366 Ga0070659_100015673 Ga0070659_1000156736 319
280 3300005366 Ga0070659_100160842 Ga0070659_1001608422 319
281 3300005367 Ga0070667_100019668 Ga0070667_1000196687 319
282 3300005367 Ga0070667_100029206 Ga0070667_1000292065 319
283 3300005406 Ga0070703_10001633 Ga0070703_100016335 319
284 3300005434 Ga0070709_10089154 Ga0070709_100891542 319
285 3300005435 Ga0070714_100031618 Ga0070714_1000316184 319
286 3300005435 Ga0070714_100140294 Ga0070714_1001402942 319
287 3300005435 Ga0070714_100229489 Ga0070714_1002294891 319
288 3300005435 Ga0070714_100369296 Ga0070714_1003692961 319
289 3300005436 Ga0070713_100010726 Ga0070713_1000107265 319
290 3300005437 Ga0070710_10002075 Ga0070710_100020754 319
291 3300005439 Ga0070711_100007887 Ga0070711_1000078875 319
292 3300005439 Ga0070711_100011777 Ga0070711_1000117775 319
293 3300005440 Ga0070705_100006364 Ga0070705_1000063642 319
294 3300005444 Ga0070694_100036409 Ga0070694_1000364092 319
295 3300005445 Ga0070708_100192603 Ga0070708_1001926033 319
296 3300005456 Ga0070678_100058654 Ga0070678_1000586543 319
297 3300005458 Ga0070681_10105774 Ga0070681_101057741 319
298 3300005458 Ga0070681_10192416 Ga0070681_101924162 319
299 3300005458 Ga0070681_10332042 Ga0070681_103320421 319
300 3300005458 Ga0070681_10497225 Ga0070681_104972251 319
301 3300005459 Ga0068867_100017455 Ga0068867_1000174552 319
302 3300005466 Ga0070685_10017509 Ga0070685_100175092 319
303 3300005530 Ga0070679_100063969 Ga0070679_1000639694 319
304 3300005530 Ga0070679_100579055 Ga0070679_1005790551 319
305 3300005535 Ga0070684_100036616 Ga0070684_1000366164 319
306 3300005535 Ga0070684_100375809 Ga0070684_1003758092 319
307 3300005539 Ga0068853_100051046 Ga0068853_1000510462 319
308 3300005539 Ga0068853_100077862 Ga0068853_1000778623 319
309 3300005543 Ga0070672_100000643 Ga0070672_10000064319 319
310 3300005543 Ga0070672_100127325 Ga0070672_1001273253 319
311 3300005544 Ga0070686_100001304 Ga0070686_10000130412 319
312 3300005544 Ga0070686_100010740 Ga0070686_1000107406 319
313 3300005545 Ga0070695_100004408 Ga0070695_1000044086 319
314 3300005545 Ga0070695_100022935 Ga0070695_1000229352 319
315 3300005547 Ga0070693_100002192 Ga0070693_1000021926 319
316 3300005547 Ga0070693_100027483 Ga0070693_1000274833 319
317 3300005548 Ga0070665_100056218 Ga0070665_1000562185 319
318 3300005563 Ga0068855_100164557 Ga0068855_1001645572 319
319 3300005563 Ga0068855_100170700 Ga0068855_1001707002 319
320 3300005563 Ga0068855_100212389 Ga0068855_1002123892 319
321 3300005564 Ga0070664_100106672 Ga0070664_1001066722 319
322 3300005577 Ga0068857_100010309 Ga0068857_1000103096 319
323 3300005577 Ga0068857_100301999 Ga0068857_1003019992 319
324 3300005578 Ga0068854_100019339 Ga0068854_1000193392 319
325 3300005614 Ga0068856_100005954 Ga0068856_1000059545 319
326 3300005614 Ga0068856_100233903 Ga0068856_1002339032 319
327 3300005614 Ga0068856_100268798 Ga0068856_1002687981 319
328 3300005615 Ga0070702_100010184 Ga0070702_1000101845 319
329 3300005616 Ga0068852_100036031 Ga0068852_1000360312 319
330 3300005616 Ga0068852_100121781 Ga0068852_1001217812 319
331 3300005618 Ga0068864_100004096 Ga0068864_1000040962 319
332 3300005618 Ga0068864_100017192 Ga0068864_1000171921 319
333 3300005718 Ga0068866_10054983 Ga0068866_100549833 319
334 3300005840 Ga0068870_10002536 Ga0068870_100025363 319
335 3300005841 Ga0068863_100011785 Ga0068863_1000117856 319
336 3300005841 Ga0068863_100041941 Ga0068863_1000419412 319
337 3300005842 Ga0068858_100027284 Ga0068858_1000272843 319
338 3300005842 Ga0068858_100049561 Ga0068858_1000495615 319
339 3300005842 Ga0068858_100059547 Ga0068858_1000595474 319
340 3300005843 Ga0068860_100031698 Ga0068860_1000316982 319
341 3300005843 Ga0068860_100177201 Ga0068860_1001772012 319
342 3300005937 Ga0081455_10000081 Ga0081455_1000008167 319
343 3300005937 Ga0081455_10012001 Ga0081455_100120018 319
344 3300005937 Ga0081455_10073907 Ga0081455_100739072 319
345 3300005937 Ga0081455_10080569 Ga0081455_100805692 319
346 3300005983 Ga0081540_1010241 Ga0081540_10102411 319
347 3300006028 Ga0070717_10000980 Ga0070717_100009805 319
348 3300006058 Ga0075432_10001738 Ga0075432_100017386 319
349 3300006163 Ga0070715_10002687 Ga0070715_100026875 319
350 3300006173 Ga0070716_100018566 Ga0070716_1000185662 319
351 3300006173 Ga0070716_100085376 Ga0070716_1000853762 319
352 3300006175 Ga0070712_100011997 Ga0070712_1000119975 319
353 3300006178 Ga0075367_10060427 Ga0075367_100604272 319
354 3300006178 Ga0075367_10099118 Ga0075367_100991183 319
355 3300006237 Ga0097621_100197389 Ga0097621_1001973892 319
356 3300006358 Ga0068871_100002394 Ga0068871_1000023942 319
357 3300006358 Ga0068871_100012591 Ga0068871_1000125914 319
358 3300006844 Ga0075428_100002359 Ga0075428_1000023593 319
359 3300006846 Ga0075430_100000424 Ga0075430_10000042420 319
360 3300006847 Ga0075431_100001606 Ga0075431_10000160620 319
361 3300006852 Ga0075433_10000012 Ga0075433_1000001246 319
362 3300006852 Ga0075433_10030391 Ga0075433_100303913 319
363 3300006852 Ga0075433_10104642 Ga0075433_101046422 319
364 3300006871 Ga0075434_100000692 Ga0075434_1000006927 319
365 3300006871 Ga0075434_100035497 Ga0075434_1000354973 319
366 3300006871 Ga0075434_100116442 Ga0075434_1001164423 319
367 3300006871 Ga0075434_100408739 Ga0075434_1004087391 319
368 3300006880 Ga0075429_100000558 Ga0075429_10000055831 319
369 3300006914 Ga0075436_100065592 Ga0075436_1000655921 319
370 3300006914 Ga0075436_100282494 Ga0075436_1002824941 319
371 3300007076 Ga0075435_100010893 Ga0075435_1000108935 319
372 3300007076 Ga0075435_100015701 Ga0075435_1000157014 319
373 3300007076 Ga0075435_100029529 Ga0075435_1000295292 319
374 3300007076 Ga0075435_100160557 Ga0075435_1001605572 319
375 3300009011 Ga0105251_10009318 Ga0105251_100093186 319
376 3300009036 Ga0105244_10059776 Ga0105244_100597762 319
377 3300009093 Ga0105240_10083193 Ga0105240_100831933 319
378 3300009093 Ga0105240_10293290 Ga0105240_102932901 319
379 3300009093 Ga0105240_10333055 Ga0105240_103330552 319
380 3300009093 Ga0105240_10640716 Ga0105240_106407161 319
381 3300009094 Ga0111539_10003218 Ga0111539_100032183 319
382 3300009094 Ga0111539_10040187 Ga0111539_100401873 319
383 3300009098 Ga0105245_10001227 Ga0105245_1000122721 319
384 3300009098 Ga0105245_10102473 Ga0105245_101024731 319
385 3300009101 Ga0105247_10007843 Ga0105247_100078432 319
386 3300009147 Ga0114129_10000803 Ga0114129_1000080321 319
387 3300009147 Ga0114129_10006740 Ga0114129_1000674015 319
388 3300009148 Ga0105243_10006687 Ga0105243_100066876 319
389 3300009148 Ga0105243_10008944 Ga0105243_100089445 319
390 3300009174 Ga0105241_10002078 Ga0105241_1000207815 319
391 3300009174 Ga0105241_10145543 Ga0105241_101455433 319
392 3300009176 Ga0105242_10012319 Ga0105242_100123193 319
393 3300009176 Ga0105242_10022262 Ga0105242_100222622 319
394 3300009176 Ga0105242_10071893 Ga0105242_100718932 319
395 3300009177 Ga0105248_10016502 Ga0105248_100165026 319
396 3300009177 Ga0105248_10090176 Ga0105248_100901762 319
397 3300009177 Ga0105248_10091208 Ga0105248_100912082 319
398 3300009177 Ga0105248_10206505 Ga0105248_102065052 319
399 3300009545 Ga0105237_10028276 Ga0105237_100282764 319
400 3300009545 Ga0105237_10201037 Ga0105237_102010372 319
401 3300009545 Ga0105237_10330868 Ga0105237_103308682 319
402 3300009551 Ga0105238_10034096 Ga0105238_100340965 319
403 3300009551 Ga0105238_10039765 Ga0105238_100397654 319
404 3300009551 Ga0105238_10072890 Ga0105238_100728902 319
405 3300009553 Ga0105249_10056093 Ga0105249_100560932 319
406 3300009553 Ga0105249_10084429 Ga0105249_100844293 319
407 3300010375 Ga0105239_10071027 Ga0105239_100710273 319
408 3300011119 Ga0105246_10017784 Ga0105246_100177845 319
409 3300011119 Ga0105246_10018580 Ga0105246_100185804 319
410 3300013100 Ga0157373_10053046 Ga0157373_100530462 319
411 3300013100 Ga0157373_10057970 Ga0157373_100579703 319
412 3300013102 Ga0157371_10036077 Ga0157371_100360772 319
413 3300013102 Ga0157371_10110696 Ga0157371_101106962 319
414 3300013104 Ga0157370_10066661 Ga0157370_100666613 319
415 3300013104 Ga0157370_10084465 Ga0157370_100844654 319
416 3300013104 Ga0157370_10290506 Ga0157370_102905061 319
417 3300013105 Ga0157369_10125307 Ga0157369_101253071 319
418 3300013296 Ga0157374_10001167 Ga0157374_1000116714 319
419 3300013296 Ga0157374_10123181 Ga0157374_101231812 319
420 3300013306 Ga0163162_10081228 Ga0163162_100812283 319
421 3300013306 Ga0163162_10172458 Ga0163162_101724583 319
422 3300013307 Ga0157372_10175216 Ga0157372_101752162 319
423 3300013307 Ga0157372_10183661 Ga0157372_101836612 319
424 3300013307 Ga0157372_10254806 Ga0157372_102548062 319
425 3300013308 Ga0157375_10024045 Ga0157375_100240453 319
426 3300014325 Ga0163163_10004077 Ga0163163_100040774 319
427 3300014325 Ga0163163_10011690 Ga0163163_100116905 319
428 3300014325 Ga0163163_10127494 Ga0163163_101274943 319
429 3300014326 Ga0157380_10187910 Ga0157380_101879101 319
430 3300014497 Ga0182008_10047790 Ga0182008_100477902 319
431 3300014745 Ga0157377_10005174 Ga0157377_100051742 319
432 3300014968 Ga0157379_10015293 Ga0157379_100152932 319
433 3300014968 Ga0157379_10019074 Ga0157379_100190742 319
434 3300014968 Ga0157379_10045579 Ga0157379_100455795 319
435 3300014969 Ga0157376_10008081 Ga0157376_100080816 319
436 3300014969 Ga0157376_10008909 Ga0157376_100089096 319
437 3300017792 Ga0163161_10023558 Ga0163161_100235584 319
438 3300017792 Ga0163161_10050839 Ga0163161_100508392 319
439 3300025271 Ga0207666_1000303 Ga0207666_10003035 319
440 3300025290 Ga0207673_1000268 Ga0207673_10002685 319
441 3300025315 Ga0207697_10010266 Ga0207697_100102662 319
442 3300025735 Ga0207713_1012260 Ga0207713_10122601 319
443 3300025885 Ga0207653_10001180 Ga0207653_100011805 319
444 3300025893 Ga0207682_10000169 Ga0207682_1000016929 319
445 3300025900 Ga0207710_10000382 Ga0207710_100003824 319
446 3300025900 Ga0207710_10009676 Ga0207710_100096765 319
447 3300025901 Ga0207688_10005457 Ga0207688_100054575 319
448 3300025903 Ga0207680_10005813 Ga0207680_100058134 319
449 3300025904 Ga0207647_10018922 Ga0207647_100189225 319
450 3300025906 Ga0207699_10003983 Ga0207699_100039835 319
451 3300025907 Ga0207645_10013151 Ga0207645_100131516 319
452 3300025908 Ga0207643_10000004 Ga0207643_1000000489 319
453 3300025909 Ga0207705_10362780 Ga0207705_103627801 319
454 3300025911 Ga0207654_10004998 Ga0207654_100049983 319
455 3300025912 Ga0207707_10079866 Ga0207707_100798663 319
456 3300025912 Ga0207707_10273712 Ga0207707_102737122 319
457 3300025912 Ga0207707_10292798 Ga0207707_102927981 319
458 3300025912 Ga0207707_10348390 Ga0207707_103483901 319
459 3300025913 Ga0207695_10088462 Ga0207695_100884622 319
460 3300025913 Ga0207695_10229620 Ga0207695_102296202 319
461 3300025915 Ga0207693_10001228 Ga0207693_100012285 319
462 3300025915 Ga0207693_10037515 Ga0207693_100375153 319
463 3300025915 Ga0207693_10086622 Ga0207693_100866222 319
464 3300025916 Ga0207663_10008842 Ga0207663_100088422 319
465 3300025917 Ga0207660_10002588 Ga0207660_100025883 319
466 3300025917 Ga0207660_10258602 Ga0207660_102586021 319
467 3300025917 Ga0207660_10343333 Ga0207660_103433331 319
468 3300025918 Ga0207662_10000392 Ga0207662_1000039217 319
469 3300025919 Ga0207657_10002007 Ga0207657_100020075 319
470 3300025919 Ga0207657_10050436 Ga0207657_100504363 319
471 3300025919 Ga0207657_10089083 Ga0207657_100890832 319
472 3300025919 Ga0207657_10121258 Ga0207657_101212582 319
473 3300025920 Ga0207649_10003920 Ga0207649_100039202 319
474 3300025920 Ga0207649_10020993 Ga0207649_100209935 319
475 3300025921 Ga0207652_10101001 Ga0207652_101010013 319
476 3300025921 Ga0207652_10191138 Ga0207652_101911382 319
477 3300025921 Ga0207652_10200343 Ga0207652_102003432 319
478 3300025923 Ga0207681_10020237 Ga0207681_100202372 319
479 3300025924 Ga0207694_10059618 Ga0207694_100596182 319
480 3300025924 Ga0207694_10112628 Ga0207694_101126283 319
481 3300025925 Ga0207650_10004443 Ga0207650_100044435 319
482 3300025926 Ga0207659_10000038 Ga0207659_10000038106 319
483 3300025927 Ga0207687_10007503 Ga0207687_100075034 319
484 3300025927 Ga0207687_10019017 Ga0207687_100190173 319
485 3300025927 Ga0207687_10022230 Ga0207687_100222305 319
486 3300025928 Ga0207700_10002133 Ga0207700_100021334 319
487 3300025929 Ga0207664_10389635 Ga0207664_103896352 319
488 3300025929 Ga0207664_10428049 Ga0207664_104280491 319
489 3300025931 Ga0207644_10002653 Ga0207644_1000265313 319
490 3300025931 Ga0207644_10014180 Ga0207644_100141801 319
491 3300025931 Ga0207644_10257919 Ga0207644_102579192 319
492 3300025932 Ga0207690_10008630 Ga0207690_100086305 319
493 3300025933 Ga0207706_10015380 Ga0207706_100153805 319
494 3300025934 Ga0207686_10005483 Ga0207686_100054835 319
495 3300025934 Ga0207686_10008322 Ga0207686_100083222 319
496 3300025935 Ga0207709_10000645 Ga0207709_100006455 319
497 3300025935 Ga0207709_10005944 Ga0207709_100059446 319
498 3300025936 Ga0207670_10026558 Ga0207670_100265584 319
499 3300025936 Ga0207670_10084696 Ga0207670_100846963 319
500 3300025937 Ga0207669_10039382 Ga0207669_100393823 319
501 3300025938 Ga0207704_10001273 Ga0207704_100012733 319
502 3300025938 Ga0207704_10230260 Ga0207704_102302601 319
503 3300025939 Ga0207665_10000541 Ga0207665_1000054117 319
504 3300025939 Ga0207665_10073437 Ga0207665_100734372 319
505 3300025939 Ga0207665_10136395 Ga0207665_101363951 319
506 3300025940 Ga0207691_10016931 Ga0207691_100169315 319
507 3300025940 Ga0207691_10093273 Ga0207691_100932733 319
508 3300025941 Ga0207711_10002645 Ga0207711_1000264512 319
509 3300025941 Ga0207711_10008404 Ga0207711_100084049 319
510 3300025941 Ga0207711_10188165 Ga0207711_101881652 319
511 3300025942 Ga0207689_10013698 Ga0207689_100136985 319
512 3300025942 Ga0207689_10044297 Ga0207689_100442975 319
513 3300025944 Ga0207661_10094127 Ga0207661_100941272 319
514 3300025944 Ga0207661_10146059 Ga0207661_101460592 319
515 3300025944 Ga0207661_10167727 Ga0207661_101677272 319
516 3300025945 Ga0207679_10000673 Ga0207679_100006735 319
517 3300025949 Ga0207667_10162417 Ga0207667_101624172 319
518 3300025949 Ga0207667_10236644 Ga0207667_102366442 319
519 3300025949 Ga0207667_10483851 Ga0207667_104838511 319
520 3300025960 Ga0207651_10004796 Ga0207651_100047962 319
521 3300025960 Ga0207651_10025240 Ga0207651_100252403 319
522 3300025960 Ga0207651_10034700 Ga0207651_100347004 319
523 3300025961 Ga0207712_10104383 Ga0207712_101043832 319
524 3300025972 Ga0207668_10000300 Ga0207668_100003005 319
525 3300025972 Ga0207668_10267865 Ga0207668_102678651 319
526 3300025981 Ga0207640_10013982 Ga0207640_100139822 319
527 3300025986 Ga0207658_10267483 Ga0207658_102674831 319
528 3300026023 Ga0207677_10052019 Ga0207677_100520191 319
529 3300026035 Ga0207703_10001822 Ga0207703_100018223 319
530 3300026035 Ga0207703_10015219 Ga0207703_100152192 319
531 3300026035 Ga0207703_10139922 Ga0207703_101399222 319
532 3300026041 Ga0207639_10070130 Ga0207639_100701302 319
533 3300026041 Ga0207639_10148777 Ga0207639_101487772 319
534 3300026067 Ga0207678_10001349 Ga0207678_1000134920 319
535 3300026075 Ga0207708_10010365 Ga0207708_100103655 319
536 3300026078 Ga0207702_10088874 Ga0207702_100888742 319
537 3300026088 Ga0207641_10301118 Ga0207641_103011182 319
538 3300026089 Ga0207648_10015829 Ga0207648_100158295 319
539 3300026095 Ga0207676_10001979 Ga0207676_100019794 319
540 3300026116 Ga0207674_10022363 Ga0207674_100223635 319
541 3300026116 Ga0207674_10165967 Ga0207674_101659672 319
542 3300026118 Ga0207675_100016410 Ga0207675_1000164105 319
543 3300026121 Ga0207683_10000138 Ga0207683_1000013861 319
544 3300026121 Ga0207683_10009051 Ga0207683_100090513 319
545 3300026121 Ga0207683_10016053 Ga0207683_100160536 319
546 3300026142 Ga0207698_10085087 Ga0207698_100850873 319
547 3300027252 Ga0209973_1006386 Ga0209973_10063861 319
548 3300027695 Ga0209966_1006273 Ga0209966_10062732 319
549 3300027717 Ga0209998_10001517 Ga0209998_100015174 319
550 3300027876 Ga0209974_10007950 Ga0209974_100079503 319
551 3300027907 Ga0207428_10000137 Ga0207428_1000013774 319
552 3300027907 Ga0207428_10000501 Ga0207428_1000050136 319
553 3300028379 Ga0268266_10001262 Ga0268266_1000126221 319
554 3300028379 Ga0268266_10124169 Ga0268266_101241692 319
555 3300028380 Ga0268265_10112629 Ga0268265_101126292 319
556 3300028380 Ga0268265_10287661 Ga0268265_102876612 319
557 3300028381 Ga0268264_10063392 Ga0268264_100633922 319
558 3300028381 Ga0268264_10217987 Ga0268264_102179872 319
559 3300028800 Ga0265338_10057618 Ga0265338_100576184 319
560 3300031241 Ga0265325_10000073 Ga0265325_1000007320 319
561 3300031241 Ga0265325_10001135 Ga0265325_1000113518 319
562 3300031241 Ga0265325_10028736 Ga0265325_100287364 319
563 3300031241 Ga0265325_10040658 Ga0265325_100406581 319
564 3300031241 Ga0265325_10068229 Ga0265325_100682292 319
565 3300031247 Ga0265340_10040674 Ga0265340_100406742 319
566 3300031247 Ga0265340_10153859 Ga0265340_101538591 319
567 3300031249 Ga0265339_10042095 Ga0265339_100420952 319
568 3300031344 Ga0265316_10026938 Ga0265316_100269384 319
569 3300031595 Ga0265313_10000716 Ga0265313_1000071621 319
570 3300031595 Ga0265313_10013800 Ga0265313_100138004 319
571 3300031595 Ga0265313_10013961 Ga0265313_100139612 319
572 3300031595 Ga0265313_10020135 Ga0265313_100201355 319
573 3300031595 Ga0265313_10056708 Ga0265313_100567082 319
574 3300031665 Ga0316575_10021421 Ga0316575_100214213 319
575 3300031691 Ga0316579_10039950 Ga0316579_100399502 319
576 3300031711 Ga0265314_10164738 Ga0265314_101647382 319
577 3300031712 Ga0265342_10000308 Ga0265342_100003082 319
578 3300031712 Ga0265342_10007094 Ga0265342_100070947 319
579 3300032133 Ga0316583_10013697 Ga0316583_100136973 319
580 3300032133 Ga0316583_10051472 Ga0316583_100514721 319
581 3300034957 Ga0373938_0003594 Ga0373938_0003594_926_1885 319
582 3300035083 Ga0373926_0002849 Ga0373926_0002849_195_1154 319
583 3300035090 Ga0373949_0004634 Ga0373949_0004634_1842_2801 319
584 3300035092 Ga0373952_0000958 Ga0373952_0000958_315_1274 319
585 3300035092 Ga0373952_0003763 Ga0373952_0003763_591_1550 319
586 3300035112 Ga0373932_0019923 Ga0373932_0019923_547_1506 319
587 3300035113 Ga0373936_0061809 Ga0373936_0061809_13_972 319
588 3300035114 Ga0373939_0000167 Ga0373939_0000167_12576_13571 319
589 3300035114 Ga0373939_0001060 Ga0373939_0001060_584_1543 319
590 3300035115 Ga0373941_0008094 Ga0373941_0008094_648_1607 319
591 3300035116 Ga0373945_0034814 Ga0373945_0034814_69_1028 319
592 3300035117 Ga0373953_0010186 Ga0373953_0010186_1063_2022 319
593 3300035117 Ga0373953_0018966 Ga0373953_0018966_1546_2505 319
594 3300035117 Ga0373953_0046524 Ga0373953_0046524_728_1690 319
595 3300035118 Ga0373954_0010267 Ga0373954_0010267_1239_2198 319
596 3300035119 Ga0373956_0012714 Ga0373956_0012714_1901_2860 319
597 3300035119 Ga0373956_0015207 Ga0373956_0015207_499_1461 319
598 3300035120 Ga0373957_0014956 Ga0373957_0014956_964_1926 319
599 3300035121 Ga0373960_0010409 Ga0373960_0010409_895_1854 319
600 3300035170 Ga0373943_0003950 Ga0373943_0003950_3274_4233 319
601 3300035171 Ga0373946_0012060 Ga0373946_0012060_1497_2456 319
602 3300035172 Ga0373955_0010594 Ga0373955_0010594_256_1215 319
603 3300035172 Ga0373955_0094137 Ga0373955_0094137_398_1360 319
604 3300035207 Ga0373942_0010013 Ga0373942_0010013_399_1358 319
605 3300035241 Ga0373961_0040393 Ga0373961_0040393_356_1315 319
606 3300035242 Ga0373962_0003809 Ga0373962_0003809_2536_3495 319
607 3300035242 Ga0373962_0021487 Ga0373962_0021487_288_1247 319
608 3300035410 Ga0373924_0002384 Ga0373924_0002384_4152_5111 319
609 3300035691 Ga0373931_0002836 Ga0373931_0002836_2209_3168 319
610 3300035691 Ga0373931_0080738 Ga0373931_0080738_26_985 319
611 3300035692 Ga0373935_0019290 Ga0373935_0019290_1341_2300 319
612 3300035692 Ga0373935_0031623 Ga0373935_0031623_197_1156 319
613 3300035695 Ga0373927_0002644 Ga0373927_0002644_5449_6408 319
614 3300035724 Ga0373933_0033264 Ga0373933_0033264_1471_2433 319
615 3300035725 Ga0373947_0001717 Ga0373947_0001717_10587_11546 319
616 3300035725 Ga0373947_0033880 Ga0373947_0033880_532_1491 319
617 3300035725 Ga0373947_0206113 Ga0373947_0206113_43_1002 319
618 3300036401 Ga0373937_0010057 Ga0373937_0010057_6408_7370 319
619 3300036401 Ga0373937_0060239 Ga0373937_0060239_1234_2193 319
620 3300036401 Ga0373937_0208874 Ga0373937_0208874_839_1798 319
621 3300037068 Ga0373925_0009737 Ga0373925_0009737_3150_4109 319
622 3300037068 Ga0373925_0175271 Ga0373925_0175271_698_1657 319
623 3300037068 Ga0373925_0440104 Ga0373925_0440104_81_1040 319
624 3300037312 Ga0395899_0036141 Ga0395899_0036141_987_1946 319
625 3300037418 Ga0395900_0005226 Ga0395900_0005226_9686_10645 319
626 3300037466 Ga0395898_0041183 Ga0395898_0041183_996_1955 319
627 3300037466 Ga0395898_0071635 Ga0395898_0071635_969_1928 319
628 3300037466 Ga0395898_0097810 Ga0395898_0097810_1176_2135 319
629 3300038443 Ga0395901_0059145 Ga0395901_0059145_2810_3769 319
630 3300042005 Ga0439448_0020540 Ga0439448_0020540_768_1727 319
631 3300044684 Ga0466966_0036234 Ga0466966_0036234_921_1880 319
632 3300044693 Ga0466961_0151821 Ga0466961_0151821_268_1227 319
633 3300044694 Ga0466963_0057036 Ga0466963_0057036_80_1039 319
634 3300044842 Ga0466957_0191744 Ga0466957_0191744_310_1269 319
635 3300045049 Ga0466959_0165525 Ga0466959_0165525_101_1060 319
636 3300045976 Ga0466967_0011672 Ga0466967_0011672_4601_5560 319
637 3300046454 Ga0495592_0017486 Ga0495592_0017486_3651_4610 319
638 3300046455 Ga0495603_0005609 Ga0495603_0005609_2055_3014 319
639 3300046459 Ga0495629_0000753 Ga0495629_0000753_6490_7449 319
640 3300046459 Ga0495629_0124027 Ga0495629_0124027_45_1004 319
641 3300046462 Ga0495651_0001426 Ga0495651_0001426_10487_11446 319
642 3300046463 Ga0495653_0037014 Ga0495653_0037014_2122_3081 319
643 3300046463 Ga0495653_0087496 Ga0495653_0087496_108_1070 319
644 3300046473 Ga0495582_0058793 Ga0495582_0058793_887_1846 319
645 3300046475 Ga0495639_0082540 Ga0495639_0082540_477_1436 319
646 3300046476 Ga0495662_0016049 Ga0495662_0016049_1575_2534 319
647 3300046491 Ga0495584_0037411 Ga0495584_0037411_363_1322 319
648 3300046499 Ga0495594_0009417 Ga0495594_0009417_161_1120 319
649 3300046499 Ga0495594_0009717 Ga0495594_0009717_3062_4021 319
650 3300046511 Ga0495608_0013047 Ga0495608_0013047_2932_3891 319
651 3300046511 Ga0495608_0061288 Ga0495608_0061288_690_1652 319
652 3300046514 Ga0495618_0003047 Ga0495618_0003047_5619_6578 319
653 3300046516 Ga0495628_0019182 Ga0495628_0019182_1572_2531 319
654 3300046517 Ga0495630_0079495 Ga0495630_0079495_1102_2061 319
655 3300046526 Ga0495666_0046412 Ga0495666_0046412_178_1137 319
656 3300046529 Ga0495652_0017441 Ga0495652_0017441_4003_4962 319
657 3300046531 Ga0495665_0191071 Ga0495665_0191071_35_994 319
658 3300046536 Ga0495587_0004130 Ga0495587_0004130_5018_5977 319
659 3300046543 Ga0495645_0010540 Ga0495645_0010540_3651_4610 319
660 3300046559 Ga0495667_0078718 Ga0495667_0078718_1039_2001 319
661 3300046674 Ga0495588_0040109 Ga0495588_0040109_13_972 319
662 3300046674 Ga0495588_0127826 Ga0495588_0127826_47_1006 319
663 3300046675 Ga0495657_0012549 Ga0495657_0012549_1466_2425 319
664 3300046675 Ga0495657_0042837 Ga0495657_0042837_984_1946 319
665 3300046679 Ga0495623_0125668 Ga0495623_0125668_433_1395 319
666 3300046680 Ga0495646_0002961 Ga0495646_0002961_8069_9028 319
667 3300046681 Ga0495647_0047755 Ga0495647_0047755_596_1555 319
668 3300046681 Ga0495647_0127768 Ga0495647_0127768_71_1030 319
669 3300046683 Ga0495658_0000543 Ga0495658_0000543_8534_9493 319
670 3300046683 Ga0495658_0004686 Ga0495658_0004686_1946_2905 319
671 3300046689 Ga0495613_0050781 Ga0495613_0050781_1787_2746 319
672 3300046689 Ga0495613_0072220 Ga0495613_0072220_964_1923 319
673 3300047315 Ga0495581_0018686 Ga0495581_0018686_711_1670 319
674 3300047317 Ga0495604_0003959 Ga0495604_0003959_3651_4610 319
675 3300047321 Ga0495676_0030918 Ga0495676_0030918_181_1140 319
676 3300047321 Ga0495676_0054653 Ga0495676_0054653_1159_2118 319
677 3300047322 Ga0495680_0015238 Ga0495680_0015238_164_1123 319
678 3300047322 Ga0495680_0045737 Ga0495680_0045737_1661_2623 319
679 3300047322 Ga0495680_0297981 Ga0495680_0297981_80_1039 319
680 3300047444 Ga0495675_0001398 Ga0495675_0001398_851_1810 319
681 3300047444 Ga0495675_0046094 Ga0495675_0046094_893_1855 319
682 3300047471 Ga0495684_0091259 Ga0495684_0091259_1072_2031 319
683 3300047471 Ga0495684_0279169 Ga0495684_0279169_165_1124 319
684 3300047673 Ga0495593_0038641 Ga0495593_0038641_448_1407 319
685 3300047673 Ga0495593_0056214 Ga0495593_0056214_48_1007 319
686 3300048088 Ga0495602_0027639 Ga0495602_0027639_839_1798 319
687 3300048088 Ga0495602_0051565 Ga0495602_0051565_1683_2645 319
688 3300048089 Ga0495614_0022916 Ga0495614_0022916_879_1838 319
689 3300048903 Ga0496100_0017497 Ga0496100_0017497_740_1699 319
690 3300048903 Ga0496100_0047791 Ga0496100_0047791_1305_2264 319
691 3300048904 Ga0496101_0011631 Ga0496101_0011631_1305_2264 319
692 3300048904 Ga0496101_0047399 Ga0496101_0047399_1901_2860 319
693 3300048904 Ga0496101_0236279 Ga0496101_0236279_232_1191 319
694 3300048905 Ga0496102_0009243 Ga0496102_0009243_42_1001 319
695 3300048905 Ga0496102_0143773 Ga0496102_0143773_17_976 319
696 3300048905 Ga0496102_0320748 Ga0496102_0320748_394_1353 319
697 3300048906 Ga0496103_0011411 Ga0496103_0011411_2909_3868 319
698 3300048907 Ga0496104_0002184 Ga0496104_0002184_5665_6624 319
699 3300048908 Ga0496105_0003206 Ga0496105_0003206_5854_6813 319
700 3300048910 Ga0496107_0016951 Ga0496107_0016951_582_1541 319
701 3300048910 Ga0496107_0022673 Ga0496107_0022673_2809_3768 319
702 3300048911 Ga0496108_0037785 Ga0496108_0037785_833_1792 319
703 3300048911 Ga0496108_0139082 Ga0496108_0139082_756_1715 319
704 3300048912 Ga0496109_0004575 Ga0496109_0004575_733_1692 319
705 3300048912 Ga0496109_0009961 Ga0496109_0009961_3845_4804 319
706 3300048912 Ga0496109_0016091 Ga0496109_0016091_1432_2391 319
707 3300048912 Ga0496109_0094444 Ga0496109_0094444_778_1737 319
708 3300048913 Ga0496110_0063136 Ga0496110_0063136_2302_3261 319
709 3300048913 Ga0496110_0144635 Ga0496110_0144635_31_990 319
710 3300048914 Ga0496111_0055333 Ga0496111_0055333_140_1099 319
711 3300048914 Ga0496111_0086834 Ga0496111_0086834_385_1344 319
712 3300048915 Ga0496112_0079598 Ga0496112_0079598_756_1715 319
713 3300048915 Ga0496112_0093480 Ga0496112_0093480_211_1170 319
714 3300048916 Ga0496113_0174178 Ga0496113_0174178_11_970 319
715 3300048917 Ga0496114_0004868 Ga0496114_0004868_7583_8542 319
716 3300048917 Ga0496114_0025726 Ga0496114_0025726_3274_4233 319
717 3300048918 Ga0496115_0032160 Ga0496115_0032160_1790_2749 319
718 3300048918 Ga0496115_0054212 Ga0496115_0054212_1868_2827 319
719 3300048918 Ga0496115_0064373 Ga0496115_0064373_824_1783 319
720 3300049569 Ga0501032_0049697 Ga0501032_0049697_815_1777 319
721 3300049569 Ga0501032_0162697 Ga0501032_0162697_206_1165 319
722 3300049570 Ga0501033_0020324 Ga0501033_0020324_1312_2271 319
723 3300049571 Ga0501034_0062652 Ga0501034_0062652_86_1048 319
724 3300049571 Ga0501034_0068301 Ga0501034_0068301_2535_3494 319
725 3300049571 Ga0501034_0083871 Ga0501034_0083871_1346_2305 319
726 3300049571 Ga0501034_0174406 Ga0501034_0174406_121_1083 319
727 3300049572 Ga0501036_0105971 Ga0501036_0105971_13_972 319
728 3300049574 Ga0501038_0008011 Ga0501038_0008011_514_1473 319
729 3300049575 Ga0501039_0118326 Ga0501039_0118326_137_1096 319
730 3300049581 Ga0501047_0019004 Ga0501047_0019004_2100_3059 319
731 3300049581 Ga0501047_0099931 Ga0501047_0099931_953_1912 319
732 3300049581 Ga0501047_0156998 Ga0501047_0156998_1119_2078 319
733 3300049581 Ga0501047_0472836 Ga0501047_0472836_50_1009 319
734 3300049585 Ga0501069_0010183 Ga0501069_0010183_2503_3462 319
735 3300049585 Ga0501069_0011329 Ga0501069_0011329_2050_3009 319
736 3300049585 Ga0501069_0050211 Ga0501069_0050211_299_1258 319
737 3300049586 Ga0501070_0000711 Ga0501070_0000711_21598_22557 319
738 3300049586 Ga0501070_0027953 Ga0501070_0027953_2430_3389 319
739 3300049586 Ga0501070_0039662 Ga0501070_0039662_1897_2859 319
740 3300049586 Ga0501070_0062742 Ga0501070_0062742_2057_3016 319
741 3300049586 Ga0501070_0074935 Ga0501070_0074935_513_1472 319
742 3300049587 Ga0501071_0040292 Ga0501071_0040292_1395_2357 319
743 3300049589 Ga0501073_0075486 Ga0501073_0075486_1078_2040 319
744 3300049741 Ga0501079_0253819 Ga0501079_0253819_60_1022 319
745 3300049742 Ga0501080_0170176 Ga0501080_0170176_914_1876 319
746 3300049744 Ga0501083_0077357 Ga0501083_0077357_220_1179 319
747 3300049822 Ga0501035_0000703 Ga0501035_0000703_4662_5621 319
748 3300049822 Ga0501035_0054522 Ga0501035_0054522_1798_2757 319
749 3300049822 Ga0501035_0089270 Ga0501035_0089270_1159_2118 319
750 3300050494 nmdc:mga06z11_7241_c1 nmdc:mga06z11_7241_c1_1670_2629 319
751 3300050507 nmdc:mga05p37_66_c1 nmdc:mga05p37_66_c1_69478_70437 319
752 3300050507 nmdc:mga05p37_7273_c1 nmdc:mga05p37_7273_c1_1305_2264 319
753 3300050508 nmdc:mga09592_1181_c1 nmdc:mga09592_1181_c1_1419_2378 319
754 3300050509 nmdc:mga0qj67_341_c1 nmdc:mga0qj67_341_c1_20224_21183 319
755 3300050510 nmdc:mga06r32_404_c1 nmdc:mga06r32_404_c1_19551_20510 319
756 3300050511 nmdc:mga08y16_615_c1 nmdc:mga08y16_615_c1_20224_21183 319
757 3300050512 nmdc:mga0n895_134690_c1 nmdc:mga0n895_134690_c1_578_1537 319
758 3300050512 nmdc:mga0n895_14593_c1 nmdc:mga0n895_14593_c1_399_1358 319
759 3300050512 nmdc:mga0n895_186795_c1 nmdc:mga0n895_186795_c1_635_1594 319
760 3300050512 nmdc:mga0n895_43_c1 nmdc:mga0n895_43_c1_3950_4909 319
761 3300050512 nmdc:mga0n895_58568_c1 nmdc:mga0n895_58568_c1_112_1071 319
762 3300050513 nmdc:mga0rr50_11111_c1 nmdc:mga0rr50_11111_c1_1316_2275 319
763 3300050513 nmdc:mga0rr50_18578_c1 nmdc:mga0rr50_18578_c1_1571_2530 319
764 3300050513 nmdc:mga0rr50_3991_c1 nmdc:mga0rr50_3991_c1_4273_5232 319
765 3300050513 nmdc:mga0rr50_8186_c1 nmdc:mga0rr50_8186_c1_2698_3657 319
766 3300050514 nmdc:mga08x19_288301_c1 nmdc:mga08x19_288301_c1_49_1008 319
767 3300050515 nmdc:mga0a205_194120_c1 nmdc:mga0a205_194120_c1_153_1112 319
768 3300050515 nmdc:mga0a205_41845_c1 nmdc:mga0a205_41845_c1_3131_4090 319
769 3300050515 nmdc:mga0a205_59009_c1 nmdc:mga0a205_59009_c1_2499_3458 319
770 3300050515 nmdc:mga0a205_89831_c1 nmdc:mga0a205_89831_c1_998_1957 319
771 3300053077 Ga0495601_0007271 Ga0495601_0007271_5166_6128 319
772 3300053077 Ga0495601_0052763 Ga0495601_0052763_348_1307 319
773 3300053077 Ga0495601_0271790 Ga0495601_0271790_133_1092 319
774 3300053078 Ga0495612_0056313 Ga0495612_0056313_266_1228 319
775 3300053084 Ga0495595_0019721 Ga0495595_0019721_636_1598 319
776 3300053084 Ga0495595_0023779 Ga0495595_0023779_1064_2023 319
777 3300053085 Ga0495619_0000388 Ga0495619_0000388_18738_19697 319
778 3300053085 Ga0495619_0013931 Ga0495619_0013931_2732_3694 319
779 3300053087 Ga0500643_005338 Ga0500643_005338_886_1845 319
780 3300053088 Ga0500644_0000570 Ga0500644_0000570_9217_10176 319
781 3300053094 Ga0500566_0027276 Ga0500566_0027276_777_1736 319
782 3300053119 Ga0500595_000002 Ga0500595_000002_996310_997269 319
783 3300053153 Ga0500616_0000002 Ga0500616_0000002_1106904_1107863 319
784 3300053730 Ga0500645_000156 Ga0500645_000156_7916_8875 319
785 3300054114 Ga0501084_0043312 Ga0501084_0043312_704_1666 319
786 3300054114 Ga0501084_0229438 Ga0501084_0229438_355_1317 319
787 3300060353 Ga0501082_0177158 Ga0501082_0177158_221_1180 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02915

Rubrerythrin

Rubrerythrin

24

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5n5e-assembly1.cif.gz_e crystal structure of encapsulated ferritin domain from pyrococcus furiosus pfc_05175 0.9936 97 148
7s5c-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.9618 97 148
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.9587 97 148
6suw-assembly3.cif.gz_V crystal structure of rhodospirillum rubrum rru_a0973 e31a variant 0.9045 91 148
5l89-assembly3.cif.gz_c crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a 0.9039 91 148
ID Description Score Start End Superfamily
5l89W00 Special;Helix non-globular;Helix Hairpins; 0.9048 91 148 6.10.140.1960
5l89c00 Special;Helix non-globular;Helix Hairpins; 0.9039 91 148 6.10.140.1960
3k6cB00 Special;Helix non-globular;Helix Hairpins; 0.9029 98 150 6.10.140.1960
5l8bP00 Special;Helix non-globular;Helix Hairpins; 0.9021 91 148 6.10.140.1960
5l8bd00 Special;Helix non-globular;Helix Hairpins; 0.9002 91 148 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A529NKI1-F1-model_v4 Rubrerythrin family protein 0.9981 2 81 GO:0016491
GO:0046872
AF-A0A7W0ML71-F1-model_v4 Rubrerythrin family protein 0.992 2 144 GO:0016491
GO:0046872
AF-A0A529U558-F1-model_v4 deleted 0.9913 2 107
AF-X1CHA1-F1-model_v4 Rubrerythrin diiron-binding domain-containing protein 0.9861 2 86 GO:0016491
GO:0046872
AF-A0A2V9ZKR0-F1-model_v4 Rubrerythrin 0.985 2 87 GO:0016491
GO:0046872

Feature Viewer

pLDDT pTM Quality
82.53 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map