F480818
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 787 | 389 | 781 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100160842|Ga0070659_1001608422 |
| Length | 332 |
| Sequence | MEERVARRSKGFPVKRFADLTEQEVLALAITNEEEDSRIYRGFAEGLREQFPSSAKVFDEMAEEEVHHRTMLFDLYRQKFGDYLPLIRRHDVKDFIPHKSSLWLMRPLILGEVRRFAEKMEEEAQRFYRKAADGARDISVRRLLLELAEAEAGHESLAHKLTEQILTDSARASEDATSRRAFMLQYVQPGLAGLMDGSVSTLAPLFAAAFATHNTWQTFLVGIAASVGAGISMAFAEGLSDDGSLTGRGSSWIRGPVCGVMTAIGGLGHTLPYLIPHFLTATVVSIIVVVIELAIISWIRMRFMDTPFLRAAFQVVVGGTLVFVAGILIGSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 3 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 4 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 5 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 6 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 96 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 215 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 219 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 332 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 333 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 334 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 335 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 346 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 382 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.24 |
| Metatranscriptomes | 0 |
| Isolates | 0.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.52 |
| Nodule | 0.51 |
| Rhizoplane | 7.5 |
| Rhizosphere | 89.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001159 | 3300001977 | Bacteria | 4163 |
| 2 | JGI24747J21853_1001686 | 3300001978 | Bacteria | 1696 |
| 3 | JGI24737J22298_10003747 | 3300001990 | Bacteria | 5350 |
| 4 | JGI24748J21848_1000922 | 3300002074 | Bacteria | 3197 |
| 5 | JGI24738J21930_10005998 | 3300002075 | Bacteria | 2881 |
| 6 | JGI24749J21850_1007268 | 3300002076 | Bacteria | 1542 |
| 7 | JGI24035J26624_1003158 | 3300002126 | Bacteria | 1546 |
| 8 | JGI24033J26618_1000670 | 3300002155 | Bacteria | 3288 |
| 9 | JGI24034J26672_10006920 | 3300002239 | Bacteria | 1644 |
| 10 | JGI24742J22300_10009688 | 3300002244 | Bacteria | 1591 |
| 11 | JGI25406J46586_10035267 | 3300003203 | Bacteria | 1827 |
| 12 | JGI25405J52794_10006675 | 3300003911 | Bacteria | 2112 |
| 13 | Ga0065715_10016799 | 3300005293 | Bacteria | 2708 |
| 14 | Ga0065715_10127935 | 3300005293 | Bacteria | 2076 |
| 15 | Ga0070658_10039334 | 3300005327 | Bacteria | 3814 |
| 16 | Ga0070676_10204072 | 3300005328 | Bacteria | 1297 |
| 17 | Ga0070683_100248921 | 3300005329 | Bacteria | 1690 |
| 18 | Ga0070690_100040084 | 3300005330 | Bacteria | 2961 |
| 19 | Ga0070670_100024012 | 3300005331 | Bacteria | 5245 |
| 20 | Ga0070670_100046489 | 3300005331 | Bacteria | 3733 |
| 21 | Ga0070677_10017515 | 3300005333 | Bacteria | 2567 |
| 22 | Ga0068869_100000546 | 3300005334 | Bacteria | 21018 |
| 23 | Ga0070666_10003351 | 3300005335 | Bacteria | 9717 |
| 24 | Ga0070666_10024866 | 3300005335 | Bacteria | 3903 |
| 25 | Ga0070680_100102443 | 3300005336 | Bacteria | 2377 |
| 26 | Ga0070680_100133966 | 3300005336 | Bacteria | 2074 |
| 27 | Ga0070680_100137235 | 3300005336 | Bacteria | 2049 |
| 28 | Ga0070680_100164107 | 3300005336 | Bacteria | 1867 |
| 29 | Ga0070682_100003749 | 3300005337 | Bacteria | 8450 |
| 30 | Ga0070682_100008347 | 3300005337 | Bacteria | 5840 |
| 31 | Ga0068868_100076157 | 3300005338 | Bacteria | 2682 |
| 32 | Ga0070660_100032484 | 3300005339 | Bacteria | 3928 |
| 33 | Ga0070689_100011088 | 3300005340 | Bacteria | 6447 |
| 34 | Ga0070687_100002463 | 3300005343 | Bacteria | 6956 |
| 35 | Ga0070661_100001763 | 3300005344 | Bacteria | 15010 |
| 36 | Ga0070661_100208639 | 3300005344 | Bacteria | 1495 |
| 37 | Ga0070692_10004998 | 3300005345 | Bacteria | 5601 |
| 38 | Ga0070668_100029340 | 3300005347 | Bacteria | 4178 |
| 39 | Ga0070668_100285021 | 3300005347 | Bacteria | 1381 |
| 40 | Ga0070669_100257439 | 3300005353 | Bacteria | 1391 |
| 41 | Ga0070669_100326239 | 3300005353 | Bacteria | 1241 |
| 42 | Ga0070675_100148503 | 3300005354 | Bacteria | 2008 |
| 43 | Ga0070671_100000400 | 3300005355 | Bacteria | 29909 |
| 44 | Ga0070671_100016183 | 3300005355 | Bacteria | 6031 |
| 45 | Ga0070671_100017220 | 3300005355 | Bacteria | 5850 |
| 46 | Ga0070671_100342741 | 3300005355 | Bacteria | 1275 |
| 47 | Ga0070674_100003887 | 3300005356 | Bacteria | 8456 |
| 48 | Ga0070673_100003044 | 3300005364 | Bacteria | 10371 |
| 49 | Ga0070673_100049035 | 3300005364 | Bacteria | 3295 |
| 50 | Ga0070673_100086054 | 3300005364 | Bacteria | 2560 |
| 51 | Ga0070688_100041330 | 3300005365 | Bacteria | 2829 |
| 52 | Ga0070688_100181830 | 3300005365 | Bacteria | 1459 |
| 53 | Ga0070659_100011935 | 3300005366 | Bacteria | 6432 |
| 54 | Ga0070659_100015673 | 3300005366 | Bacteria | 5678 |
| 55 | Ga0070659_100160842 | 3300005366 | Bacteria | 1836 |
| 56 | Ga0070667_100019668 | 3300005367 | Bacteria | 5601 |
| 57 | Ga0070667_100029206 | 3300005367 | Bacteria | 4593 |
| 58 | Ga0070703_10001633 | 3300005406 | Bacteria | 6661 |
| 59 | Ga0070709_10027418 | 3300005434 | Bacteria | 3386 |
| 60 | Ga0070709_10072248 | 3300005434 | Bacteria | 2230 |
| 61 | Ga0070709_10089154 | 3300005434 | Bacteria | 2030 |
| 62 | Ga0070714_100004751 | 3300005435 | Bacteria | 10286 |
| 63 | Ga0070714_100031618 | 3300005435 | Bacteria | 4418 |
| 64 | Ga0070714_100109397 | 3300005435 | Bacteria | 2445 |
| 65 | Ga0070714_100140294 | 3300005435 | Bacteria | 2169 |
| 66 | Ga0070714_100229489 | 3300005435 | Bacteria | 1710 |
| 67 | Ga0070714_100369296 | 3300005435 | Bacteria | 1350 |
| 68 | Ga0070713_100007671 | 3300005436 | Bacteria | 7594 |
| 69 | Ga0070713_100010726 | 3300005436 | Bacteria | 6635 |
| 70 | Ga0070710_10002075 | 3300005437 | Bacteria | 9497 |
| 71 | Ga0070710_10011385 | 3300005437 | Bacteria | 4394 |
| 72 | Ga0070710_10012917 | 3300005437 | Bacteria | 4163 |
| 73 | Ga0070710_10033554 | 3300005437 | Bacteria | 2788 |
| 74 | Ga0070711_100005015 | 3300005439 | Bacteria | 7869 |
| 75 | Ga0070711_100007887 | 3300005439 | Bacteria | 6491 |
| 76 | Ga0070711_100011777 | 3300005439 | Bacteria | 5441 |
| 77 | Ga0070711_100019306 | 3300005439 | Bacteria | 4372 |
| 78 | Ga0070711_100202919 | 3300005439 | Bacteria | 1531 |
| 79 | Ga0070711_100236608 | 3300005439 | Bacteria | 1426 |
| 80 | Ga0070705_100006364 | 3300005440 | Bacteria | 5785 |
| 81 | Ga0070694_100036409 | 3300005444 | Bacteria | 3260 |
| 82 | Ga0070708_100192603 | 3300005445 | Bacteria | 1907 |
| 83 | Ga0070678_100058654 | 3300005456 | Bacteria | 2826 |
| 84 | Ga0070681_10018300 | 3300005458 | Bacteria | 7002 |
| 85 | Ga0070681_10105774 | 3300005458 | Bacteria | 2756 |
| 86 | Ga0070681_10192416 | 3300005458 | Bacteria | 1959 |
| 87 | Ga0070681_10332042 | 3300005458 | Bacteria | 1430 |
| 88 | Ga0070681_10497225 | 3300005458 | Bacteria | 1132 |
| 89 | Ga0068867_100017455 | 3300005459 | Bacteria | 5098 |
| 90 | Ga0070685_10017509 | 3300005466 | Bacteria | 3837 |
| 91 | Ga0070679_100063969 | 3300005530 | Bacteria | 3666 |
| 92 | Ga0070679_100579055 | 3300005530 | Bacteria | 1066 |
| 93 | Ga0070684_100036616 | 3300005535 | Bacteria | 4205 |
| 94 | Ga0070684_100375809 | 3300005535 | Bacteria | 1308 |
| 95 | Ga0070697_100023727 | 3300005536 | Bacteria | 4880 |
| 96 | Ga0068853_100051046 | 3300005539 | Bacteria | 3559 |
| 97 | Ga0068853_100077862 | 3300005539 | Unclassified | 2897 |
| 98 | Ga0070672_100000643 | 3300005543 | Bacteria | 20456 |
| 99 | Ga0070672_100127325 | 3300005543 | Unclassified | 2090 |
| 100 | Ga0070686_100001304 | 3300005544 | Bacteria | 14085 |
| 101 | Ga0070686_100010740 | 3300005544 | Bacteria | 5175 |
| 102 | Ga0070695_100001486 | 3300005545 | Bacteria | 13009 |
| 103 | Ga0070695_100004408 | 3300005545 | Bacteria | 8263 |
| 104 | Ga0070695_100022935 | 3300005545 | Bacteria | 3831 |
| 105 | Ga0070696_100143811 | 3300005546 | Bacteria | 1745 |
| 106 | Ga0070693_100002192 | 3300005547 | Bacteria | 8954 |
| 107 | Ga0070693_100027483 | 3300005547 | Bacteria | 3085 |
| 108 | Ga0070693_100061809 | 3300005547 | Bacteria | 2179 |
| 109 | Ga0070665_100056218 | 3300005548 | Bacteria | 3946 |
| 110 | Ga0068855_100164557 | 3300005563 | Bacteria | 2515 |
| 111 | Ga0068855_100170700 | 3300005563 | Bacteria | 2463 |
| 112 | Ga0068855_100212389 | 3300005563 | Bacteria | 2174 |
| 113 | Ga0068855_100227338 | 3300005563 | Bacteria | 2091 |
| 114 | Ga0070664_100106672 | 3300005564 | Bacteria | 2441 |
| 115 | Ga0068857_100010309 | 3300005577 | Bacteria | 8117 |
| 116 | Ga0068857_100301999 | 3300005577 | Bacteria | 1476 |
| 117 | Ga0068854_100019339 | 3300005578 | Bacteria | 4588 |
| 118 | Ga0068856_100005954 | 3300005614 | Bacteria | 12005 |
| 119 | Ga0068856_100035670 | 3300005614 | Bacteria | 4874 |
| 120 | Ga0068856_100233903 | 3300005614 | Bacteria | 1853 |
| 121 | Ga0068856_100268798 | 3300005614 | Bacteria | 1721 |
| 122 | Ga0070702_100010184 | 3300005615 | Bacteria | 4621 |
| 123 | Ga0070702_100091105 | 3300005615 | Bacteria | 1849 |
| 124 | Ga0068852_100036031 | 3300005616 | Bacteria | 4135 |
| 125 | Ga0068852_100121781 | 3300005616 | Bacteria | 2390 |
| 126 | Ga0068864_100004096 | 3300005618 | Bacteria | 11968 |
| 127 | Ga0068864_100017192 | 3300005618 | Bacteria | 6032 |
| 128 | Ga0068866_10054983 | 3300005718 | Bacteria | 2042 |
| 129 | Ga0068870_10002536 | 3300005840 | Bacteria | 7629 |
| 130 | Ga0068863_100011785 | 3300005841 | Bacteria | 8451 |
| 131 | Ga0068863_100041941 | 3300005841 | Bacteria | 4349 |
| 132 | Ga0068858_100027284 | 3300005842 | Bacteria | 5306 |
| 133 | Ga0068858_100049561 | 3300005842 | Bacteria | 3889 |
| 134 | Ga0068858_100059547 | 3300005842 | Bacteria | 3529 |
| 135 | Ga0068860_100031698 | 3300005843 | Bacteria | 5081 |
| 136 | Ga0068860_100072141 | 3300005843 | Bacteria | 3281 |
| 137 | Ga0068860_100177201 | 3300005843 | Bacteria | 2060 |
| 138 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 139 | Ga0081455_10006099 | 3300005937 | Bacteria | 13031 |
| 140 | Ga0081455_10012001 | 3300005937 | Bacteria | 8669 |
| 141 | Ga0081455_10012659 | 3300005937 | Bacteria | 8398 |
| 142 | Ga0081455_10073907 | 3300005937 | Bacteria | 2817 |
| 143 | Ga0081455_10080569 | 3300005937 | Bacteria | 2668 |
| 144 | Ga0081540_1010241 | 3300005983 | Bacteria | 6368 |
| 145 | Ga0070717_10000980 | 3300006028 | Bacteria | 19102 |
| 146 | Ga0070717_10105419 | 3300006028 | Bacteria | 2399 |
| 147 | Ga0075365_10206831 | 3300006038 | Bacteria | 1376 |
| 148 | Ga0075432_10001738 | 3300006058 | Bacteria | 7172 |
| 149 | Ga0070715_10001654 | 3300006163 | Bacteria | 6605 |
| 150 | Ga0070715_10002687 | 3300006163 | Bacteria | 5509 |
| 151 | Ga0070716_100018566 | 3300006173 | Bacteria | 3626 |
| 152 | Ga0070716_100044250 | 3300006173 | Bacteria | 2493 |
| 153 | Ga0070716_100085376 | 3300006173 | Bacteria | 1896 |
| 154 | Ga0070712_100011997 | 3300006175 | Bacteria | 5506 |
| 155 | Ga0070712_100045208 | 3300006175 | Bacteria | 3040 |
| 156 | Ga0075367_10060427 | 3300006178 | Bacteria | 2260 |
| 157 | Ga0075367_10099118 | 3300006178 | Bacteria | 1780 |
| 158 | Ga0097621_100197389 | 3300006237 | Bacteria | 1745 |
| 159 | Ga0068871_100002394 | 3300006358 | Bacteria | 12790 |
| 160 | Ga0068871_100012591 | 3300006358 | Bacteria | 6244 |
| 161 | Ga0075428_100002359 | 3300006844 | Bacteria | 20499 |
| 162 | Ga0075430_100000424 | 3300006846 | Bacteria | 31568 |
| 163 | Ga0075430_100139760 | 3300006846 | Bacteria | 2017 |
| 164 | Ga0075431_100001606 | 3300006847 | Bacteria | 21079 |
| 165 | Ga0075431_100054071 | 3300006847 | Bacteria | 4140 |
| 166 | Ga0075431_100598529 | 3300006847 | Bacteria | 1087 |
| 167 | Ga0075433_10000012 | 3300006852 | Bacteria | 71065 |
| 168 | Ga0075433_10030391 | 3300006852 | Bacteria | 4609 |
| 169 | Ga0075433_10104642 | 3300006852 | Bacteria | 2507 |
| 170 | Ga0075433_10161753 | 3300006852 | Bacteria | 1993 |
| 171 | Ga0075434_100000692 | 3300006871 | Bacteria | 26317 |
| 172 | Ga0075434_100035497 | 3300006871 | Bacteria | 4929 |
| 173 | Ga0075434_100046300 | 3300006871 | Bacteria | 4316 |
| 174 | Ga0075434_100116442 | 3300006871 | Bacteria | 2685 |
| 175 | Ga0075434_100209513 | 3300006871 | Bacteria | 1969 |
| 176 | Ga0075434_100259838 | 3300006871 | Bacteria | 1755 |
| 177 | Ga0075434_100408739 | 3300006871 | Bacteria | 1378 |
| 178 | Ga0075429_100000558 | 3300006880 | Bacteria | 28507 |
| 179 | Ga0075436_100002445 | 3300006914 | Bacteria | 12802 |
| 180 | Ga0075436_100049129 | 3300006914 | Bacteria | 2911 |
| 181 | Ga0075436_100065592 | 3300006914 | Bacteria | 2509 |
| 182 | Ga0075436_100282494 | 3300006914 | Bacteria | 1187 |
| 183 | Ga0079104_1000033 | 3300006946 | Bacteria | 202636 |
| 184 | Ga0075435_100001906 | 3300007076 | Bacteria | 13571 |
| 185 | Ga0075435_100010893 | 3300007076 | Bacteria | 6662 |
| 186 | Ga0075435_100015701 | 3300007076 | Bacteria | 5696 |
| 187 | Ga0075435_100029529 | 3300007076 | Bacteria | 4303 |
| 188 | Ga0075435_100058325 | 3300007076 | Bacteria | 3126 |
| 189 | Ga0075435_100160557 | 3300007076 | Bacteria | 1893 |
| 190 | Ga0105251_10009318 | 3300009011 | Bacteria | 5808 |
| 191 | Ga0105244_10059776 | 3300009036 | Bacteria | 1921 |
| 192 | Ga0105240_10083193 | 3300009093 | Bacteria | 3928 |
| 193 | Ga0105240_10293290 | 3300009093 | Bacteria | 1863 |
| 194 | Ga0105240_10333055 | 3300009093 | Bacteria | 1727 |
| 195 | Ga0105240_10640716 | 3300009093 | Bacteria | 1166 |
| 196 | Ga0111539_10003218 | 3300009094 | Bacteria | 21598 |
| 197 | Ga0111539_10040187 | 3300009094 | Bacteria | 5632 |
| 198 | Ga0105245_10001227 | 3300009098 | Bacteria | 23145 |
| 199 | Ga0105245_10102473 | 3300009098 | Unclassified | 2651 |
| 200 | Ga0105245_10166045 | 3300009098 | Bacteria | 2098 |
| 201 | Ga0105247_10007843 | 3300009101 | Bacteria | 6531 |
| 202 | Ga0114129_10000803 | 3300009147 | Bacteria | 40282 |
| 203 | Ga0114129_10006740 | 3300009147 | Bacteria | 16309 |
| 204 | Ga0114129_10341877 | 3300009147 | Bacteria | 1985 |
| 205 | Ga0105243_10006687 | 3300009148 | Bacteria | 8902 |
| 206 | Ga0105243_10008944 | 3300009148 | Bacteria | 7657 |
| 207 | Ga0105241_10002078 | 3300009174 | Bacteria | 15128 |
| 208 | Ga0105241_10145543 | 3300009174 | Bacteria | 1933 |
| 209 | Ga0105242_10012319 | 3300009176 | Bacteria | 6580 |
| 210 | Ga0105242_10022262 | 3300009176 | Bacteria | 4982 |
| 211 | Ga0105242_10071893 | 3300009176 | Bacteria | 2872 |
| 212 | Ga0105248_10016502 | 3300009177 | Bacteria | 8130 |
| 213 | Ga0105248_10090176 | 3300009177 | Bacteria | 3452 |
| 214 | Ga0105248_10091208 | 3300009177 | Bacteria | 3432 |
| 215 | Ga0105248_10153484 | 3300009177 | Bacteria | 2598 |
| 216 | Ga0105248_10206505 | 3300009177 | Unclassified | 2213 |
| 217 | Ga0105237_10028276 | 3300009545 | Bacteria | 5713 |
| 218 | Ga0105237_10201037 | 3300009545 | Unclassified | 1993 |
| 219 | Ga0105237_10330868 | 3300009545 | Bacteria | 1527 |
| 220 | Ga0105238_10034096 | 3300009551 | Bacteria | 5180 |
| 221 | Ga0105238_10039765 | 3300009551 | Bacteria | 4769 |
| 222 | Ga0105238_10072890 | 3300009551 | Bacteria | 3429 |
| 223 | Ga0105249_10056093 | 3300009553 | Bacteria | 3607 |
| 224 | Ga0105249_10084429 | 3300009553 | Bacteria | 2957 |
| 225 | Ga0105239_10071027 | 3300010375 | Bacteria | 3824 |
| 226 | Ga0105246_10017784 | 3300011119 | Bacteria | 4521 |
| 227 | Ga0105246_10018580 | 3300011119 | Bacteria | 4433 |
| 228 | Ga0157373_10053046 | 3300013100 | Bacteria | 2883 |
| 229 | Ga0157373_10057970 | 3300013100 | Bacteria | 2746 |
| 230 | Ga0157371_10036077 | 3300013102 | Bacteria | 3541 |
| 231 | Ga0157371_10110696 | 3300013102 | Bacteria | 1949 |
| 232 | Ga0157371_10212913 | 3300013102 | Bacteria | 1387 |
| 233 | Ga0157370_10066661 | 3300013104 | Bacteria | 3404 |
| 234 | Ga0157370_10084465 | 3300013104 | Bacteria | 2984 |
| 235 | Ga0157370_10290506 | 3300013104 | Bacteria | 1510 |
| 236 | Ga0157369_10125307 | 3300013105 | Bacteria | 2724 |
| 237 | Ga0157374_10001167 | 3300013296 | Bacteria | 22404 |
| 238 | Ga0157374_10123181 | 3300013296 | Bacteria | 2504 |
| 239 | Ga0163162_10081228 | 3300013306 | Bacteria | 3312 |
| 240 | Ga0163162_10172458 | 3300013306 | Bacteria | 2288 |
| 241 | Ga0163162_10274268 | 3300013306 | Bacteria | 1818 |
| 242 | Ga0157372_10175216 | 3300013307 | Bacteria | 2482 |
| 243 | Ga0157372_10183661 | 3300013307 | Bacteria | 2422 |
| 244 | Ga0157372_10254806 | 3300013307 | Bacteria | 2037 |
| 245 | Ga0157375_10024045 | 3300013308 | Bacteria | 5632 |
| 246 | Ga0163163_10004077 | 3300014325 | Bacteria | 12455 |
| 247 | Ga0163163_10011690 | 3300014325 | Bacteria | 7972 |
| 248 | Ga0163163_10127494 | 3300014325 | Bacteria | 2583 |
| 249 | Ga0157380_10187910 | 3300014326 | Bacteria | 1821 |
| 250 | Ga0182008_10047790 | 3300014497 | Bacteria | 2126 |
| 251 | Ga0157377_10005174 | 3300014745 | Bacteria | 6102 |
| 252 | Ga0157379_10015293 | 3300014968 | Bacteria | 6730 |
| 253 | Ga0157379_10019074 | 3300014968 | Bacteria | 6056 |
| 254 | Ga0157379_10045579 | 3300014968 | Bacteria | 3913 |
| 255 | Ga0157379_10069112 | 3300014968 | Bacteria | 3158 |
| 256 | Ga0157376_10008081 | 3300014969 | Bacteria | 7561 |
| 257 | Ga0157376_10008909 | 3300014969 | Bacteria | 7265 |
| 258 | Ga0163161_10023558 | 3300017792 | Bacteria | 4343 |
| 259 | Ga0163161_10050839 | 3300017792 | Bacteria | 3001 |
| 260 | Ga0207666_1000303 | 3300025271 | Bacteria | 6893 |
| 261 | Ga0207673_1000268 | 3300025290 | Bacteria | 5313 |
| 262 | Ga0207697_10010266 | 3300025315 | Bacteria | 4011 |
| 263 | Ga0207713_1012260 | 3300025735 | Bacteria | 4599 |
| 264 | Ga0207653_10001180 | 3300025885 | Bacteria | 8537 |
| 265 | Ga0207682_10000169 | 3300025893 | Bacteria | 30010 |
| 266 | Ga0207692_10029091 | 3300025898 | Bacteria | 2622 |
| 267 | Ga0207710_10000382 | 3300025900 | Bacteria | 30360 |
| 268 | Ga0207710_10009676 | 3300025900 | Bacteria | 4051 |
| 269 | Ga0207688_10005457 | 3300025901 | Bacteria | 6913 |
| 270 | Ga0207680_10005813 | 3300025903 | Bacteria | 5920 |
| 271 | Ga0207647_10018922 | 3300025904 | Bacteria | 4642 |
| 272 | Ga0207699_10003983 | 3300025906 | Bacteria | 7064 |
| 273 | Ga0207645_10013151 | 3300025907 | Bacteria | 5588 |
| 274 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 275 | Ga0207705_10362780 | 3300025909 | Bacteria | 1117 |
| 276 | Ga0207654_10004998 | 3300025911 | Bacteria | 6704 |
| 277 | Ga0207707_10054511 | 3300025912 | Bacteria | 3481 |
| 278 | Ga0207707_10079866 | 3300025912 | Bacteria | 2856 |
| 279 | Ga0207707_10273712 | 3300025912 | Bacteria | 1463 |
| 280 | Ga0207707_10292798 | 3300025912 | Bacteria | 1408 |
| 281 | Ga0207707_10348390 | 3300025912 | Bacteria | 1276 |
| 282 | Ga0207695_10088462 | 3300025913 | Bacteria | 3117 |
| 283 | Ga0207695_10229620 | 3300025913 | Bacteria | 1761 |
| 284 | Ga0207693_10001228 | 3300025915 | Bacteria | 22855 |
| 285 | Ga0207693_10037515 | 3300025915 | Bacteria | 3819 |
| 286 | Ga0207693_10086622 | 3300025915 | Unclassified | 2454 |
| 287 | Ga0207663_10008842 | 3300025916 | Bacteria | 5293 |
| 288 | Ga0207663_10023493 | 3300025916 | Bacteria | 3539 |
| 289 | Ga0207663_10039328 | 3300025916 | Bacteria | 2865 |
| 290 | Ga0207663_10076093 | 3300025916 | Bacteria | 2180 |
| 291 | Ga0207660_10002588 | 3300025917 | Bacteria | 11865 |
| 292 | Ga0207660_10258602 | 3300025917 | Bacteria | 1376 |
| 293 | Ga0207660_10343333 | 3300025917 | Bacteria | 1195 |
| 294 | Ga0207662_10000392 | 3300025918 | Bacteria | 19588 |
| 295 | Ga0207662_10009869 | 3300025918 | Bacteria | 5268 |
| 296 | Ga0207657_10002007 | 3300025919 | Bacteria | 22003 |
| 297 | Ga0207657_10050436 | 3300025919 | Bacteria | 3622 |
| 298 | Ga0207657_10089083 | 3300025919 | Bacteria | 2578 |
| 299 | Ga0207657_10121258 | 3300025919 | Unclassified | 2151 |
| 300 | Ga0207649_10003920 | 3300025920 | Bacteria | 8119 |
| 301 | Ga0207649_10020993 | 3300025920 | Bacteria | 3751 |
| 302 | Ga0207652_10096428 | 3300025921 | Bacteria | 2606 |
| 303 | Ga0207652_10101001 | 3300025921 | Bacteria | 2547 |
| 304 | Ga0207652_10191138 | 3300025921 | Bacteria | 1841 |
| 305 | Ga0207652_10200343 | 3300025921 | Bacteria | 1797 |
| 306 | Ga0207681_10020237 | 3300025923 | Bacteria | 4213 |
| 307 | Ga0207681_10138116 | 3300025923 | Bacteria | 1812 |
| 308 | Ga0207694_10059618 | 3300025924 | Bacteria | 2969 |
| 309 | Ga0207694_10112628 | 3300025924 | Bacteria | 2165 |
| 310 | Ga0207650_10004443 | 3300025925 | Bacteria | 9579 |
| 311 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 312 | Ga0207687_10007503 | 3300025927 | Bacteria | 7173 |
| 313 | Ga0207687_10019017 | 3300025927 | Bacteria | 4545 |
| 314 | Ga0207687_10022230 | 3300025927 | Bacteria | 4219 |
| 315 | Ga0207687_10413340 | 3300025927 | Bacteria | 1112 |
| 316 | Ga0207700_10002133 | 3300025928 | Bacteria | 11319 |
| 317 | Ga0207664_10389635 | 3300025929 | Bacteria | 1238 |
| 318 | Ga0207664_10428049 | 3300025929 | Bacteria | 1179 |
| 319 | Ga0207644_10002653 | 3300025931 | Bacteria | 11522 |
| 320 | Ga0207644_10014180 | 3300025931 | Bacteria | 5331 |
| 321 | Ga0207644_10257919 | 3300025931 | Bacteria | 1393 |
| 322 | Ga0207690_10008630 | 3300025932 | Bacteria | 6043 |
| 323 | Ga0207706_10015380 | 3300025933 | Bacteria | 6913 |
| 324 | Ga0207686_10005483 | 3300025934 | Bacteria | 6807 |
| 325 | Ga0207686_10008322 | 3300025934 | Bacteria | 5596 |
| 326 | Ga0207709_10000645 | 3300025935 | Bacteria | 28329 |
| 327 | Ga0207709_10005944 | 3300025935 | Bacteria | 6881 |
| 328 | Ga0207670_10026558 | 3300025936 | Bacteria | 3650 |
| 329 | Ga0207670_10084696 | 3300025936 | Bacteria | 2226 |
| 330 | Ga0207669_10039382 | 3300025937 | Bacteria | 2731 |
| 331 | Ga0207704_10001273 | 3300025938 | Bacteria | 11282 |
| 332 | Ga0207704_10160169 | 3300025938 | Bacteria | 1600 |
| 333 | Ga0207704_10230260 | 3300025938 | Bacteria | 1377 |
| 334 | Ga0207665_10000541 | 3300025939 | Bacteria | 25458 |
| 335 | Ga0207665_10073437 | 3300025939 | Bacteria | 2339 |
| 336 | Ga0207665_10089965 | 3300025939 | Bacteria | 2127 |
| 337 | Ga0207665_10136395 | 3300025939 | Bacteria | 1746 |
| 338 | Ga0207691_10016931 | 3300025940 | Bacteria | 6917 |
| 339 | Ga0207691_10093273 | 3300025940 | Unclassified | 2696 |
| 340 | Ga0207711_10002645 | 3300025941 | Bacteria | 15844 |
| 341 | Ga0207711_10008404 | 3300025941 | Bacteria | 8635 |
| 342 | Ga0207711_10188165 | 3300025941 | Bacteria | 1880 |
| 343 | Ga0207689_10013698 | 3300025942 | Bacteria | 6913 |
| 344 | Ga0207689_10044297 | 3300025942 | Bacteria | 3678 |
| 345 | Ga0207689_10399240 | 3300025942 | Bacteria | 1146 |
| 346 | Ga0207661_10094127 | 3300025944 | Unclassified | 2502 |
| 347 | Ga0207661_10146059 | 3300025944 | Bacteria | 2040 |
| 348 | Ga0207661_10167727 | 3300025944 | Bacteria | 1909 |
| 349 | Ga0207679_10000673 | 3300025945 | Bacteria | 22925 |
| 350 | Ga0207667_10162417 | 3300025949 | Bacteria | 2297 |
| 351 | Ga0207667_10236644 | 3300025949 | Bacteria | 1869 |
| 352 | Ga0207667_10483851 | 3300025949 | Bacteria | 1256 |
| 353 | Ga0207651_10004796 | 3300025960 | Bacteria | 6878 |
| 354 | Ga0207651_10025240 | 3300025960 | Bacteria | 3692 |
| 355 | Ga0207651_10034700 | 3300025960 | Bacteria | 3271 |
| 356 | Ga0207712_10104383 | 3300025961 | Bacteria | 2113 |
| 357 | Ga0207712_10177581 | 3300025961 | Bacteria | 1670 |
| 358 | Ga0207668_10000300 | 3300025972 | Bacteria | 32440 |
| 359 | Ga0207668_10267865 | 3300025972 | Unclassified | 1395 |
| 360 | Ga0207640_10013982 | 3300025981 | Bacteria | 4610 |
| 361 | Ga0207658_10106936 | 3300025986 | Bacteria | 2204 |
| 362 | Ga0207658_10267483 | 3300025986 | Bacteria | 1459 |
| 363 | Ga0207677_10052019 | 3300026023 | Bacteria | 2780 |
| 364 | Ga0207677_10275121 | 3300026023 | Bacteria | 1379 |
| 365 | Ga0207703_10001822 | 3300026035 | Bacteria | 19007 |
| 366 | Ga0207703_10015219 | 3300026035 | Bacteria | 6002 |
| 367 | Ga0207703_10139922 | 3300026035 | Bacteria | 2099 |
| 368 | Ga0207639_10070130 | 3300026041 | Unclassified | 2737 |
| 369 | Ga0207639_10148777 | 3300026041 | Bacteria | 1959 |
| 370 | Ga0207678_10001349 | 3300026067 | Bacteria | 22608 |
| 371 | Ga0207708_10010365 | 3300026075 | Bacteria | 6919 |
| 372 | Ga0207702_10088874 | 3300026078 | Bacteria | 2701 |
| 373 | Ga0207641_10301118 | 3300026088 | Unclassified | 1514 |
| 374 | Ga0207648_10015829 | 3300026089 | Bacteria | 6913 |
| 375 | Ga0207676_10001979 | 3300026095 | Bacteria | 14919 |
| 376 | Ga0207674_10022363 | 3300026116 | Bacteria | 6790 |
| 377 | Ga0207674_10165967 | 3300026116 | Bacteria | 2162 |
| 378 | Ga0207675_100016410 | 3300026118 | Bacteria | 6915 |
| 379 | Ga0207683_10000138 | 3300026121 | Bacteria | 60113 |
| 380 | Ga0207683_10009051 | 3300026121 | Bacteria | 8486 |
| 381 | Ga0207683_10016053 | 3300026121 | Bacteria | 6372 |
| 382 | Ga0207698_10085087 | 3300026142 | Bacteria | 2566 |
| 383 | Ga0209973_1006386 | 3300027252 | Bacteria | 1285 |
| 384 | Ga0209966_1006273 | 3300027695 | Bacteria | 2061 |
| 385 | Ga0209998_10001517 | 3300027717 | Bacteria | 5581 |
| 386 | Ga0209974_10007950 | 3300027876 | Bacteria | 3637 |
| 387 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 388 | Ga0207428_10000501 | 3300027907 | Bacteria | 46798 |
| 389 | Ga0268266_10001262 | 3300028379 | Bacteria | 30924 |
| 390 | Ga0268266_10124169 | 3300028379 | Bacteria | 2301 |
| 391 | Ga0268265_10112629 | 3300028380 | Bacteria | 2224 |
| 392 | Ga0268265_10287661 | 3300028380 | Unclassified | 1474 |
| 393 | Ga0268264_10063392 | 3300028381 | Bacteria | 3106 |
| 394 | Ga0268264_10217987 | 3300028381 | Bacteria | 1755 |
| 395 | Ga0265318_10036446 | 3300028577 | Bacteria | 1887 |
| 396 | Ga0265338_10057618 | 3300028800 | Bacteria | 3435 |
| 397 | Ga0265320_10001751 | 3300031240 | Bacteria | 15379 |
| 398 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 399 | Ga0265325_10001135 | 3300031241 | Bacteria | 19104 |
| 400 | Ga0265325_10028736 | 3300031241 | Bacteria | 2994 |
| 401 | Ga0265325_10040658 | 3300031241 | Bacteria | 2441 |
| 402 | Ga0265325_10068229 | 3300031241 | Bacteria | 1790 |
| 403 | Ga0265340_10040674 | 3300031247 | Bacteria | 2289 |
| 404 | Ga0265340_10153859 | 3300031247 | Bacteria | 1047 |
| 405 | Ga0265339_10031148 | 3300031249 | Bacteria | 3015 |
| 406 | Ga0265339_10042095 | 3300031249 | Bacteria | 2530 |
| 407 | Ga0265316_10026938 | 3300031344 | Bacteria | 4771 |
| 408 | Ga0265316_10055119 | 3300031344 | Bacteria | 3111 |
| 409 | Ga0307513_10156600 | 3300031456 | Bacteria | 2177 |
| 410 | Ga0265313_10000716 | 3300031595 | Bacteria | 34149 |
| 411 | Ga0265313_10006520 | 3300031595 | Bacteria | 8247 |
| 412 | Ga0265313_10013800 | 3300031595 | Bacteria | 4818 |
| 413 | Ga0265313_10013961 | 3300031595 | Bacteria | 4781 |
| 414 | Ga0265313_10020135 | 3300031595 | Bacteria | 3688 |
| 415 | Ga0265313_10056708 | 3300031595 | Bacteria | 1852 |
| 416 | Ga0316575_10021421 | 3300031665 | Bacteria | 2488 |
| 417 | Ga0316579_10039950 | 3300031691 | Bacteria | 2175 |
| 418 | Ga0265314_10164738 | 3300031711 | Bacteria | 1345 |
| 419 | Ga0265342_10000308 | 3300031712 | Bacteria | 55378 |
| 420 | Ga0265342_10007094 | 3300031712 | Bacteria | 8253 |
| 421 | Ga0316583_10013697 | 3300032133 | Bacteria | 2926 |
| 422 | Ga0316583_10051472 | 3300032133 | Bacteria | 1449 |
| 423 | Ga0373938_0003594 | 3300034957 | Bacteria | 2553 |
| 424 | Ga0373926_0000307 | 3300035083 | Bacteria | 12124 |
| 425 | Ga0373926_0002849 | 3300035083 | Bacteria | 5537 |
| 426 | Ga0373934_0009944 | 3300035086 | Bacteria | 3569 |
| 427 | Ga0373944_0000747 | 3300035089 | Bacteria | 7899 |
| 428 | Ga0373949_0004634 | 3300035090 | Unclassified | 3130 |
| 429 | Ga0373952_0000958 | 3300035092 | Bacteria | 5239 |
| 430 | Ga0373952_0003763 | 3300035092 | Bacteria | 2742 |
| 431 | Ga0373923_0002801 | 3300035111 | Bacteria | 5456 |
| 432 | Ga0373923_0025925 | 3300035111 | Bacteria | 2328 |
| 433 | Ga0373923_0036552 | 3300035111 | Bacteria | 2005 |
| 434 | Ga0373932_0018265 | 3300035112 | Bacteria | 1811 |
| 435 | Ga0373932_0019923 | 3300035112 | Bacteria | 1753 |
| 436 | Ga0373936_0003188 | 3300035113 | Bacteria | 6147 |
| 437 | Ga0373936_0061809 | 3300035113 | Bacteria | 1530 |
| 438 | Ga0373939_0000167 | 3300035114 | Bacteria | 18254 |
| 439 | Ga0373939_0001060 | 3300035114 | Bacteria | 6784 |
| 440 | Ga0373941_0008094 | 3300035115 | Bacteria | 2600 |
| 441 | Ga0373945_0000024 | 3300035116 | Bacteria | 30607 |
| 442 | Ga0373945_0034814 | 3300035116 | Bacteria | 1796 |
| 443 | Ga0373953_0010186 | 3300035117 | Bacteria | 3260 |
| 444 | Ga0373953_0018966 | 3300035117 | Bacteria | 2553 |
| 445 | Ga0373953_0046524 | 3300035117 | Bacteria | 1742 |
| 446 | Ga0373954_0010267 | 3300035118 | Bacteria | 4130 |
| 447 | Ga0373956_0012714 | 3300035119 | Bacteria | 3494 |
| 448 | Ga0373956_0015207 | 3300035119 | Bacteria | 3220 |
| 449 | Ga0373957_0014956 | 3300035120 | Bacteria | 2661 |
| 450 | Ga0373960_0010409 | 3300035121 | Bacteria | 2270 |
| 451 | Ga0373943_0003950 | 3300035170 | Bacteria | 6751 |
| 452 | Ga0373943_0006014 | 3300035170 | Bacteria | 5447 |
| 453 | Ga0373946_0000503 | 3300035171 | Bacteria | 12938 |
| 454 | Ga0373946_0012060 | 3300035171 | Bacteria | 3232 |
| 455 | Ga0373955_0010594 | 3300035172 | Bacteria | 4360 |
| 456 | Ga0373955_0012923 | 3300035172 | Bacteria | 4024 |
| 457 | Ga0373955_0094137 | 3300035172 | Bacteria | 1711 |
| 458 | Ga0373942_0010013 | 3300035207 | Bacteria | 2223 |
| 459 | Ga0373961_0040393 | 3300035241 | Bacteria | 1344 |
| 460 | Ga0373962_0003809 | 3300035242 | Bacteria | 3625 |
| 461 | Ga0373962_0021487 | 3300035242 | Bacteria | 1703 |
| 462 | Ga0373924_0002384 | 3300035410 | Bacteria | 6326 |
| 463 | Ga0373924_0008537 | 3300035410 | Bacteria | 3728 |
| 464 | Ga0373931_0002836 | 3300035691 | Bacteria | 7730 |
| 465 | Ga0373931_0015561 | 3300035691 | Bacteria | 3734 |
| 466 | Ga0373931_0080738 | 3300035691 | Bacteria | 1794 |
| 467 | Ga0373935_0004347 | 3300035692 | Bacteria | 8314 |
| 468 | Ga0373935_0019290 | 3300035692 | Bacteria | 4158 |
| 469 | Ga0373935_0031623 | 3300035692 | Bacteria | 3285 |
| 470 | Ga0373927_0002644 | 3300035695 | Bacteria | 13050 |
| 471 | Ga0373927_0025011 | 3300035695 | Bacteria | 3903 |
| 472 | Ga0373933_0011976 | 3300035724 | Bacteria | 4788 |
| 473 | Ga0373933_0033264 | 3300035724 | Bacteria | 2997 |
| 474 | Ga0373947_0001717 | 3300035725 | Bacteria | 13399 |
| 475 | Ga0373947_0006930 | 3300035725 | Bacteria | 6568 |
| 476 | Ga0373947_0033880 | 3300035725 | Bacteria | 3018 |
| 477 | Ga0373947_0206113 | 3300035725 | Bacteria | 1288 |
| 478 | Ga0373937_0007576 | 3300036401 | Bacteria | 9400 |
| 479 | Ga0373937_0010057 | 3300036401 | Bacteria | 8248 |
| 480 | Ga0373937_0060239 | 3300036401 | Bacteria | 3489 |
| 481 | Ga0373937_0208874 | 3300036401 | Bacteria | 1836 |
| 482 | Ga0373925_0009737 | 3300037068 | Bacteria | 6985 |
| 483 | Ga0373925_0162543 | 3300037068 | Bacteria | 1759 |
| 484 | Ga0373925_0175271 | 3300037068 | Bacteria | 1694 |
| 485 | Ga0373925_0440104 | 3300037068 | Bacteria | 1067 |
| 486 | Ga0395899_0036141 | 3300037312 | Bacteria | 3707 |
| 487 | Ga0395900_0005226 | 3300037418 | Bacteria | 13621 |
| 488 | Ga0395898_0041183 | 3300037466 | Bacteria | 4563 |
| 489 | Ga0395898_0071635 | 3300037466 | Bacteria | 3349 |
| 490 | Ga0395898_0097810 | 3300037466 | Bacteria | 2818 |
| 491 | Ga0436364_1033575 | 3300037853 | Bacteria | 2183 |
| 492 | Ga0436364_1402500 | 3300037853 | Bacteria | 1579 |
| 493 | Ga0395901_0059145 | 3300038443 | Bacteria | 3987 |
| 494 | Ga0436365_0713111 | 3300039437 | Bacteria | 3753 |
| 495 | Ga0436360_0289177 | 3300039438 | Bacteria | 1400 |
| 496 | Ga0436361_1211214 | 3300039447 | Bacteria | 2074 |
| 497 | Ga0439448_0020540 | 3300042005 | Bacteria | 2044 |
| 498 | Ga0439460_0022983 | 3300042461 | Bacteria | 1715 |
| 499 | Ga0451577_0071195 | 3300042876 | Bacteria | 3101 |
| 500 | Ga0466966_0036234 | 3300044684 | Bacteria | 3186 |
| 501 | Ga0466961_0151821 | 3300044693 | Bacteria | 1446 |
| 502 | Ga0466963_0057036 | 3300044694 | Bacteria | 2600 |
| 503 | Ga0453684_0091371 | 3300044712 | Bacteria | 3758 |
| 504 | Ga0466957_0191744 | 3300044842 | Bacteria | 1339 |
| 505 | Ga0466959_0165525 | 3300045049 | Bacteria | 1553 |
| 506 | Ga0466967_0011672 | 3300045976 | Bacteria | 6674 |
| 507 | Ga0495617_030003 | 3300046452 | Bacteria | 1828 |
| 508 | Ga0495592_0006111 | 3300046454 | Bacteria | 8952 |
| 509 | Ga0495592_0017486 | 3300046454 | Bacteria | 5448 |
| 510 | Ga0495603_0003742 | 3300046455 | Bacteria | 9045 |
| 511 | Ga0495603_0005609 | 3300046455 | Bacteria | 7498 |
| 512 | Ga0495629_0000753 | 3300046459 | Bacteria | 26186 |
| 513 | Ga0495629_0045372 | 3300046459 | Bacteria | 3083 |
| 514 | Ga0495629_0124027 | 3300046459 | Bacteria | 1799 |
| 515 | Ga0495638_0072158 | 3300046460 | Bacteria | 2111 |
| 516 | Ga0495641_0004791 | 3300046461 | Bacteria | 9417 |
| 517 | Ga0495651_0001426 | 3300046462 | Bacteria | 18541 |
| 518 | Ga0495651_0002939 | 3300046462 | Bacteria | 13180 |
| 519 | Ga0495653_0014789 | 3300046463 | Bacteria | 6364 |
| 520 | Ga0495653_0037014 | 3300046463 | Bacteria | 3838 |
| 521 | Ga0495653_0063884 | 3300046463 | Bacteria | 2776 |
| 522 | Ga0495653_0087496 | 3300046463 | Bacteria | 2288 |
| 523 | Ga0495580_0007742 | 3300046472 | Bacteria | 8610 |
| 524 | Ga0495582_0007911 | 3300046473 | Bacteria | 5875 |
| 525 | Ga0495582_0058793 | 3300046473 | Bacteria | 2120 |
| 526 | Ga0495639_0008291 | 3300046475 | Bacteria | 4459 |
| 527 | Ga0495639_0015775 | 3300046475 | Unclassified | 3276 |
| 528 | Ga0495639_0082540 | 3300046475 | Bacteria | 1498 |
| 529 | Ga0495662_0008720 | 3300046476 | Bacteria | 4985 |
| 530 | Ga0495662_0016049 | 3300046476 | Bacteria | 3632 |
| 531 | Ga0495664_0003487 | 3300046477 | Bacteria | 8563 |
| 532 | Ga0495584_0008365 | 3300046491 | Bacteria | 5359 |
| 533 | Ga0495584_0037411 | 3300046491 | Bacteria | 2453 |
| 534 | Ga0495585_0006802 | 3300046492 | Bacteria | 7057 |
| 535 | Ga0495594_0003931 | 3300046499 | Bacteria | 7644 |
| 536 | Ga0495594_0009417 | 3300046499 | Bacteria | 5045 |
| 537 | Ga0495594_0009717 | 3300046499 | Bacteria | 4977 |
| 538 | Ga0495607_0004637 | 3300046501 | Bacteria | 10064 |
| 539 | Ga0495608_0013047 | 3300046511 | Bacteria | 5765 |
| 540 | Ga0495608_0014069 | 3300046511 | Bacteria | 5553 |
| 541 | Ga0495608_0061288 | 3300046511 | Bacteria | 2474 |
| 542 | Ga0495618_0003047 | 3300046514 | Bacteria | 10585 |
| 543 | Ga0495618_0013518 | 3300046514 | Bacteria | 4965 |
| 544 | Ga0495628_0019182 | 3300046516 | Bacteria | 5655 |
| 545 | Ga0495628_0032294 | 3300046516 | Bacteria | 4227 |
| 546 | Ga0495630_0006135 | 3300046517 | Bacteria | 8521 |
| 547 | Ga0495630_0079495 | 3300046517 | Bacteria | 2473 |
| 548 | Ga0495637_0012831 | 3300046520 | Bacteria | 3997 |
| 549 | Ga0495637_0046007 | 3300046520 | Bacteria | 1848 |
| 550 | Ga0495644_0003881 | 3300046523 | Bacteria | 5883 |
| 551 | Ga0495666_0000788 | 3300046526 | Bacteria | 14672 |
| 552 | Ga0495666_0046412 | 3300046526 | Bacteria | 2094 |
| 553 | Ga0495652_0017441 | 3300046529 | Bacteria | 6405 |
| 554 | Ga0495652_0018691 | 3300046529 | Bacteria | 6177 |
| 555 | Ga0495654_0000070 | 3300046530 | Bacteria | 117357 |
| 556 | Ga0495665_0000227 | 3300046531 | Bacteria | 28192 |
| 557 | Ga0495665_0191071 | 3300046531 | Bacteria | 1062 |
| 558 | Ga0495640_0027438 | 3300046533 | Bacteria | 4107 |
| 559 | Ga0495640_0035420 | 3300046533 | Bacteria | 3532 |
| 560 | Ga0495587_0004130 | 3300046536 | Bacteria | 9600 |
| 561 | Ga0495587_0008487 | 3300046536 | Bacteria | 6603 |
| 562 | Ga0495587_0061412 | 3300046536 | Bacteria | 2202 |
| 563 | Ga0495609_0005483 | 3300046538 | Bacteria | 6645 |
| 564 | Ga0495645_0010540 | 3300046543 | Bacteria | 6484 |
| 565 | Ga0495622_0005976 | 3300046557 | Bacteria | 5654 |
| 566 | Ga0495633_0002067 | 3300046558 | Bacteria | 14446 |
| 567 | Ga0495667_0001790 | 3300046559 | Bacteria | 14251 |
| 568 | Ga0495667_0078718 | 3300046559 | Bacteria | 2143 |
| 569 | Ga0495656_0000293 | 3300046615 | Bacteria | 17434 |
| 570 | Ga0495634_0010910 | 3300046642 | Bacteria | 6632 |
| 571 | Ga0495635_0018551 | 3300046663 | Bacteria | 4853 |
| 572 | Ga0495659_0001622 | 3300046664 | Bacteria | 7559 |
| 573 | Ga0495659_0002627 | 3300046664 | Bacteria | 5796 |
| 574 | Ga0495661_0010629 | 3300046665 | Bacteria | 6275 |
| 575 | Ga0495588_0001913 | 3300046674 | Bacteria | 8890 |
| 576 | Ga0495588_0040109 | 3300046674 | Bacteria | 2387 |
| 577 | Ga0495588_0127826 | 3300046674 | Bacteria | 1340 |
| 578 | Ga0495657_0012549 | 3300046675 | Bacteria | 6290 |
| 579 | Ga0495657_0042837 | 3300046675 | Bacteria | 3088 |
| 580 | Ga0495599_0015010 | 3300046678 | Bacteria | 4801 |
| 581 | Ga0495623_0125668 | 3300046679 | Bacteria | 1540 |
| 582 | Ga0495646_0001140 | 3300046680 | Bacteria | 15502 |
| 583 | Ga0495646_0002961 | 3300046680 | Bacteria | 10519 |
| 584 | Ga0495647_0000989 | 3300046681 | Bacteria | 8641 |
| 585 | Ga0495647_0047755 | 3300046681 | Bacteria | 1653 |
| 586 | Ga0495647_0127768 | 3300046681 | Bacteria | 1074 |
| 587 | Ga0495658_0000543 | 3300046683 | Bacteria | 20578 |
| 588 | Ga0495658_0004438 | 3300046683 | Bacteria | 6902 |
| 589 | Ga0495658_0004686 | 3300046683 | Bacteria | 6726 |
| 590 | Ga0495613_0002489 | 3300046689 | Bacteria | 13900 |
| 591 | Ga0495613_0050781 | 3300046689 | Bacteria | 3058 |
| 592 | Ga0495613_0072220 | 3300046689 | Bacteria | 2515 |
| 593 | Ga0495624_0009130 | 3300046690 | Bacteria | 6876 |
| 594 | Ga0495670_0001083 | 3300046691 | Bacteria | 13211 |
| 595 | Ga0495600_0010740 | 3300046809 | Bacteria | 5692 |
| 596 | Ga0495581_0018686 | 3300047315 | Bacteria | 4025 |
| 597 | Ga0495604_0003959 | 3300047317 | Bacteria | 11793 |
| 598 | Ga0495604_0053061 | 3300047317 | Bacteria | 3136 |
| 599 | Ga0495604_0075834 | 3300047317 | Bacteria | 2531 |
| 600 | Ga0495674_0018711 | 3300047319 | Bacteria | 6447 |
| 601 | Ga0495674_0060468 | 3300047319 | Bacteria | 3305 |
| 602 | Ga0495676_0030918 | 3300047321 | Bacteria | 4535 |
| 603 | Ga0495676_0054653 | 3300047321 | Bacteria | 3172 |
| 604 | Ga0495676_0150273 | 3300047321 | Bacteria | 1658 |
| 605 | Ga0495680_0015238 | 3300047322 | Bacteria | 6637 |
| 606 | Ga0495680_0022375 | 3300047322 | Bacteria | 5268 |
| 607 | Ga0495680_0045737 | 3300047322 | Bacteria | 3455 |
| 608 | Ga0495680_0107613 | 3300047322 | Bacteria | 2070 |
| 609 | Ga0495680_0297981 | 3300047322 | Bacteria | 1133 |
| 610 | Ga0495675_0001398 | 3300047444 | Bacteria | 14624 |
| 611 | Ga0495675_0046094 | 3300047444 | Bacteria | 2776 |
| 612 | Ga0495685_047254 | 3300047447 | Bacteria | 1464 |
| 613 | Ga0495684_0003544 | 3300047471 | Bacteria | 12202 |
| 614 | Ga0495684_0091259 | 3300047471 | Bacteria | 2307 |
| 615 | Ga0495684_0279169 | 3300047471 | Bacteria | 1206 |
| 616 | Ga0495593_0003809 | 3300047673 | Bacteria | 9007 |
| 617 | Ga0495593_0038641 | 3300047673 | Unclassified | 2577 |
| 618 | Ga0495593_0056214 | 3300047673 | Bacteria | 2069 |
| 619 | Ga0495602_0027639 | 3300048088 | Bacteria | 5448 |
| 620 | Ga0495602_0051565 | 3300048088 | Bacteria | 3663 |
| 621 | Ga0495602_0066933 | 3300048088 | Bacteria | 3093 |
| 622 | Ga0495614_0022916 | 3300048089 | Bacteria | 2692 |
| 623 | Ga0495614_0043034 | 3300048089 | Bacteria | 1936 |
| 624 | Ga0496100_0001173 | 3300048903 | Bacteria | 12746 |
| 625 | Ga0496100_0017497 | 3300048903 | Bacteria | 4232 |
| 626 | Ga0496100_0047791 | 3300048903 | Bacteria | 2759 |
| 627 | Ga0496101_0011631 | 3300048904 | Bacteria | 5845 |
| 628 | Ga0496101_0047399 | 3300048904 | Bacteria | 3085 |
| 629 | Ga0496101_0236279 | 3300048904 | Bacteria | 1421 |
| 630 | Ga0496102_0009243 | 3300048905 | Bacteria | 8455 |
| 631 | Ga0496102_0015422 | 3300048905 | Bacteria | 6656 |
| 632 | Ga0496102_0016185 | 3300048905 | Bacteria | 6516 |
| 633 | Ga0496102_0143773 | 3300048905 | Bacteria | 2237 |
| 634 | Ga0496102_0320748 | 3300048905 | Bacteria | 1459 |
| 635 | Ga0496103_0011411 | 3300048906 | Bacteria | 5264 |
| 636 | Ga0496104_0001459 | 3300048907 | Bacteria | 20443 |
| 637 | Ga0496104_0002184 | 3300048907 | Bacteria | 16947 |
| 638 | Ga0496104_0467694 | 3300048907 | Bacteria | 1172 |
| 639 | Ga0496105_0003206 | 3300048908 | Bacteria | 12045 |
| 640 | Ga0496105_0068206 | 3300048908 | Bacteria | 2938 |
| 641 | Ga0496105_0080325 | 3300048908 | Bacteria | 2693 |
| 642 | Ga0496105_0286227 | 3300048908 | Bacteria | 1328 |
| 643 | Ga0496106_0081055 | 3300048909 | Bacteria | 2493 |
| 644 | Ga0496106_0347936 | 3300048909 | Bacteria | 1190 |
| 645 | Ga0496107_0009730 | 3300048910 | Bacteria | 6667 |
| 646 | Ga0496107_0016951 | 3300048910 | Bacteria | 5122 |
| 647 | Ga0496107_0022673 | 3300048910 | Bacteria | 4438 |
| 648 | Ga0496108_0002474 | 3300048911 | Bacteria | 14790 |
| 649 | Ga0496108_0037785 | 3300048911 | Bacteria | 4023 |
| 650 | Ga0496108_0102293 | 3300048911 | Bacteria | 2445 |
| 651 | Ga0496108_0139082 | 3300048911 | Bacteria | 2091 |
| 652 | Ga0496108_0251516 | 3300048911 | Bacteria | 1537 |
| 653 | Ga0496109_0001010 | 3300048912 | Bacteria | 23241 |
| 654 | Ga0496109_0004575 | 3300048912 | Bacteria | 11545 |
| 655 | Ga0496109_0009961 | 3300048912 | Bacteria | 8116 |
| 656 | Ga0496109_0016091 | 3300048912 | Bacteria | 6536 |
| 657 | Ga0496109_0087451 | 3300048912 | Bacteria | 2879 |
| 658 | Ga0496109_0094444 | 3300048912 | Bacteria | 2768 |
| 659 | Ga0496109_0154503 | 3300048912 | Bacteria | 2149 |
| 660 | Ga0496110_0002704 | 3300048913 | Bacteria | 13402 |
| 661 | Ga0496110_0003213 | 3300048913 | Bacteria | 12442 |
| 662 | Ga0496110_0063136 | 3300048913 | Bacteria | 3272 |
| 663 | Ga0496110_0144635 | 3300048913 | Bacteria | 2150 |
| 664 | Ga0496111_0000245 | 3300048914 | Bacteria | 26053 |
| 665 | Ga0496111_0055333 | 3300048914 | Bacteria | 2869 |
| 666 | Ga0496111_0086834 | 3300048914 | Bacteria | 2289 |
| 667 | Ga0496112_0003218 | 3300048915 | Bacteria | 13448 |
| 668 | Ga0496112_0017506 | 3300048915 | Bacteria | 6734 |
| 669 | Ga0496112_0079598 | 3300048915 | Bacteria | 3241 |
| 670 | Ga0496112_0093480 | 3300048915 | Bacteria | 2977 |
| 671 | Ga0496112_0182491 | 3300048915 | Bacteria | 2062 |
| 672 | Ga0496112_0782149 | 3300048915 | Bacteria | 880 |
| 673 | Ga0496113_0045479 | 3300048916 | Bacteria | 3256 |
| 674 | Ga0496113_0065905 | 3300048916 | Bacteria | 2742 |
| 675 | Ga0496113_0174178 | 3300048916 | Bacteria | 1704 |
| 676 | Ga0496114_0004868 | 3300048917 | Bacteria | 10455 |
| 677 | Ga0496114_0025726 | 3300048917 | Bacteria | 4812 |
| 678 | Ga0496115_0032160 | 3300048918 | Bacteria | 4138 |
| 679 | Ga0496115_0033864 | 3300048918 | Bacteria | 4036 |
| 680 | Ga0496115_0054212 | 3300048918 | Bacteria | 3219 |
| 681 | Ga0496115_0064373 | 3300048918 | Bacteria | 2959 |
| 682 | Ga0496115_0073942 | 3300048918 | Bacteria | 2767 |
| 683 | Ga0496121_0014314 | 3300048924 | Bacteria | 8433 |
| 684 | Ga0496124_0098935 | 3300048927 | Bacteria | 2366 |
| 685 | Ga0501032_0049697 | 3300049569 | Bacteria | 2829 |
| 686 | Ga0501032_0162697 | 3300049569 | Bacteria | 1465 |
| 687 | Ga0501033_0020324 | 3300049570 | Bacteria | 5016 |
| 688 | Ga0501034_0019426 | 3300049571 | Bacteria | 6950 |
| 689 | Ga0501034_0062652 | 3300049571 | Bacteria | 3734 |
| 690 | Ga0501034_0068301 | 3300049571 | Bacteria | 3565 |
| 691 | Ga0501034_0083871 | 3300049571 | Bacteria | 3188 |
| 692 | Ga0501034_0174406 | 3300049571 | Bacteria | 2116 |
| 693 | Ga0501036_0105971 | 3300049572 | Bacteria | 2377 |
| 694 | Ga0501038_0008011 | 3300049574 | Bacteria | 9733 |
| 695 | Ga0501039_0118326 | 3300049575 | Bacteria | 2075 |
| 696 | Ga0501043_0024721 | 3300049579 | Bacteria | 4710 |
| 697 | Ga0501047_0019004 | 3300049581 | Bacteria | 6592 |
| 698 | Ga0501047_0099931 | 3300049581 | Bacteria | 2780 |
| 699 | Ga0501047_0156998 | 3300049581 | Bacteria | 2148 |
| 700 | Ga0501047_0472836 | 3300049581 | Bacteria | 1081 |
| 701 | Ga0501069_0010183 | 3300049585 | Bacteria | 4972 |
| 702 | Ga0501069_0011329 | 3300049585 | Bacteria | 4729 |
| 703 | Ga0501069_0050211 | 3300049585 | Bacteria | 2319 |
| 704 | Ga0501070_0000711 | 3300049586 | Bacteria | 30493 |
| 705 | Ga0501070_0027953 | 3300049586 | Bacteria | 4731 |
| 706 | Ga0501070_0031315 | 3300049586 | Bacteria | 4457 |
| 707 | Ga0501070_0039662 | 3300049586 | Bacteria | 3926 |
| 708 | Ga0501070_0062742 | 3300049586 | Bacteria | 3078 |
| 709 | Ga0501070_0074935 | 3300049586 | Bacteria | 2801 |
| 710 | Ga0501071_0040292 | 3300049587 | Bacteria | 3342 |
| 711 | Ga0501073_0075486 | 3300049589 | Bacteria | 2346 |
| 712 | Ga0501076_0024247 | 3300049592 | Bacteria | 4687 |
| 713 | Ga0501077_0022557 | 3300049593 | Bacteria | 3987 |
| 714 | Ga0501079_0012760 | 3300049741 | Bacteria | 6419 |
| 715 | Ga0501079_0253819 | 3300049741 | Bacteria | 1374 |
| 716 | Ga0501080_0054441 | 3300049742 | Bacteria | 3726 |
| 717 | Ga0501080_0170176 | 3300049742 | Bacteria | 2009 |
| 718 | Ga0501083_0077357 | 3300049744 | Bacteria | 2208 |
| 719 | Ga0501035_0000703 | 3300049822 | Bacteria | 36519 |
| 720 | Ga0501035_0054522 | 3300049822 | Bacteria | 3572 |
| 721 | Ga0501035_0089270 | 3300049822 | Bacteria | 2715 |
| 722 | nmdc:mga0yw44_255353_c1 | 3300050492 | Bacteria | 1167 |
| 723 | nmdc:mga0yw44_269162_c1 | 3300050492 | Bacteria | 1137 |
| 724 | nmdc:mga06z11_7241_c1 | 3300050494 | Bacteria | 4555 |
| 725 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 726 | nmdc:mga05p37_7273_c1 | 3300050507 | Bacteria | 13063 |
| 727 | nmdc:mga09592_1181_c1 | 3300050508 | Bacteria | 20837 |
| 728 | nmdc:mga0qj67_116117_c1 | 3300050509 | Bacteria | 2163 |
| 729 | nmdc:mga0qj67_341_c1 | 3300050509 | Bacteria | 32144 |
| 730 | nmdc:mga0qj67_66211_c1 | 3300050509 | Bacteria | 2877 |
| 731 | nmdc:mga06r32_122581_c1 | 3300050510 | Bacteria | 2565 |
| 732 | nmdc:mga06r32_404_c1 | 3300050510 | Bacteria | 36414 |
| 733 | nmdc:mga08y16_615_c1 | 3300050511 | Bacteria | 33272 |
| 734 | nmdc:mga0n895_134690_c1 | 3300050512 | Bacteria | 2497 |
| 735 | nmdc:mga0n895_14593_c1 | 3300050512 | Bacteria | 7141 |
| 736 | nmdc:mga0n895_181038_c1 | 3300050512 | Bacteria | 2139 |
| 737 | nmdc:mga0n895_186795_c1 | 3300050512 | Bacteria | 2103 |
| 738 | nmdc:mga0n895_43_c1 | 3300050512 | Bacteria | 74924 |
| 739 | nmdc:mga0n895_58568_c1 | 3300050512 | Bacteria | 3798 |
| 740 | nmdc:mga0n895_88860_c1 | 3300050512 | Bacteria | 3090 |
| 741 | nmdc:mga0rr50_11111_c1 | 3300050513 | Bacteria | 5746 |
| 742 | nmdc:mga0rr50_18578_c1 | 3300050513 | Bacteria | 4673 |
| 743 | nmdc:mga0rr50_3991_c1 | 3300050513 | Bacteria | 8597 |
| 744 | nmdc:mga0rr50_65273_c1 | 3300050513 | Bacteria | 2756 |
| 745 | nmdc:mga0rr50_8186_c1 | 3300050513 | Bacteria | 6493 |
| 746 | nmdc:mga08x19_288301_c1 | 3300050514 | Bacteria | 1138 |
| 747 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 748 | nmdc:mga0a205_194120_c1 | 3300050515 | Bacteria | 1921 |
| 749 | nmdc:mga0a205_41845_c1 | 3300050515 | Bacteria | 4414 |
| 750 | nmdc:mga0a205_59009_c1 | 3300050515 | Bacteria | 3707 |
| 751 | nmdc:mga0a205_89831_c1 | 3300050515 | Bacteria | 2969 |
| 752 | Ga0495601_0007271 | 3300053077 | Bacteria | 6494 |
| 753 | Ga0495601_0009898 | 3300053077 | Bacteria | 5646 |
| 754 | Ga0495601_0052763 | 3300053077 | Bacteria | 2568 |
| 755 | Ga0495601_0271790 | 3300053077 | Bacteria | 1106 |
| 756 | Ga0495612_0000562 | 3300053078 | Bacteria | 14913 |
| 757 | Ga0495612_0006546 | 3300053078 | Bacteria | 4786 |
| 758 | Ga0495612_0056313 | 3300053078 | Bacteria | 1622 |
| 759 | Ga0495612_0112990 | 3300053078 | Bacteria | 1164 |
| 760 | Ga0495655_0029679 | 3300053083 | Bacteria | 1316 |
| 761 | Ga0495595_0001568 | 3300053084 | Bacteria | 8924 |
| 762 | Ga0495595_0019721 | 3300053084 | Bacteria | 2928 |
| 763 | Ga0495595_0023779 | 3300053084 | Bacteria | 2701 |
| 764 | Ga0495595_0123462 | 3300053084 | Bacteria | 1262 |
| 765 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 766 | Ga0495619_0000388 | 3300053085 | Bacteria | 30051 |
| 767 | Ga0495619_0013931 | 3300053085 | Bacteria | 5073 |
| 768 | Ga0495619_0017164 | 3300053085 | Bacteria | 4584 |
| 769 | Ga0495619_0032275 | 3300053085 | Bacteria | 3397 |
| 770 | Ga0500643_005338 | 3300053087 | Bacteria | 5559 |
| 771 | Ga0500644_0000570 | 3300053088 | Bacteria | 14410 |
| 772 | Ga0500566_0027276 | 3300053094 | Bacteria | 3343 |
| 773 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 774 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 775 | Ga0500645_000156 | 3300053730 | Bacteria | 53110 |
| 776 | Ga0501084_0003196 | 3300054114 | Bacteria | 13261 |
| 777 | Ga0501084_0043312 | 3300054114 | Bacteria | 3766 |
| 778 | Ga0501084_0229438 | 3300054114 | Bacteria | 1567 |
| 779 | Ga0501082_0005740 | 3300060353 | Bacteria | 10768 |
| 780 | Ga0501082_0177158 | 3300060353 | Bacteria | 1854 |
| 781 | Ga0530510_0191855 | 3300061734 | Bacteria | 1517 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048909 | Ga0496106_0347936 | Ga0496106_0347936_360_1175 | 259 |
| 2 | 3300035111 | Ga0373923_0036552 | Ga0373923_0036552_1172_1990 | 272 |
| 3 | 3300048915 | Ga0496112_0782149 | Ga0496112_0782149_19_843 | 274 |
| 4 | 3300031249 | Ga0265339_10031148 | Ga0265339_100311484 | 288 |
| 5 | 3300031595 | Ga0265313_10006520 | Ga0265313_100065205 | 288 |
| 6 | 3300042461 | Ga0439460_0022983 | Ga0439460_0022983_649_1608 | 290 |
| 7 | 3300031344 | Ga0265316_10055119 | Ga0265316_100551192 | 291 |
| 8 | 3300042876 | Ga0451577_0071195 | Ga0451577_0071195_778_1740 | 293 |
| 9 | 3300044712 | Ga0453684_0091371 | Ga0453684_0091371_630_1592 | 293 |
| 10 | 3300013102 | Ga0157371_10212913 | Ga0157371_102129132 | 295 |
| 11 | 3300049579 | Ga0501043_0024721 | Ga0501043_0024721_1320_2282 | 296 |
| 12 | 3300006847 | Ga0075431_100054071 | Ga0075431_1000540715 | 297 |
| 13 | 3300050509 | nmdc:mga0qj67_116117_c1 | nmdc:mga0qj67_116117_c1_610_1563 | 297 |
| 14 | 3300046463 | Ga0495653_0063884 | Ga0495653_0063884_268_1227 | 298 |
| 15 | 3300046520 | Ga0495637_0046007 | Ga0495637_0046007_742_1695 | 298 |
| 16 | 3300046533 | Ga0495640_0027438 | Ga0495640_0027438_1159_2118 | 298 |
| 17 | 3300046664 | Ga0495659_0002627 | Ga0495659_0002627_2149_3102 | 298 |
| 18 | 3300047317 | Ga0495604_0075834 | Ga0495604_0075834_562_1521 | 298 |
| 19 | 3300047319 | Ga0495674_0018711 | Ga0495674_0018711_1650_2609 | 298 |
| 20 | 3300047322 | Ga0495680_0022375 | Ga0495680_0022375_2416_3375 | 298 |
| 21 | 3300053078 | Ga0495612_0006546 | Ga0495612_0006546_3436_4395 | 298 |
| 22 | 3300053085 | Ga0495619_0000045 | Ga0495619_0000045_19269_20228 | 298 |
| 23 | 3300006846 | Ga0075430_100139760 | Ga0075430_1001397602 | 299 |
| 24 | 3300050509 | nmdc:mga0qj67_66211_c1 | nmdc:mga0qj67_66211_c1_258_1214 | 299 |
| 25 | 3300050510 | nmdc:mga06r32_122581_c1 | nmdc:mga06r32_122581_c1_1216_2172 | 299 |
| 26 | 3300005336 | Ga0070680_100164107 | Ga0070680_1001641073 | 300 |
| 27 | 3300005344 | Ga0070661_100208639 | Ga0070661_1002086391 | 300 |
| 28 | 3300005347 | Ga0070668_100285021 | Ga0070668_1002850211 | 300 |
| 29 | 3300005355 | Ga0070671_100017220 | Ga0070671_1000172207 | 300 |
| 30 | 3300005458 | Ga0070681_10018300 | Ga0070681_100183009 | 300 |
| 31 | 3300005546 | Ga0070696_100143811 | Ga0070696_1001438112 | 300 |
| 32 | 3300005547 | Ga0070693_100061809 | Ga0070693_1000618092 | 300 |
| 33 | 3300005563 | Ga0068855_100227338 | Ga0068855_1002273383 | 300 |
| 34 | 3300005843 | Ga0068860_100072141 | Ga0068860_1000721413 | 300 |
| 35 | 3300006871 | Ga0075434_100046300 | Ga0075434_1000463003 | 300 |
| 36 | 3300007076 | Ga0075435_100058325 | Ga0075435_1000583252 | 300 |
| 37 | 3300025912 | Ga0207707_10054511 | Ga0207707_100545112 | 300 |
| 38 | 3300025921 | Ga0207652_10096428 | Ga0207652_100964282 | 300 |
| 39 | 3300025938 | Ga0207704_10160169 | Ga0207704_101601692 | 300 |
| 40 | 3300035112 | Ga0373932_0018265 | Ga0373932_0018265_444_1403 | 300 |
| 41 | 3300035691 | Ga0373931_0015561 | Ga0373931_0015561_493_1491 | 300 |
| 42 | 3300050513 | nmdc:mga0rr50_65273_c1 | nmdc:mga0rr50_65273_c1_899_1897 | 300 |
| 43 | 3300031456 | Ga0307513_10156600 | Ga0307513_101566002 | 301 |
| 44 | 3300013306 | Ga0163162_10274268 | Ga0163162_102742681 | 303 |
| 45 | 3300014968 | Ga0157379_10069112 | Ga0157379_100691122 | 303 |
| 46 | 3300025927 | Ga0207687_10413340 | Ga0207687_104133401 | 303 |
| 47 | 3300025961 | Ga0207712_10177581 | Ga0207712_101775812 | 303 |
| 48 | 3300025986 | Ga0207658_10106936 | Ga0207658_101069361 | 303 |
| 49 | 3300048905 | Ga0496102_0016185 | Ga0496102_0016185_1431_2390 | 303 |
| 50 | 3300048918 | Ga0496115_0033864 | Ga0496115_0033864_1601_2560 | 303 |
| 51 | 3300035083 | Ga0373926_0000307 | Ga0373926_0000307_6575_7534 | 304 |
| 52 | 3300035086 | Ga0373934_0009944 | Ga0373934_0009944_2472_3431 | 304 |
| 53 | 3300035089 | Ga0373944_0000747 | Ga0373944_0000747_1724_2683 | 304 |
| 54 | 3300035111 | Ga0373923_0002801 | Ga0373923_0002801_3598_4557 | 304 |
| 55 | 3300035113 | Ga0373936_0003188 | Ga0373936_0003188_4367_5326 | 304 |
| 56 | 3300035116 | Ga0373945_0000024 | Ga0373945_0000024_28017_28976 | 304 |
| 57 | 3300035170 | Ga0373943_0006014 | Ga0373943_0006014_1653_2612 | 304 |
| 58 | 3300035171 | Ga0373946_0000503 | Ga0373946_0000503_6693_7652 | 304 |
| 59 | 3300035172 | Ga0373955_0012923 | Ga0373955_0012923_1042_2001 | 304 |
| 60 | 3300035410 | Ga0373924_0008537 | Ga0373924_0008537_821_1780 | 304 |
| 61 | 3300035692 | Ga0373935_0004347 | Ga0373935_0004347_4997_5956 | 304 |
| 62 | 3300035695 | Ga0373927_0025011 | Ga0373927_0025011_1525_2484 | 304 |
| 63 | 3300035724 | Ga0373933_0011976 | Ga0373933_0011976_1102_2061 | 304 |
| 64 | 3300035725 | Ga0373947_0006930 | Ga0373947_0006930_5345_6304 | 304 |
| 65 | 3300036401 | Ga0373937_0007576 | Ga0373937_0007576_5148_6107 | 304 |
| 66 | 3300037068 | Ga0373925_0162543 | Ga0373925_0162543_614_1573 | 304 |
| 67 | 3300046452 | Ga0495617_030003 | Ga0495617_030003_82_1041 | 304 |
| 68 | 3300046454 | Ga0495592_0006111 | Ga0495592_0006111_2376_3335 | 304 |
| 69 | 3300046455 | Ga0495603_0003742 | Ga0495603_0003742_6189_7148 | 304 |
| 70 | 3300046459 | Ga0495629_0045372 | Ga0495629_0045372_1548_2507 | 304 |
| 71 | 3300046461 | Ga0495641_0004791 | Ga0495641_0004791_4484_5443 | 304 |
| 72 | 3300046462 | Ga0495651_0002939 | Ga0495651_0002939_8979_9938 | 304 |
| 73 | 3300046463 | Ga0495653_0014789 | Ga0495653_0014789_614_1573 | 304 |
| 74 | 3300046472 | Ga0495580_0007742 | Ga0495580_0007742_4223_5182 | 304 |
| 75 | 3300046473 | Ga0495582_0007911 | Ga0495582_0007911_1766_2725 | 304 |
| 76 | 3300046475 | Ga0495639_0008291 | Ga0495639_0008291_2887_3846 | 304 |
| 77 | 3300046476 | Ga0495662_0008720 | Ga0495662_0008720_1191_2150 | 304 |
| 78 | 3300046477 | Ga0495664_0003487 | Ga0495664_0003487_3168_4127 | 304 |
| 79 | 3300046491 | Ga0495584_0008365 | Ga0495584_0008365_1212_2171 | 304 |
| 80 | 3300046492 | Ga0495585_0006802 | Ga0495585_0006802_4506_5465 | 304 |
| 81 | 3300046499 | Ga0495594_0003931 | Ga0495594_0003931_265_1224 | 304 |
| 82 | 3300046501 | Ga0495607_0004637 | Ga0495607_0004637_3293_4252 | 304 |
| 83 | 3300046511 | Ga0495608_0014069 | Ga0495608_0014069_313_1272 | 304 |
| 84 | 3300046514 | Ga0495618_0013518 | Ga0495618_0013518_1547_2506 | 304 |
| 85 | 3300046516 | Ga0495628_0032294 | Ga0495628_0032294_712_1671 | 304 |
| 86 | 3300046517 | Ga0495630_0006135 | Ga0495630_0006135_2964_3923 | 304 |
| 87 | 3300046520 | Ga0495637_0012831 | Ga0495637_0012831_198_1157 | 304 |
| 88 | 3300046523 | Ga0495644_0003881 | Ga0495644_0003881_3357_4316 | 304 |
| 89 | 3300046526 | Ga0495666_0000788 | Ga0495666_0000788_8339_9298 | 304 |
| 90 | 3300046529 | Ga0495652_0018691 | Ga0495652_0018691_3646_4605 | 304 |
| 91 | 3300046531 | Ga0495665_0000227 | Ga0495665_0000227_16832_17791 | 304 |
| 92 | 3300046533 | Ga0495640_0035420 | Ga0495640_0035420_1980_2939 | 304 |
| 93 | 3300046536 | Ga0495587_0008487 | Ga0495587_0008487_2025_2984 | 304 |
| 94 | 3300046538 | Ga0495609_0005483 | Ga0495609_0005483_3982_4941 | 304 |
| 95 | 3300046557 | Ga0495622_0005976 | Ga0495622_0005976_3879_4838 | 304 |
| 96 | 3300046558 | Ga0495633_0002067 | Ga0495633_0002067_5076_6035 | 304 |
| 97 | 3300046559 | Ga0495667_0001790 | Ga0495667_0001790_8510_9469 | 304 |
| 98 | 3300046615 | Ga0495656_0000293 | Ga0495656_0000293_1050_2009 | 304 |
| 99 | 3300046642 | Ga0495634_0010910 | Ga0495634_0010910_5510_6469 | 304 |
| 100 | 3300046663 | Ga0495635_0018551 | Ga0495635_0018551_1980_2939 | 304 |
| 101 | 3300046664 | Ga0495659_0001622 | Ga0495659_0001622_5589_6548 | 304 |
| 102 | 3300046665 | Ga0495661_0010629 | Ga0495661_0010629_4712_5671 | 304 |
| 103 | 3300046674 | Ga0495588_0001913 | Ga0495588_0001913_3429_4388 | 304 |
| 104 | 3300046678 | Ga0495599_0015010 | Ga0495599_0015010_3343_4302 | 304 |
| 105 | 3300046680 | Ga0495646_0001140 | Ga0495646_0001140_5472_6431 | 304 |
| 106 | 3300046681 | Ga0495647_0000989 | Ga0495647_0000989_1622_2581 | 304 |
| 107 | 3300046683 | Ga0495658_0004438 | Ga0495658_0004438_4305_5264 | 304 |
| 108 | 3300046689 | Ga0495613_0002489 | Ga0495613_0002489_10767_11726 | 304 |
| 109 | 3300046690 | Ga0495624_0009130 | Ga0495624_0009130_4393_5352 | 304 |
| 110 | 3300046691 | Ga0495670_0001083 | Ga0495670_0001083_9656_10615 | 304 |
| 111 | 3300046809 | Ga0495600_0010740 | Ga0495600_0010740_3296_4255 | 304 |
| 112 | 3300047317 | Ga0495604_0053061 | Ga0495604_0053061_1669_2628 | 304 |
| 113 | 3300047319 | Ga0495674_0060468 | Ga0495674_0060468_1525_2484 | 304 |
| 114 | 3300047321 | Ga0495676_0150273 | Ga0495676_0150273_435_1394 | 304 |
| 115 | 3300047322 | Ga0495680_0107613 | Ga0495680_0107613_26_985 | 304 |
| 116 | 3300047471 | Ga0495684_0003544 | Ga0495684_0003544_2026_2985 | 304 |
| 117 | 3300047673 | Ga0495593_0003809 | Ga0495593_0003809_2385_3344 | 304 |
| 118 | 3300048088 | Ga0495602_0066933 | Ga0495602_0066933_1357_2316 | 304 |
| 119 | 3300048089 | Ga0495614_0043034 | Ga0495614_0043034_156_1115 | 304 |
| 120 | 3300050492 | nmdc:mga0yw44_269162_c1 | nmdc:mga0yw44_269162_c1_73_1029 | 304 |
| 121 | 3300053077 | Ga0495601_0009898 | Ga0495601_0009898_4074_5033 | 304 |
| 122 | 3300053078 | Ga0495612_0000562 | Ga0495612_0000562_910_1869 | 304 |
| 123 | 3300053084 | Ga0495595_0001568 | Ga0495595_0001568_3528_4487 | 304 |
| 124 | 3300053085 | Ga0495619_0017164 | Ga0495619_0017164_790_1749 | 304 |
| 125 | 3300046475 | Ga0495639_0015775 | Ga0495639_0015775_553_1470 | 305 |
| 126 | 3300005434 | Ga0070709_10027418 | Ga0070709_100274183 | 306 |
| 127 | 3300005435 | Ga0070714_100004751 | Ga0070714_1000047516 | 306 |
| 128 | 3300005436 | Ga0070713_100007671 | Ga0070713_1000076715 | 306 |
| 129 | 3300005437 | Ga0070710_10012917 | Ga0070710_100129173 | 306 |
| 130 | 3300005439 | Ga0070711_100005015 | Ga0070711_1000050157 | 306 |
| 131 | 3300005614 | Ga0068856_100035670 | Ga0068856_1000356705 | 306 |
| 132 | 3300006028 | Ga0070717_10105419 | Ga0070717_101054192 | 306 |
| 133 | 3300006163 | Ga0070715_10001654 | Ga0070715_100016546 | 306 |
| 134 | 3300006173 | Ga0070716_100044250 | Ga0070716_1000442502 | 306 |
| 135 | 3300006847 | Ga0075431_100598529 | Ga0075431_1005985291 | 306 |
| 136 | 3300006852 | Ga0075433_10161753 | Ga0075433_101617532 | 306 |
| 137 | 3300006871 | Ga0075434_100209513 | Ga0075434_1002095132 | 306 |
| 138 | 3300009147 | Ga0114129_10341877 | Ga0114129_103418772 | 306 |
| 139 | 3300048903 | Ga0496100_0001173 | Ga0496100_0001173_9168_10124 | 306 |
| 140 | 3300048905 | Ga0496102_0015422 | Ga0496102_0015422_4481_5437 | 306 |
| 141 | 3300048907 | Ga0496104_0001459 | Ga0496104_0001459_3802_4758 | 306 |
| 142 | 3300048908 | Ga0496105_0080325 | Ga0496105_0080325_444_1400 | 306 |
| 143 | 3300048910 | Ga0496107_0009730 | Ga0496107_0009730_65_1021 | 306 |
| 144 | 3300048911 | Ga0496108_0002474 | Ga0496108_0002474_13416_14372 | 306 |
| 145 | 3300048912 | Ga0496109_0087451 | Ga0496109_0087451_241_1197 | 306 |
| 146 | 3300048913 | Ga0496110_0003213 | Ga0496110_0003213_8405_9361 | 306 |
| 147 | 3300048915 | Ga0496112_0017506 | Ga0496112_0017506_5470_6426 | 306 |
| 148 | 3300048916 | Ga0496113_0045479 | Ga0496113_0045479_2130_3086 | 306 |
| 149 | 3300048918 | Ga0496115_0073942 | Ga0496115_0073942_578_1534 | 306 |
| 150 | 3300050512 | nmdc:mga0n895_181038_c1 | nmdc:mga0n895_181038_c1_509_1474 | 306 |
| 151 | 3300005439 | Ga0070711_100236608 | Ga0070711_1002366082 | 307 |
| 152 | 3300048908 | Ga0496105_0068206 | Ga0496105_0068206_1236_2189 | 307 |
| 153 | 3300048909 | Ga0496106_0081055 | Ga0496106_0081055_197_1153 | 307 |
| 154 | 3300048911 | Ga0496108_0102293 | Ga0496108_0102293_344_1297 | 307 |
| 155 | 3300048912 | Ga0496109_0154503 | Ga0496109_0154503_606_1559 | 307 |
| 156 | 3300048915 | Ga0496112_0182491 | Ga0496112_0182491_35_988 | 307 |
| 157 | 3300049571 | Ga0501034_0019426 | Ga0501034_0019426_4852_5814 | 307 |
| 158 | 3300049586 | Ga0501070_0031315 | Ga0501070_0031315_1214_2176 | 307 |
| 159 | 3300050512 | nmdc:mga0n895_88860_c1 | nmdc:mga0n895_88860_c1_1048_2004 | 307 |
| 160 | 3300005937 | Ga0081455_10012659 | Ga0081455_100126592 | 309 |
| 161 | 3300005434 | Ga0070709_10072248 | Ga0070709_100722482 | 310 |
| 162 | 3300005435 | Ga0070714_100109397 | Ga0070714_1001093971 | 310 |
| 163 | 3300005437 | Ga0070710_10011385 | Ga0070710_100113854 | 310 |
| 164 | 3300005439 | Ga0070711_100019306 | Ga0070711_1000193064 | 310 |
| 165 | 3300025898 | Ga0207692_10029091 | Ga0207692_100290913 | 310 |
| 166 | 3300025916 | Ga0207663_10023493 | Ga0207663_100234932 | 310 |
| 167 | 3300037853 | Ga0436364_1033575 | Ga0436364_1033575_793_1746 | 310 |
| 168 | 3300037853 | Ga0436364_1402500 | Ga0436364_1402500_12_965 | 310 |
| 169 | 3300039437 | Ga0436365_0713111 | Ga0436365_0713111_1703_2656 | 310 |
| 170 | 3300039447 | Ga0436361_1211214 | Ga0436361_1211214_308_1261 | 310 |
| 171 | 3300046536 | Ga0495587_0061412 | Ga0495587_0061412_172_1125 | 310 |
| 172 | 3300053078 | Ga0495612_0112990 | Ga0495612_0112990_70_1023 | 310 |
| 173 | 3300053084 | Ga0495595_0123462 | Ga0495595_0123462_60_1022 | 310 |
| 174 | 3300053085 | Ga0495619_0032275 | Ga0495619_0032275_2289_3242 | 310 |
| 175 | 3300025916 | Ga0207663_10076093 | Ga0207663_100760933 | 312 |
| 176 | 3300048916 | Ga0496113_0065905 | Ga0496113_0065905_476_1429 | 312 |
| 177 | 3300005437 | Ga0070710_10033554 | Ga0070710_100335542 | 313 |
| 178 | 3300005439 | Ga0070711_100202919 | Ga0070711_1002029192 | 313 |
| 179 | 3300006038 | Ga0075365_10206831 | Ga0075365_102068312 | 313 |
| 180 | 3300006175 | Ga0070712_100045208 | Ga0070712_1000452082 | 313 |
| 181 | 3300025916 | Ga0207663_10039328 | Ga0207663_100393282 | 313 |
| 182 | 3300046460 | Ga0495638_0072158 | Ga0495638_0072158_29_985 | 313 |
| 183 | iso_pu_bacteria | 2643221547 | 2643757320 | 315 |
| 184 | 3300005353 | Ga0070669_100326239 | Ga0070669_1003262391 | 317 |
| 185 | 3300005615 | Ga0070702_100091105 | Ga0070702_1000911053 | 317 |
| 186 | 3300009098 | Ga0105245_10166045 | Ga0105245_101660453 | 317 |
| 187 | 3300009177 | Ga0105248_10153484 | Ga0105248_101534843 | 317 |
| 188 | 3300025918 | Ga0207662_10009869 | Ga0207662_100098696 | 317 |
| 189 | 3300025923 | Ga0207681_10138116 | Ga0207681_101381161 | 317 |
| 190 | 3300026023 | Ga0207677_10275121 | Ga0207677_102751211 | 317 |
| 191 | 3300003203 | JGI25406J46586_10035267 | JGI25406J46586_100352672 | 318 |
| 192 | 3300005536 | Ga0070697_100023727 | Ga0070697_1000237277 | 318 |
| 193 | 3300005545 | Ga0070695_100001486 | Ga0070695_1000014863 | 318 |
| 194 | 3300005937 | Ga0081455_10006099 | Ga0081455_100060996 | 318 |
| 195 | 3300006871 | Ga0075434_100259838 | Ga0075434_1002598382 | 318 |
| 196 | 3300006914 | Ga0075436_100002445 | Ga0075436_1000024456 | 318 |
| 197 | 3300006914 | Ga0075436_100049129 | Ga0075436_1000491293 | 318 |
| 198 | 3300006946 | Ga0079104_1000033 | Ga0079104_10000332 | 318 |
| 199 | 3300007076 | Ga0075435_100001906 | Ga0075435_1000019066 | 318 |
| 200 | 3300025939 | Ga0207665_10089965 | Ga0207665_100899652 | 318 |
| 201 | 3300025942 | Ga0207689_10399240 | Ga0207689_103992401 | 318 |
| 202 | 3300028577 | Ga0265318_10036446 | Ga0265318_100364462 | 318 |
| 203 | 3300031240 | Ga0265320_10001751 | Ga0265320_100017516 | 318 |
| 204 | 3300035111 | Ga0373923_0025925 | Ga0373923_0025925_900_1856 | 318 |
| 205 | 3300039438 | Ga0436360_0289177 | Ga0436360_0289177_208_1185 | 318 |
| 206 | 3300046530 | Ga0495654_0000070 | Ga0495654_0000070_106033_107031 | 318 |
| 207 | 3300047447 | Ga0495685_047254 | Ga0495685_047254_121_1077 | 318 |
| 208 | 3300048907 | Ga0496104_0467694 | Ga0496104_0467694_103_1059 | 318 |
| 209 | 3300048908 | Ga0496105_0286227 | Ga0496105_0286227_228_1184 | 318 |
| 210 | 3300048911 | Ga0496108_0251516 | Ga0496108_0251516_163_1119 | 318 |
| 211 | 3300048912 | Ga0496109_0001010 | Ga0496109_0001010_21851_22807 | 318 |
| 212 | 3300048913 | Ga0496110_0002704 | Ga0496110_0002704_369_1325 | 318 |
| 213 | 3300048914 | Ga0496111_0000245 | Ga0496111_0000245_21461_22417 | 318 |
| 214 | 3300048915 | Ga0496112_0003218 | Ga0496112_0003218_419_1375 | 318 |
| 215 | 3300048924 | Ga0496121_0014314 | Ga0496121_0014314_4532_5518 | 318 |
| 216 | 3300048927 | Ga0496124_0098935 | Ga0496124_0098935_732_1718 | 318 |
| 217 | 3300049592 | Ga0501076_0024247 | Ga0501076_0024247_3471_4427 | 318 |
| 218 | 3300049593 | Ga0501077_0022557 | Ga0501077_0022557_2839_3795 | 318 |
| 219 | 3300049741 | Ga0501079_0012760 | Ga0501079_0012760_4738_5694 | 318 |
| 220 | 3300049742 | Ga0501080_0054441 | Ga0501080_0054441_1486_2442 | 318 |
| 221 | 3300050492 | nmdc:mga0yw44_255353_c1 | nmdc:mga0yw44_255353_c1_45_1001 | 318 |
| 222 | 3300050514 | nmdc:mga08x19_6_c1 | nmdc:mga08x19_6_c1_111031_111987 | 318 |
| 223 | 3300053083 | Ga0495655_0029679 | Ga0495655_0029679_36_1004 | 318 |
| 224 | 3300054114 | Ga0501084_0003196 | Ga0501084_0003196_9106_10062 | 318 |
| 225 | 3300060353 | Ga0501082_0005740 | Ga0501082_0005740_4638_5594 | 318 |
| 226 | 3300061734 | Ga0530510_0191855 | Ga0530510_0191855_275_1231 | 318 |
| 227 | iso_pu_bacteria | 2821123053 | 2821123280 | 318 |
| 228 | iso_pu_bacteria | 2838736955 | 2838739697 | 318 |
| 229 | iso_pu_bacteria | 2841840854 | 2841844179 | 318 |
| 230 | iso_pu_bacteria | 2842140634 | 2842143900 | 318 |
| 231 | iso_pu_bacteria | 2857531043 | 2857533768 | 318 |
| 232 | 3300001977 | JGI24746J21847_1001159 | JGI24746J21847_10011594 | 319 |
| 233 | 3300001978 | JGI24747J21853_1001686 | JGI24747J21853_10016862 | 319 |
| 234 | 3300001990 | JGI24737J22298_10003747 | JGI24737J22298_100037475 | 319 |
| 235 | 3300002074 | JGI24748J21848_1000922 | JGI24748J21848_10009224 | 319 |
| 236 | 3300002075 | JGI24738J21930_10005998 | JGI24738J21930_100059983 | 319 |
| 237 | 3300002076 | JGI24749J21850_1007268 | JGI24749J21850_10072682 | 319 |
| 238 | 3300002126 | JGI24035J26624_1003158 | JGI24035J26624_10031582 | 319 |
| 239 | 3300002155 | JGI24033J26618_1000670 | JGI24033J26618_10006702 | 319 |
| 240 | 3300002239 | JGI24034J26672_10006920 | JGI24034J26672_100069202 | 319 |
| 241 | 3300002244 | JGI24742J22300_10009688 | JGI24742J22300_100096882 | 319 |
| 242 | 3300003911 | JGI25405J52794_10006675 | JGI25405J52794_100066752 | 319 |
| 243 | 3300005293 | Ga0065715_10016799 | Ga0065715_100167992 | 319 |
| 244 | 3300005293 | Ga0065715_10127935 | Ga0065715_101279351 | 319 |
| 245 | 3300005327 | Ga0070658_10039334 | Ga0070658_100393342 | 319 |
| 246 | 3300005328 | Ga0070676_10204072 | Ga0070676_102040721 | 319 |
| 247 | 3300005329 | Ga0070683_100248921 | Ga0070683_1002489212 | 319 |
| 248 | 3300005330 | Ga0070690_100040084 | Ga0070690_1000400843 | 319 |
| 249 | 3300005331 | Ga0070670_100024012 | Ga0070670_1000240125 | 319 |
| 250 | 3300005331 | Ga0070670_100046489 | Ga0070670_1000464892 | 319 |
| 251 | 3300005333 | Ga0070677_10017515 | Ga0070677_100175152 | 319 |
| 252 | 3300005334 | Ga0068869_100000546 | Ga0068869_1000005462 | 319 |
| 253 | 3300005335 | Ga0070666_10003351 | Ga0070666_100033512 | 319 |
| 254 | 3300005335 | Ga0070666_10024866 | Ga0070666_100248662 | 319 |
| 255 | 3300005336 | Ga0070680_100102443 | Ga0070680_1001024431 | 319 |
| 256 | 3300005336 | Ga0070680_100133966 | Ga0070680_1001339662 | 319 |
| 257 | 3300005336 | Ga0070680_100137235 | Ga0070680_1001372352 | 319 |
| 258 | 3300005337 | Ga0070682_100003749 | Ga0070682_1000037493 | 319 |
| 259 | 3300005337 | Ga0070682_100008347 | Ga0070682_1000083472 | 319 |
| 260 | 3300005338 | Ga0068868_100076157 | Ga0068868_1000761572 | 319 |
| 261 | 3300005339 | Ga0070660_100032484 | Ga0070660_1000324844 | 319 |
| 262 | 3300005340 | Ga0070689_100011088 | Ga0070689_1000110884 | 319 |
| 263 | 3300005343 | Ga0070687_100002463 | Ga0070687_1000024632 | 319 |
| 264 | 3300005344 | Ga0070661_100001763 | Ga0070661_1000017635 | 319 |
| 265 | 3300005345 | Ga0070692_10004998 | Ga0070692_100049982 | 319 |
| 266 | 3300005347 | Ga0070668_100029340 | Ga0070668_1000293402 | 319 |
| 267 | 3300005353 | Ga0070669_100257439 | Ga0070669_1002574392 | 319 |
| 268 | 3300005354 | Ga0070675_100148503 | Ga0070675_1001485032 | 319 |
| 269 | 3300005355 | Ga0070671_100000400 | Ga0070671_10000040027 | 319 |
| 270 | 3300005355 | Ga0070671_100016183 | Ga0070671_1000161835 | 319 |
| 271 | 3300005355 | Ga0070671_100342741 | Ga0070671_1003427412 | 319 |
| 272 | 3300005356 | Ga0070674_100003887 | Ga0070674_1000038874 | 319 |
| 273 | 3300005364 | Ga0070673_100003044 | Ga0070673_1000030446 | 319 |
| 274 | 3300005364 | Ga0070673_100049035 | Ga0070673_1000490352 | 319 |
| 275 | 3300005364 | Ga0070673_100086054 | Ga0070673_1000860542 | 319 |
| 276 | 3300005365 | Ga0070688_100041330 | Ga0070688_1000413302 | 319 |
| 277 | 3300005365 | Ga0070688_100181830 | Ga0070688_1001818302 | 319 |
| 278 | 3300005366 | Ga0070659_100011935 | Ga0070659_1000119357 | 319 |
| 279 | 3300005366 | Ga0070659_100015673 | Ga0070659_1000156736 | 319 |
| 280 | 3300005366 | Ga0070659_100160842 | Ga0070659_1001608422 | 319 |
| 281 | 3300005367 | Ga0070667_100019668 | Ga0070667_1000196687 | 319 |
| 282 | 3300005367 | Ga0070667_100029206 | Ga0070667_1000292065 | 319 |
| 283 | 3300005406 | Ga0070703_10001633 | Ga0070703_100016335 | 319 |
| 284 | 3300005434 | Ga0070709_10089154 | Ga0070709_100891542 | 319 |
| 285 | 3300005435 | Ga0070714_100031618 | Ga0070714_1000316184 | 319 |
| 286 | 3300005435 | Ga0070714_100140294 | Ga0070714_1001402942 | 319 |
| 287 | 3300005435 | Ga0070714_100229489 | Ga0070714_1002294891 | 319 |
| 288 | 3300005435 | Ga0070714_100369296 | Ga0070714_1003692961 | 319 |
| 289 | 3300005436 | Ga0070713_100010726 | Ga0070713_1000107265 | 319 |
| 290 | 3300005437 | Ga0070710_10002075 | Ga0070710_100020754 | 319 |
| 291 | 3300005439 | Ga0070711_100007887 | Ga0070711_1000078875 | 319 |
| 292 | 3300005439 | Ga0070711_100011777 | Ga0070711_1000117775 | 319 |
| 293 | 3300005440 | Ga0070705_100006364 | Ga0070705_1000063642 | 319 |
| 294 | 3300005444 | Ga0070694_100036409 | Ga0070694_1000364092 | 319 |
| 295 | 3300005445 | Ga0070708_100192603 | Ga0070708_1001926033 | 319 |
| 296 | 3300005456 | Ga0070678_100058654 | Ga0070678_1000586543 | 319 |
| 297 | 3300005458 | Ga0070681_10105774 | Ga0070681_101057741 | 319 |
| 298 | 3300005458 | Ga0070681_10192416 | Ga0070681_101924162 | 319 |
| 299 | 3300005458 | Ga0070681_10332042 | Ga0070681_103320421 | 319 |
| 300 | 3300005458 | Ga0070681_10497225 | Ga0070681_104972251 | 319 |
| 301 | 3300005459 | Ga0068867_100017455 | Ga0068867_1000174552 | 319 |
| 302 | 3300005466 | Ga0070685_10017509 | Ga0070685_100175092 | 319 |
| 303 | 3300005530 | Ga0070679_100063969 | Ga0070679_1000639694 | 319 |
| 304 | 3300005530 | Ga0070679_100579055 | Ga0070679_1005790551 | 319 |
| 305 | 3300005535 | Ga0070684_100036616 | Ga0070684_1000366164 | 319 |
| 306 | 3300005535 | Ga0070684_100375809 | Ga0070684_1003758092 | 319 |
| 307 | 3300005539 | Ga0068853_100051046 | Ga0068853_1000510462 | 319 |
| 308 | 3300005539 | Ga0068853_100077862 | Ga0068853_1000778623 | 319 |
| 309 | 3300005543 | Ga0070672_100000643 | Ga0070672_10000064319 | 319 |
| 310 | 3300005543 | Ga0070672_100127325 | Ga0070672_1001273253 | 319 |
| 311 | 3300005544 | Ga0070686_100001304 | Ga0070686_10000130412 | 319 |
| 312 | 3300005544 | Ga0070686_100010740 | Ga0070686_1000107406 | 319 |
| 313 | 3300005545 | Ga0070695_100004408 | Ga0070695_1000044086 | 319 |
| 314 | 3300005545 | Ga0070695_100022935 | Ga0070695_1000229352 | 319 |
| 315 | 3300005547 | Ga0070693_100002192 | Ga0070693_1000021926 | 319 |
| 316 | 3300005547 | Ga0070693_100027483 | Ga0070693_1000274833 | 319 |
| 317 | 3300005548 | Ga0070665_100056218 | Ga0070665_1000562185 | 319 |
| 318 | 3300005563 | Ga0068855_100164557 | Ga0068855_1001645572 | 319 |
| 319 | 3300005563 | Ga0068855_100170700 | Ga0068855_1001707002 | 319 |
| 320 | 3300005563 | Ga0068855_100212389 | Ga0068855_1002123892 | 319 |
| 321 | 3300005564 | Ga0070664_100106672 | Ga0070664_1001066722 | 319 |
| 322 | 3300005577 | Ga0068857_100010309 | Ga0068857_1000103096 | 319 |
| 323 | 3300005577 | Ga0068857_100301999 | Ga0068857_1003019992 | 319 |
| 324 | 3300005578 | Ga0068854_100019339 | Ga0068854_1000193392 | 319 |
| 325 | 3300005614 | Ga0068856_100005954 | Ga0068856_1000059545 | 319 |
| 326 | 3300005614 | Ga0068856_100233903 | Ga0068856_1002339032 | 319 |
| 327 | 3300005614 | Ga0068856_100268798 | Ga0068856_1002687981 | 319 |
| 328 | 3300005615 | Ga0070702_100010184 | Ga0070702_1000101845 | 319 |
| 329 | 3300005616 | Ga0068852_100036031 | Ga0068852_1000360312 | 319 |
| 330 | 3300005616 | Ga0068852_100121781 | Ga0068852_1001217812 | 319 |
| 331 | 3300005618 | Ga0068864_100004096 | Ga0068864_1000040962 | 319 |
| 332 | 3300005618 | Ga0068864_100017192 | Ga0068864_1000171921 | 319 |
| 333 | 3300005718 | Ga0068866_10054983 | Ga0068866_100549833 | 319 |
| 334 | 3300005840 | Ga0068870_10002536 | Ga0068870_100025363 | 319 |
| 335 | 3300005841 | Ga0068863_100011785 | Ga0068863_1000117856 | 319 |
| 336 | 3300005841 | Ga0068863_100041941 | Ga0068863_1000419412 | 319 |
| 337 | 3300005842 | Ga0068858_100027284 | Ga0068858_1000272843 | 319 |
| 338 | 3300005842 | Ga0068858_100049561 | Ga0068858_1000495615 | 319 |
| 339 | 3300005842 | Ga0068858_100059547 | Ga0068858_1000595474 | 319 |
| 340 | 3300005843 | Ga0068860_100031698 | Ga0068860_1000316982 | 319 |
| 341 | 3300005843 | Ga0068860_100177201 | Ga0068860_1001772012 | 319 |
| 342 | 3300005937 | Ga0081455_10000081 | Ga0081455_1000008167 | 319 |
| 343 | 3300005937 | Ga0081455_10012001 | Ga0081455_100120018 | 319 |
| 344 | 3300005937 | Ga0081455_10073907 | Ga0081455_100739072 | 319 |
| 345 | 3300005937 | Ga0081455_10080569 | Ga0081455_100805692 | 319 |
| 346 | 3300005983 | Ga0081540_1010241 | Ga0081540_10102411 | 319 |
| 347 | 3300006028 | Ga0070717_10000980 | Ga0070717_100009805 | 319 |
| 348 | 3300006058 | Ga0075432_10001738 | Ga0075432_100017386 | 319 |
| 349 | 3300006163 | Ga0070715_10002687 | Ga0070715_100026875 | 319 |
| 350 | 3300006173 | Ga0070716_100018566 | Ga0070716_1000185662 | 319 |
| 351 | 3300006173 | Ga0070716_100085376 | Ga0070716_1000853762 | 319 |
| 352 | 3300006175 | Ga0070712_100011997 | Ga0070712_1000119975 | 319 |
| 353 | 3300006178 | Ga0075367_10060427 | Ga0075367_100604272 | 319 |
| 354 | 3300006178 | Ga0075367_10099118 | Ga0075367_100991183 | 319 |
| 355 | 3300006237 | Ga0097621_100197389 | Ga0097621_1001973892 | 319 |
| 356 | 3300006358 | Ga0068871_100002394 | Ga0068871_1000023942 | 319 |
| 357 | 3300006358 | Ga0068871_100012591 | Ga0068871_1000125914 | 319 |
| 358 | 3300006844 | Ga0075428_100002359 | Ga0075428_1000023593 | 319 |
| 359 | 3300006846 | Ga0075430_100000424 | Ga0075430_10000042420 | 319 |
| 360 | 3300006847 | Ga0075431_100001606 | Ga0075431_10000160620 | 319 |
| 361 | 3300006852 | Ga0075433_10000012 | Ga0075433_1000001246 | 319 |
| 362 | 3300006852 | Ga0075433_10030391 | Ga0075433_100303913 | 319 |
| 363 | 3300006852 | Ga0075433_10104642 | Ga0075433_101046422 | 319 |
| 364 | 3300006871 | Ga0075434_100000692 | Ga0075434_1000006927 | 319 |
| 365 | 3300006871 | Ga0075434_100035497 | Ga0075434_1000354973 | 319 |
| 366 | 3300006871 | Ga0075434_100116442 | Ga0075434_1001164423 | 319 |
| 367 | 3300006871 | Ga0075434_100408739 | Ga0075434_1004087391 | 319 |
| 368 | 3300006880 | Ga0075429_100000558 | Ga0075429_10000055831 | 319 |
| 369 | 3300006914 | Ga0075436_100065592 | Ga0075436_1000655921 | 319 |
| 370 | 3300006914 | Ga0075436_100282494 | Ga0075436_1002824941 | 319 |
| 371 | 3300007076 | Ga0075435_100010893 | Ga0075435_1000108935 | 319 |
| 372 | 3300007076 | Ga0075435_100015701 | Ga0075435_1000157014 | 319 |
| 373 | 3300007076 | Ga0075435_100029529 | Ga0075435_1000295292 | 319 |
| 374 | 3300007076 | Ga0075435_100160557 | Ga0075435_1001605572 | 319 |
| 375 | 3300009011 | Ga0105251_10009318 | Ga0105251_100093186 | 319 |
| 376 | 3300009036 | Ga0105244_10059776 | Ga0105244_100597762 | 319 |
| 377 | 3300009093 | Ga0105240_10083193 | Ga0105240_100831933 | 319 |
| 378 | 3300009093 | Ga0105240_10293290 | Ga0105240_102932901 | 319 |
| 379 | 3300009093 | Ga0105240_10333055 | Ga0105240_103330552 | 319 |
| 380 | 3300009093 | Ga0105240_10640716 | Ga0105240_106407161 | 319 |
| 381 | 3300009094 | Ga0111539_10003218 | Ga0111539_100032183 | 319 |
| 382 | 3300009094 | Ga0111539_10040187 | Ga0111539_100401873 | 319 |
| 383 | 3300009098 | Ga0105245_10001227 | Ga0105245_1000122721 | 319 |
| 384 | 3300009098 | Ga0105245_10102473 | Ga0105245_101024731 | 319 |
| 385 | 3300009101 | Ga0105247_10007843 | Ga0105247_100078432 | 319 |
| 386 | 3300009147 | Ga0114129_10000803 | Ga0114129_1000080321 | 319 |
| 387 | 3300009147 | Ga0114129_10006740 | Ga0114129_1000674015 | 319 |
| 388 | 3300009148 | Ga0105243_10006687 | Ga0105243_100066876 | 319 |
| 389 | 3300009148 | Ga0105243_10008944 | Ga0105243_100089445 | 319 |
| 390 | 3300009174 | Ga0105241_10002078 | Ga0105241_1000207815 | 319 |
| 391 | 3300009174 | Ga0105241_10145543 | Ga0105241_101455433 | 319 |
| 392 | 3300009176 | Ga0105242_10012319 | Ga0105242_100123193 | 319 |
| 393 | 3300009176 | Ga0105242_10022262 | Ga0105242_100222622 | 319 |
| 394 | 3300009176 | Ga0105242_10071893 | Ga0105242_100718932 | 319 |
| 395 | 3300009177 | Ga0105248_10016502 | Ga0105248_100165026 | 319 |
| 396 | 3300009177 | Ga0105248_10090176 | Ga0105248_100901762 | 319 |
| 397 | 3300009177 | Ga0105248_10091208 | Ga0105248_100912082 | 319 |
| 398 | 3300009177 | Ga0105248_10206505 | Ga0105248_102065052 | 319 |
| 399 | 3300009545 | Ga0105237_10028276 | Ga0105237_100282764 | 319 |
| 400 | 3300009545 | Ga0105237_10201037 | Ga0105237_102010372 | 319 |
| 401 | 3300009545 | Ga0105237_10330868 | Ga0105237_103308682 | 319 |
| 402 | 3300009551 | Ga0105238_10034096 | Ga0105238_100340965 | 319 |
| 403 | 3300009551 | Ga0105238_10039765 | Ga0105238_100397654 | 319 |
| 404 | 3300009551 | Ga0105238_10072890 | Ga0105238_100728902 | 319 |
| 405 | 3300009553 | Ga0105249_10056093 | Ga0105249_100560932 | 319 |
| 406 | 3300009553 | Ga0105249_10084429 | Ga0105249_100844293 | 319 |
| 407 | 3300010375 | Ga0105239_10071027 | Ga0105239_100710273 | 319 |
| 408 | 3300011119 | Ga0105246_10017784 | Ga0105246_100177845 | 319 |
| 409 | 3300011119 | Ga0105246_10018580 | Ga0105246_100185804 | 319 |
| 410 | 3300013100 | Ga0157373_10053046 | Ga0157373_100530462 | 319 |
| 411 | 3300013100 | Ga0157373_10057970 | Ga0157373_100579703 | 319 |
| 412 | 3300013102 | Ga0157371_10036077 | Ga0157371_100360772 | 319 |
| 413 | 3300013102 | Ga0157371_10110696 | Ga0157371_101106962 | 319 |
| 414 | 3300013104 | Ga0157370_10066661 | Ga0157370_100666613 | 319 |
| 415 | 3300013104 | Ga0157370_10084465 | Ga0157370_100844654 | 319 |
| 416 | 3300013104 | Ga0157370_10290506 | Ga0157370_102905061 | 319 |
| 417 | 3300013105 | Ga0157369_10125307 | Ga0157369_101253071 | 319 |
| 418 | 3300013296 | Ga0157374_10001167 | Ga0157374_1000116714 | 319 |
| 419 | 3300013296 | Ga0157374_10123181 | Ga0157374_101231812 | 319 |
| 420 | 3300013306 | Ga0163162_10081228 | Ga0163162_100812283 | 319 |
| 421 | 3300013306 | Ga0163162_10172458 | Ga0163162_101724583 | 319 |
| 422 | 3300013307 | Ga0157372_10175216 | Ga0157372_101752162 | 319 |
| 423 | 3300013307 | Ga0157372_10183661 | Ga0157372_101836612 | 319 |
| 424 | 3300013307 | Ga0157372_10254806 | Ga0157372_102548062 | 319 |
| 425 | 3300013308 | Ga0157375_10024045 | Ga0157375_100240453 | 319 |
| 426 | 3300014325 | Ga0163163_10004077 | Ga0163163_100040774 | 319 |
| 427 | 3300014325 | Ga0163163_10011690 | Ga0163163_100116905 | 319 |
| 428 | 3300014325 | Ga0163163_10127494 | Ga0163163_101274943 | 319 |
| 429 | 3300014326 | Ga0157380_10187910 | Ga0157380_101879101 | 319 |
| 430 | 3300014497 | Ga0182008_10047790 | Ga0182008_100477902 | 319 |
| 431 | 3300014745 | Ga0157377_10005174 | Ga0157377_100051742 | 319 |
| 432 | 3300014968 | Ga0157379_10015293 | Ga0157379_100152932 | 319 |
| 433 | 3300014968 | Ga0157379_10019074 | Ga0157379_100190742 | 319 |
| 434 | 3300014968 | Ga0157379_10045579 | Ga0157379_100455795 | 319 |
| 435 | 3300014969 | Ga0157376_10008081 | Ga0157376_100080816 | 319 |
| 436 | 3300014969 | Ga0157376_10008909 | Ga0157376_100089096 | 319 |
| 437 | 3300017792 | Ga0163161_10023558 | Ga0163161_100235584 | 319 |
| 438 | 3300017792 | Ga0163161_10050839 | Ga0163161_100508392 | 319 |
| 439 | 3300025271 | Ga0207666_1000303 | Ga0207666_10003035 | 319 |
| 440 | 3300025290 | Ga0207673_1000268 | Ga0207673_10002685 | 319 |
| 441 | 3300025315 | Ga0207697_10010266 | Ga0207697_100102662 | 319 |
| 442 | 3300025735 | Ga0207713_1012260 | Ga0207713_10122601 | 319 |
| 443 | 3300025885 | Ga0207653_10001180 | Ga0207653_100011805 | 319 |
| 444 | 3300025893 | Ga0207682_10000169 | Ga0207682_1000016929 | 319 |
| 445 | 3300025900 | Ga0207710_10000382 | Ga0207710_100003824 | 319 |
| 446 | 3300025900 | Ga0207710_10009676 | Ga0207710_100096765 | 319 |
| 447 | 3300025901 | Ga0207688_10005457 | Ga0207688_100054575 | 319 |
| 448 | 3300025903 | Ga0207680_10005813 | Ga0207680_100058134 | 319 |
| 449 | 3300025904 | Ga0207647_10018922 | Ga0207647_100189225 | 319 |
| 450 | 3300025906 | Ga0207699_10003983 | Ga0207699_100039835 | 319 |
| 451 | 3300025907 | Ga0207645_10013151 | Ga0207645_100131516 | 319 |
| 452 | 3300025908 | Ga0207643_10000004 | Ga0207643_1000000489 | 319 |
| 453 | 3300025909 | Ga0207705_10362780 | Ga0207705_103627801 | 319 |
| 454 | 3300025911 | Ga0207654_10004998 | Ga0207654_100049983 | 319 |
| 455 | 3300025912 | Ga0207707_10079866 | Ga0207707_100798663 | 319 |
| 456 | 3300025912 | Ga0207707_10273712 | Ga0207707_102737122 | 319 |
| 457 | 3300025912 | Ga0207707_10292798 | Ga0207707_102927981 | 319 |
| 458 | 3300025912 | Ga0207707_10348390 | Ga0207707_103483901 | 319 |
| 459 | 3300025913 | Ga0207695_10088462 | Ga0207695_100884622 | 319 |
| 460 | 3300025913 | Ga0207695_10229620 | Ga0207695_102296202 | 319 |
| 461 | 3300025915 | Ga0207693_10001228 | Ga0207693_100012285 | 319 |
| 462 | 3300025915 | Ga0207693_10037515 | Ga0207693_100375153 | 319 |
| 463 | 3300025915 | Ga0207693_10086622 | Ga0207693_100866222 | 319 |
| 464 | 3300025916 | Ga0207663_10008842 | Ga0207663_100088422 | 319 |
| 465 | 3300025917 | Ga0207660_10002588 | Ga0207660_100025883 | 319 |
| 466 | 3300025917 | Ga0207660_10258602 | Ga0207660_102586021 | 319 |
| 467 | 3300025917 | Ga0207660_10343333 | Ga0207660_103433331 | 319 |
| 468 | 3300025918 | Ga0207662_10000392 | Ga0207662_1000039217 | 319 |
| 469 | 3300025919 | Ga0207657_10002007 | Ga0207657_100020075 | 319 |
| 470 | 3300025919 | Ga0207657_10050436 | Ga0207657_100504363 | 319 |
| 471 | 3300025919 | Ga0207657_10089083 | Ga0207657_100890832 | 319 |
| 472 | 3300025919 | Ga0207657_10121258 | Ga0207657_101212582 | 319 |
| 473 | 3300025920 | Ga0207649_10003920 | Ga0207649_100039202 | 319 |
| 474 | 3300025920 | Ga0207649_10020993 | Ga0207649_100209935 | 319 |
| 475 | 3300025921 | Ga0207652_10101001 | Ga0207652_101010013 | 319 |
| 476 | 3300025921 | Ga0207652_10191138 | Ga0207652_101911382 | 319 |
| 477 | 3300025921 | Ga0207652_10200343 | Ga0207652_102003432 | 319 |
| 478 | 3300025923 | Ga0207681_10020237 | Ga0207681_100202372 | 319 |
| 479 | 3300025924 | Ga0207694_10059618 | Ga0207694_100596182 | 319 |
| 480 | 3300025924 | Ga0207694_10112628 | Ga0207694_101126283 | 319 |
| 481 | 3300025925 | Ga0207650_10004443 | Ga0207650_100044435 | 319 |
| 482 | 3300025926 | Ga0207659_10000038 | Ga0207659_10000038106 | 319 |
| 483 | 3300025927 | Ga0207687_10007503 | Ga0207687_100075034 | 319 |
| 484 | 3300025927 | Ga0207687_10019017 | Ga0207687_100190173 | 319 |
| 485 | 3300025927 | Ga0207687_10022230 | Ga0207687_100222305 | 319 |
| 486 | 3300025928 | Ga0207700_10002133 | Ga0207700_100021334 | 319 |
| 487 | 3300025929 | Ga0207664_10389635 | Ga0207664_103896352 | 319 |
| 488 | 3300025929 | Ga0207664_10428049 | Ga0207664_104280491 | 319 |
| 489 | 3300025931 | Ga0207644_10002653 | Ga0207644_1000265313 | 319 |
| 490 | 3300025931 | Ga0207644_10014180 | Ga0207644_100141801 | 319 |
| 491 | 3300025931 | Ga0207644_10257919 | Ga0207644_102579192 | 319 |
| 492 | 3300025932 | Ga0207690_10008630 | Ga0207690_100086305 | 319 |
| 493 | 3300025933 | Ga0207706_10015380 | Ga0207706_100153805 | 319 |
| 494 | 3300025934 | Ga0207686_10005483 | Ga0207686_100054835 | 319 |
| 495 | 3300025934 | Ga0207686_10008322 | Ga0207686_100083222 | 319 |
| 496 | 3300025935 | Ga0207709_10000645 | Ga0207709_100006455 | 319 |
| 497 | 3300025935 | Ga0207709_10005944 | Ga0207709_100059446 | 319 |
| 498 | 3300025936 | Ga0207670_10026558 | Ga0207670_100265584 | 319 |
| 499 | 3300025936 | Ga0207670_10084696 | Ga0207670_100846963 | 319 |
| 500 | 3300025937 | Ga0207669_10039382 | Ga0207669_100393823 | 319 |
| 501 | 3300025938 | Ga0207704_10001273 | Ga0207704_100012733 | 319 |
| 502 | 3300025938 | Ga0207704_10230260 | Ga0207704_102302601 | 319 |
| 503 | 3300025939 | Ga0207665_10000541 | Ga0207665_1000054117 | 319 |
| 504 | 3300025939 | Ga0207665_10073437 | Ga0207665_100734372 | 319 |
| 505 | 3300025939 | Ga0207665_10136395 | Ga0207665_101363951 | 319 |
| 506 | 3300025940 | Ga0207691_10016931 | Ga0207691_100169315 | 319 |
| 507 | 3300025940 | Ga0207691_10093273 | Ga0207691_100932733 | 319 |
| 508 | 3300025941 | Ga0207711_10002645 | Ga0207711_1000264512 | 319 |
| 509 | 3300025941 | Ga0207711_10008404 | Ga0207711_100084049 | 319 |
| 510 | 3300025941 | Ga0207711_10188165 | Ga0207711_101881652 | 319 |
| 511 | 3300025942 | Ga0207689_10013698 | Ga0207689_100136985 | 319 |
| 512 | 3300025942 | Ga0207689_10044297 | Ga0207689_100442975 | 319 |
| 513 | 3300025944 | Ga0207661_10094127 | Ga0207661_100941272 | 319 |
| 514 | 3300025944 | Ga0207661_10146059 | Ga0207661_101460592 | 319 |
| 515 | 3300025944 | Ga0207661_10167727 | Ga0207661_101677272 | 319 |
| 516 | 3300025945 | Ga0207679_10000673 | Ga0207679_100006735 | 319 |
| 517 | 3300025949 | Ga0207667_10162417 | Ga0207667_101624172 | 319 |
| 518 | 3300025949 | Ga0207667_10236644 | Ga0207667_102366442 | 319 |
| 519 | 3300025949 | Ga0207667_10483851 | Ga0207667_104838511 | 319 |
| 520 | 3300025960 | Ga0207651_10004796 | Ga0207651_100047962 | 319 |
| 521 | 3300025960 | Ga0207651_10025240 | Ga0207651_100252403 | 319 |
| 522 | 3300025960 | Ga0207651_10034700 | Ga0207651_100347004 | 319 |
| 523 | 3300025961 | Ga0207712_10104383 | Ga0207712_101043832 | 319 |
| 524 | 3300025972 | Ga0207668_10000300 | Ga0207668_100003005 | 319 |
| 525 | 3300025972 | Ga0207668_10267865 | Ga0207668_102678651 | 319 |
| 526 | 3300025981 | Ga0207640_10013982 | Ga0207640_100139822 | 319 |
| 527 | 3300025986 | Ga0207658_10267483 | Ga0207658_102674831 | 319 |
| 528 | 3300026023 | Ga0207677_10052019 | Ga0207677_100520191 | 319 |
| 529 | 3300026035 | Ga0207703_10001822 | Ga0207703_100018223 | 319 |
| 530 | 3300026035 | Ga0207703_10015219 | Ga0207703_100152192 | 319 |
| 531 | 3300026035 | Ga0207703_10139922 | Ga0207703_101399222 | 319 |
| 532 | 3300026041 | Ga0207639_10070130 | Ga0207639_100701302 | 319 |
| 533 | 3300026041 | Ga0207639_10148777 | Ga0207639_101487772 | 319 |
| 534 | 3300026067 | Ga0207678_10001349 | Ga0207678_1000134920 | 319 |
| 535 | 3300026075 | Ga0207708_10010365 | Ga0207708_100103655 | 319 |
| 536 | 3300026078 | Ga0207702_10088874 | Ga0207702_100888742 | 319 |
| 537 | 3300026088 | Ga0207641_10301118 | Ga0207641_103011182 | 319 |
| 538 | 3300026089 | Ga0207648_10015829 | Ga0207648_100158295 | 319 |
| 539 | 3300026095 | Ga0207676_10001979 | Ga0207676_100019794 | 319 |
| 540 | 3300026116 | Ga0207674_10022363 | Ga0207674_100223635 | 319 |
| 541 | 3300026116 | Ga0207674_10165967 | Ga0207674_101659672 | 319 |
| 542 | 3300026118 | Ga0207675_100016410 | Ga0207675_1000164105 | 319 |
| 543 | 3300026121 | Ga0207683_10000138 | Ga0207683_1000013861 | 319 |
| 544 | 3300026121 | Ga0207683_10009051 | Ga0207683_100090513 | 319 |
| 545 | 3300026121 | Ga0207683_10016053 | Ga0207683_100160536 | 319 |
| 546 | 3300026142 | Ga0207698_10085087 | Ga0207698_100850873 | 319 |
| 547 | 3300027252 | Ga0209973_1006386 | Ga0209973_10063861 | 319 |
| 548 | 3300027695 | Ga0209966_1006273 | Ga0209966_10062732 | 319 |
| 549 | 3300027717 | Ga0209998_10001517 | Ga0209998_100015174 | 319 |
| 550 | 3300027876 | Ga0209974_10007950 | Ga0209974_100079503 | 319 |
| 551 | 3300027907 | Ga0207428_10000137 | Ga0207428_1000013774 | 319 |
| 552 | 3300027907 | Ga0207428_10000501 | Ga0207428_1000050136 | 319 |
| 553 | 3300028379 | Ga0268266_10001262 | Ga0268266_1000126221 | 319 |
| 554 | 3300028379 | Ga0268266_10124169 | Ga0268266_101241692 | 319 |
| 555 | 3300028380 | Ga0268265_10112629 | Ga0268265_101126292 | 319 |
| 556 | 3300028380 | Ga0268265_10287661 | Ga0268265_102876612 | 319 |
| 557 | 3300028381 | Ga0268264_10063392 | Ga0268264_100633922 | 319 |
| 558 | 3300028381 | Ga0268264_10217987 | Ga0268264_102179872 | 319 |
| 559 | 3300028800 | Ga0265338_10057618 | Ga0265338_100576184 | 319 |
| 560 | 3300031241 | Ga0265325_10000073 | Ga0265325_1000007320 | 319 |
| 561 | 3300031241 | Ga0265325_10001135 | Ga0265325_1000113518 | 319 |
| 562 | 3300031241 | Ga0265325_10028736 | Ga0265325_100287364 | 319 |
| 563 | 3300031241 | Ga0265325_10040658 | Ga0265325_100406581 | 319 |
| 564 | 3300031241 | Ga0265325_10068229 | Ga0265325_100682292 | 319 |
| 565 | 3300031247 | Ga0265340_10040674 | Ga0265340_100406742 | 319 |
| 566 | 3300031247 | Ga0265340_10153859 | Ga0265340_101538591 | 319 |
| 567 | 3300031249 | Ga0265339_10042095 | Ga0265339_100420952 | 319 |
| 568 | 3300031344 | Ga0265316_10026938 | Ga0265316_100269384 | 319 |
| 569 | 3300031595 | Ga0265313_10000716 | Ga0265313_1000071621 | 319 |
| 570 | 3300031595 | Ga0265313_10013800 | Ga0265313_100138004 | 319 |
| 571 | 3300031595 | Ga0265313_10013961 | Ga0265313_100139612 | 319 |
| 572 | 3300031595 | Ga0265313_10020135 | Ga0265313_100201355 | 319 |
| 573 | 3300031595 | Ga0265313_10056708 | Ga0265313_100567082 | 319 |
| 574 | 3300031665 | Ga0316575_10021421 | Ga0316575_100214213 | 319 |
| 575 | 3300031691 | Ga0316579_10039950 | Ga0316579_100399502 | 319 |
| 576 | 3300031711 | Ga0265314_10164738 | Ga0265314_101647382 | 319 |
| 577 | 3300031712 | Ga0265342_10000308 | Ga0265342_100003082 | 319 |
| 578 | 3300031712 | Ga0265342_10007094 | Ga0265342_100070947 | 319 |
| 579 | 3300032133 | Ga0316583_10013697 | Ga0316583_100136973 | 319 |
| 580 | 3300032133 | Ga0316583_10051472 | Ga0316583_100514721 | 319 |
| 581 | 3300034957 | Ga0373938_0003594 | Ga0373938_0003594_926_1885 | 319 |
| 582 | 3300035083 | Ga0373926_0002849 | Ga0373926_0002849_195_1154 | 319 |
| 583 | 3300035090 | Ga0373949_0004634 | Ga0373949_0004634_1842_2801 | 319 |
| 584 | 3300035092 | Ga0373952_0000958 | Ga0373952_0000958_315_1274 | 319 |
| 585 | 3300035092 | Ga0373952_0003763 | Ga0373952_0003763_591_1550 | 319 |
| 586 | 3300035112 | Ga0373932_0019923 | Ga0373932_0019923_547_1506 | 319 |
| 587 | 3300035113 | Ga0373936_0061809 | Ga0373936_0061809_13_972 | 319 |
| 588 | 3300035114 | Ga0373939_0000167 | Ga0373939_0000167_12576_13571 | 319 |
| 589 | 3300035114 | Ga0373939_0001060 | Ga0373939_0001060_584_1543 | 319 |
| 590 | 3300035115 | Ga0373941_0008094 | Ga0373941_0008094_648_1607 | 319 |
| 591 | 3300035116 | Ga0373945_0034814 | Ga0373945_0034814_69_1028 | 319 |
| 592 | 3300035117 | Ga0373953_0010186 | Ga0373953_0010186_1063_2022 | 319 |
| 593 | 3300035117 | Ga0373953_0018966 | Ga0373953_0018966_1546_2505 | 319 |
| 594 | 3300035117 | Ga0373953_0046524 | Ga0373953_0046524_728_1690 | 319 |
| 595 | 3300035118 | Ga0373954_0010267 | Ga0373954_0010267_1239_2198 | 319 |
| 596 | 3300035119 | Ga0373956_0012714 | Ga0373956_0012714_1901_2860 | 319 |
| 597 | 3300035119 | Ga0373956_0015207 | Ga0373956_0015207_499_1461 | 319 |
| 598 | 3300035120 | Ga0373957_0014956 | Ga0373957_0014956_964_1926 | 319 |
| 599 | 3300035121 | Ga0373960_0010409 | Ga0373960_0010409_895_1854 | 319 |
| 600 | 3300035170 | Ga0373943_0003950 | Ga0373943_0003950_3274_4233 | 319 |
| 601 | 3300035171 | Ga0373946_0012060 | Ga0373946_0012060_1497_2456 | 319 |
| 602 | 3300035172 | Ga0373955_0010594 | Ga0373955_0010594_256_1215 | 319 |
| 603 | 3300035172 | Ga0373955_0094137 | Ga0373955_0094137_398_1360 | 319 |
| 604 | 3300035207 | Ga0373942_0010013 | Ga0373942_0010013_399_1358 | 319 |
| 605 | 3300035241 | Ga0373961_0040393 | Ga0373961_0040393_356_1315 | 319 |
| 606 | 3300035242 | Ga0373962_0003809 | Ga0373962_0003809_2536_3495 | 319 |
| 607 | 3300035242 | Ga0373962_0021487 | Ga0373962_0021487_288_1247 | 319 |
| 608 | 3300035410 | Ga0373924_0002384 | Ga0373924_0002384_4152_5111 | 319 |
| 609 | 3300035691 | Ga0373931_0002836 | Ga0373931_0002836_2209_3168 | 319 |
| 610 | 3300035691 | Ga0373931_0080738 | Ga0373931_0080738_26_985 | 319 |
| 611 | 3300035692 | Ga0373935_0019290 | Ga0373935_0019290_1341_2300 | 319 |
| 612 | 3300035692 | Ga0373935_0031623 | Ga0373935_0031623_197_1156 | 319 |
| 613 | 3300035695 | Ga0373927_0002644 | Ga0373927_0002644_5449_6408 | 319 |
| 614 | 3300035724 | Ga0373933_0033264 | Ga0373933_0033264_1471_2433 | 319 |
| 615 | 3300035725 | Ga0373947_0001717 | Ga0373947_0001717_10587_11546 | 319 |
| 616 | 3300035725 | Ga0373947_0033880 | Ga0373947_0033880_532_1491 | 319 |
| 617 | 3300035725 | Ga0373947_0206113 | Ga0373947_0206113_43_1002 | 319 |
| 618 | 3300036401 | Ga0373937_0010057 | Ga0373937_0010057_6408_7370 | 319 |
| 619 | 3300036401 | Ga0373937_0060239 | Ga0373937_0060239_1234_2193 | 319 |
| 620 | 3300036401 | Ga0373937_0208874 | Ga0373937_0208874_839_1798 | 319 |
| 621 | 3300037068 | Ga0373925_0009737 | Ga0373925_0009737_3150_4109 | 319 |
| 622 | 3300037068 | Ga0373925_0175271 | Ga0373925_0175271_698_1657 | 319 |
| 623 | 3300037068 | Ga0373925_0440104 | Ga0373925_0440104_81_1040 | 319 |
| 624 | 3300037312 | Ga0395899_0036141 | Ga0395899_0036141_987_1946 | 319 |
| 625 | 3300037418 | Ga0395900_0005226 | Ga0395900_0005226_9686_10645 | 319 |
| 626 | 3300037466 | Ga0395898_0041183 | Ga0395898_0041183_996_1955 | 319 |
| 627 | 3300037466 | Ga0395898_0071635 | Ga0395898_0071635_969_1928 | 319 |
| 628 | 3300037466 | Ga0395898_0097810 | Ga0395898_0097810_1176_2135 | 319 |
| 629 | 3300038443 | Ga0395901_0059145 | Ga0395901_0059145_2810_3769 | 319 |
| 630 | 3300042005 | Ga0439448_0020540 | Ga0439448_0020540_768_1727 | 319 |
| 631 | 3300044684 | Ga0466966_0036234 | Ga0466966_0036234_921_1880 | 319 |
| 632 | 3300044693 | Ga0466961_0151821 | Ga0466961_0151821_268_1227 | 319 |
| 633 | 3300044694 | Ga0466963_0057036 | Ga0466963_0057036_80_1039 | 319 |
| 634 | 3300044842 | Ga0466957_0191744 | Ga0466957_0191744_310_1269 | 319 |
| 635 | 3300045049 | Ga0466959_0165525 | Ga0466959_0165525_101_1060 | 319 |
| 636 | 3300045976 | Ga0466967_0011672 | Ga0466967_0011672_4601_5560 | 319 |
| 637 | 3300046454 | Ga0495592_0017486 | Ga0495592_0017486_3651_4610 | 319 |
| 638 | 3300046455 | Ga0495603_0005609 | Ga0495603_0005609_2055_3014 | 319 |
| 639 | 3300046459 | Ga0495629_0000753 | Ga0495629_0000753_6490_7449 | 319 |
| 640 | 3300046459 | Ga0495629_0124027 | Ga0495629_0124027_45_1004 | 319 |
| 641 | 3300046462 | Ga0495651_0001426 | Ga0495651_0001426_10487_11446 | 319 |
| 642 | 3300046463 | Ga0495653_0037014 | Ga0495653_0037014_2122_3081 | 319 |
| 643 | 3300046463 | Ga0495653_0087496 | Ga0495653_0087496_108_1070 | 319 |
| 644 | 3300046473 | Ga0495582_0058793 | Ga0495582_0058793_887_1846 | 319 |
| 645 | 3300046475 | Ga0495639_0082540 | Ga0495639_0082540_477_1436 | 319 |
| 646 | 3300046476 | Ga0495662_0016049 | Ga0495662_0016049_1575_2534 | 319 |
| 647 | 3300046491 | Ga0495584_0037411 | Ga0495584_0037411_363_1322 | 319 |
| 648 | 3300046499 | Ga0495594_0009417 | Ga0495594_0009417_161_1120 | 319 |
| 649 | 3300046499 | Ga0495594_0009717 | Ga0495594_0009717_3062_4021 | 319 |
| 650 | 3300046511 | Ga0495608_0013047 | Ga0495608_0013047_2932_3891 | 319 |
| 651 | 3300046511 | Ga0495608_0061288 | Ga0495608_0061288_690_1652 | 319 |
| 652 | 3300046514 | Ga0495618_0003047 | Ga0495618_0003047_5619_6578 | 319 |
| 653 | 3300046516 | Ga0495628_0019182 | Ga0495628_0019182_1572_2531 | 319 |
| 654 | 3300046517 | Ga0495630_0079495 | Ga0495630_0079495_1102_2061 | 319 |
| 655 | 3300046526 | Ga0495666_0046412 | Ga0495666_0046412_178_1137 | 319 |
| 656 | 3300046529 | Ga0495652_0017441 | Ga0495652_0017441_4003_4962 | 319 |
| 657 | 3300046531 | Ga0495665_0191071 | Ga0495665_0191071_35_994 | 319 |
| 658 | 3300046536 | Ga0495587_0004130 | Ga0495587_0004130_5018_5977 | 319 |
| 659 | 3300046543 | Ga0495645_0010540 | Ga0495645_0010540_3651_4610 | 319 |
| 660 | 3300046559 | Ga0495667_0078718 | Ga0495667_0078718_1039_2001 | 319 |
| 661 | 3300046674 | Ga0495588_0040109 | Ga0495588_0040109_13_972 | 319 |
| 662 | 3300046674 | Ga0495588_0127826 | Ga0495588_0127826_47_1006 | 319 |
| 663 | 3300046675 | Ga0495657_0012549 | Ga0495657_0012549_1466_2425 | 319 |
| 664 | 3300046675 | Ga0495657_0042837 | Ga0495657_0042837_984_1946 | 319 |
| 665 | 3300046679 | Ga0495623_0125668 | Ga0495623_0125668_433_1395 | 319 |
| 666 | 3300046680 | Ga0495646_0002961 | Ga0495646_0002961_8069_9028 | 319 |
| 667 | 3300046681 | Ga0495647_0047755 | Ga0495647_0047755_596_1555 | 319 |
| 668 | 3300046681 | Ga0495647_0127768 | Ga0495647_0127768_71_1030 | 319 |
| 669 | 3300046683 | Ga0495658_0000543 | Ga0495658_0000543_8534_9493 | 319 |
| 670 | 3300046683 | Ga0495658_0004686 | Ga0495658_0004686_1946_2905 | 319 |
| 671 | 3300046689 | Ga0495613_0050781 | Ga0495613_0050781_1787_2746 | 319 |
| 672 | 3300046689 | Ga0495613_0072220 | Ga0495613_0072220_964_1923 | 319 |
| 673 | 3300047315 | Ga0495581_0018686 | Ga0495581_0018686_711_1670 | 319 |
| 674 | 3300047317 | Ga0495604_0003959 | Ga0495604_0003959_3651_4610 | 319 |
| 675 | 3300047321 | Ga0495676_0030918 | Ga0495676_0030918_181_1140 | 319 |
| 676 | 3300047321 | Ga0495676_0054653 | Ga0495676_0054653_1159_2118 | 319 |
| 677 | 3300047322 | Ga0495680_0015238 | Ga0495680_0015238_164_1123 | 319 |
| 678 | 3300047322 | Ga0495680_0045737 | Ga0495680_0045737_1661_2623 | 319 |
| 679 | 3300047322 | Ga0495680_0297981 | Ga0495680_0297981_80_1039 | 319 |
| 680 | 3300047444 | Ga0495675_0001398 | Ga0495675_0001398_851_1810 | 319 |
| 681 | 3300047444 | Ga0495675_0046094 | Ga0495675_0046094_893_1855 | 319 |
| 682 | 3300047471 | Ga0495684_0091259 | Ga0495684_0091259_1072_2031 | 319 |
| 683 | 3300047471 | Ga0495684_0279169 | Ga0495684_0279169_165_1124 | 319 |
| 684 | 3300047673 | Ga0495593_0038641 | Ga0495593_0038641_448_1407 | 319 |
| 685 | 3300047673 | Ga0495593_0056214 | Ga0495593_0056214_48_1007 | 319 |
| 686 | 3300048088 | Ga0495602_0027639 | Ga0495602_0027639_839_1798 | 319 |
| 687 | 3300048088 | Ga0495602_0051565 | Ga0495602_0051565_1683_2645 | 319 |
| 688 | 3300048089 | Ga0495614_0022916 | Ga0495614_0022916_879_1838 | 319 |
| 689 | 3300048903 | Ga0496100_0017497 | Ga0496100_0017497_740_1699 | 319 |
| 690 | 3300048903 | Ga0496100_0047791 | Ga0496100_0047791_1305_2264 | 319 |
| 691 | 3300048904 | Ga0496101_0011631 | Ga0496101_0011631_1305_2264 | 319 |
| 692 | 3300048904 | Ga0496101_0047399 | Ga0496101_0047399_1901_2860 | 319 |
| 693 | 3300048904 | Ga0496101_0236279 | Ga0496101_0236279_232_1191 | 319 |
| 694 | 3300048905 | Ga0496102_0009243 | Ga0496102_0009243_42_1001 | 319 |
| 695 | 3300048905 | Ga0496102_0143773 | Ga0496102_0143773_17_976 | 319 |
| 696 | 3300048905 | Ga0496102_0320748 | Ga0496102_0320748_394_1353 | 319 |
| 697 | 3300048906 | Ga0496103_0011411 | Ga0496103_0011411_2909_3868 | 319 |
| 698 | 3300048907 | Ga0496104_0002184 | Ga0496104_0002184_5665_6624 | 319 |
| 699 | 3300048908 | Ga0496105_0003206 | Ga0496105_0003206_5854_6813 | 319 |
| 700 | 3300048910 | Ga0496107_0016951 | Ga0496107_0016951_582_1541 | 319 |
| 701 | 3300048910 | Ga0496107_0022673 | Ga0496107_0022673_2809_3768 | 319 |
| 702 | 3300048911 | Ga0496108_0037785 | Ga0496108_0037785_833_1792 | 319 |
| 703 | 3300048911 | Ga0496108_0139082 | Ga0496108_0139082_756_1715 | 319 |
| 704 | 3300048912 | Ga0496109_0004575 | Ga0496109_0004575_733_1692 | 319 |
| 705 | 3300048912 | Ga0496109_0009961 | Ga0496109_0009961_3845_4804 | 319 |
| 706 | 3300048912 | Ga0496109_0016091 | Ga0496109_0016091_1432_2391 | 319 |
| 707 | 3300048912 | Ga0496109_0094444 | Ga0496109_0094444_778_1737 | 319 |
| 708 | 3300048913 | Ga0496110_0063136 | Ga0496110_0063136_2302_3261 | 319 |
| 709 | 3300048913 | Ga0496110_0144635 | Ga0496110_0144635_31_990 | 319 |
| 710 | 3300048914 | Ga0496111_0055333 | Ga0496111_0055333_140_1099 | 319 |
| 711 | 3300048914 | Ga0496111_0086834 | Ga0496111_0086834_385_1344 | 319 |
| 712 | 3300048915 | Ga0496112_0079598 | Ga0496112_0079598_756_1715 | 319 |
| 713 | 3300048915 | Ga0496112_0093480 | Ga0496112_0093480_211_1170 | 319 |
| 714 | 3300048916 | Ga0496113_0174178 | Ga0496113_0174178_11_970 | 319 |
| 715 | 3300048917 | Ga0496114_0004868 | Ga0496114_0004868_7583_8542 | 319 |
| 716 | 3300048917 | Ga0496114_0025726 | Ga0496114_0025726_3274_4233 | 319 |
| 717 | 3300048918 | Ga0496115_0032160 | Ga0496115_0032160_1790_2749 | 319 |
| 718 | 3300048918 | Ga0496115_0054212 | Ga0496115_0054212_1868_2827 | 319 |
| 719 | 3300048918 | Ga0496115_0064373 | Ga0496115_0064373_824_1783 | 319 |
| 720 | 3300049569 | Ga0501032_0049697 | Ga0501032_0049697_815_1777 | 319 |
| 721 | 3300049569 | Ga0501032_0162697 | Ga0501032_0162697_206_1165 | 319 |
| 722 | 3300049570 | Ga0501033_0020324 | Ga0501033_0020324_1312_2271 | 319 |
| 723 | 3300049571 | Ga0501034_0062652 | Ga0501034_0062652_86_1048 | 319 |
| 724 | 3300049571 | Ga0501034_0068301 | Ga0501034_0068301_2535_3494 | 319 |
| 725 | 3300049571 | Ga0501034_0083871 | Ga0501034_0083871_1346_2305 | 319 |
| 726 | 3300049571 | Ga0501034_0174406 | Ga0501034_0174406_121_1083 | 319 |
| 727 | 3300049572 | Ga0501036_0105971 | Ga0501036_0105971_13_972 | 319 |
| 728 | 3300049574 | Ga0501038_0008011 | Ga0501038_0008011_514_1473 | 319 |
| 729 | 3300049575 | Ga0501039_0118326 | Ga0501039_0118326_137_1096 | 319 |
| 730 | 3300049581 | Ga0501047_0019004 | Ga0501047_0019004_2100_3059 | 319 |
| 731 | 3300049581 | Ga0501047_0099931 | Ga0501047_0099931_953_1912 | 319 |
| 732 | 3300049581 | Ga0501047_0156998 | Ga0501047_0156998_1119_2078 | 319 |
| 733 | 3300049581 | Ga0501047_0472836 | Ga0501047_0472836_50_1009 | 319 |
| 734 | 3300049585 | Ga0501069_0010183 | Ga0501069_0010183_2503_3462 | 319 |
| 735 | 3300049585 | Ga0501069_0011329 | Ga0501069_0011329_2050_3009 | 319 |
| 736 | 3300049585 | Ga0501069_0050211 | Ga0501069_0050211_299_1258 | 319 |
| 737 | 3300049586 | Ga0501070_0000711 | Ga0501070_0000711_21598_22557 | 319 |
| 738 | 3300049586 | Ga0501070_0027953 | Ga0501070_0027953_2430_3389 | 319 |
| 739 | 3300049586 | Ga0501070_0039662 | Ga0501070_0039662_1897_2859 | 319 |
| 740 | 3300049586 | Ga0501070_0062742 | Ga0501070_0062742_2057_3016 | 319 |
| 741 | 3300049586 | Ga0501070_0074935 | Ga0501070_0074935_513_1472 | 319 |
| 742 | 3300049587 | Ga0501071_0040292 | Ga0501071_0040292_1395_2357 | 319 |
| 743 | 3300049589 | Ga0501073_0075486 | Ga0501073_0075486_1078_2040 | 319 |
| 744 | 3300049741 | Ga0501079_0253819 | Ga0501079_0253819_60_1022 | 319 |
| 745 | 3300049742 | Ga0501080_0170176 | Ga0501080_0170176_914_1876 | 319 |
| 746 | 3300049744 | Ga0501083_0077357 | Ga0501083_0077357_220_1179 | 319 |
| 747 | 3300049822 | Ga0501035_0000703 | Ga0501035_0000703_4662_5621 | 319 |
| 748 | 3300049822 | Ga0501035_0054522 | Ga0501035_0054522_1798_2757 | 319 |
| 749 | 3300049822 | Ga0501035_0089270 | Ga0501035_0089270_1159_2118 | 319 |
| 750 | 3300050494 | nmdc:mga06z11_7241_c1 | nmdc:mga06z11_7241_c1_1670_2629 | 319 |
| 751 | 3300050507 | nmdc:mga05p37_66_c1 | nmdc:mga05p37_66_c1_69478_70437 | 319 |
| 752 | 3300050507 | nmdc:mga05p37_7273_c1 | nmdc:mga05p37_7273_c1_1305_2264 | 319 |
| 753 | 3300050508 | nmdc:mga09592_1181_c1 | nmdc:mga09592_1181_c1_1419_2378 | 319 |
| 754 | 3300050509 | nmdc:mga0qj67_341_c1 | nmdc:mga0qj67_341_c1_20224_21183 | 319 |
| 755 | 3300050510 | nmdc:mga06r32_404_c1 | nmdc:mga06r32_404_c1_19551_20510 | 319 |
| 756 | 3300050511 | nmdc:mga08y16_615_c1 | nmdc:mga08y16_615_c1_20224_21183 | 319 |
| 757 | 3300050512 | nmdc:mga0n895_134690_c1 | nmdc:mga0n895_134690_c1_578_1537 | 319 |
| 758 | 3300050512 | nmdc:mga0n895_14593_c1 | nmdc:mga0n895_14593_c1_399_1358 | 319 |
| 759 | 3300050512 | nmdc:mga0n895_186795_c1 | nmdc:mga0n895_186795_c1_635_1594 | 319 |
| 760 | 3300050512 | nmdc:mga0n895_43_c1 | nmdc:mga0n895_43_c1_3950_4909 | 319 |
| 761 | 3300050512 | nmdc:mga0n895_58568_c1 | nmdc:mga0n895_58568_c1_112_1071 | 319 |
| 762 | 3300050513 | nmdc:mga0rr50_11111_c1 | nmdc:mga0rr50_11111_c1_1316_2275 | 319 |
| 763 | 3300050513 | nmdc:mga0rr50_18578_c1 | nmdc:mga0rr50_18578_c1_1571_2530 | 319 |
| 764 | 3300050513 | nmdc:mga0rr50_3991_c1 | nmdc:mga0rr50_3991_c1_4273_5232 | 319 |
| 765 | 3300050513 | nmdc:mga0rr50_8186_c1 | nmdc:mga0rr50_8186_c1_2698_3657 | 319 |
| 766 | 3300050514 | nmdc:mga08x19_288301_c1 | nmdc:mga08x19_288301_c1_49_1008 | 319 |
| 767 | 3300050515 | nmdc:mga0a205_194120_c1 | nmdc:mga0a205_194120_c1_153_1112 | 319 |
| 768 | 3300050515 | nmdc:mga0a205_41845_c1 | nmdc:mga0a205_41845_c1_3131_4090 | 319 |
| 769 | 3300050515 | nmdc:mga0a205_59009_c1 | nmdc:mga0a205_59009_c1_2499_3458 | 319 |
| 770 | 3300050515 | nmdc:mga0a205_89831_c1 | nmdc:mga0a205_89831_c1_998_1957 | 319 |
| 771 | 3300053077 | Ga0495601_0007271 | Ga0495601_0007271_5166_6128 | 319 |
| 772 | 3300053077 | Ga0495601_0052763 | Ga0495601_0052763_348_1307 | 319 |
| 773 | 3300053077 | Ga0495601_0271790 | Ga0495601_0271790_133_1092 | 319 |
| 774 | 3300053078 | Ga0495612_0056313 | Ga0495612_0056313_266_1228 | 319 |
| 775 | 3300053084 | Ga0495595_0019721 | Ga0495595_0019721_636_1598 | 319 |
| 776 | 3300053084 | Ga0495595_0023779 | Ga0495595_0023779_1064_2023 | 319 |
| 777 | 3300053085 | Ga0495619_0000388 | Ga0495619_0000388_18738_19697 | 319 |
| 778 | 3300053085 | Ga0495619_0013931 | Ga0495619_0013931_2732_3694 | 319 |
| 779 | 3300053087 | Ga0500643_005338 | Ga0500643_005338_886_1845 | 319 |
| 780 | 3300053088 | Ga0500644_0000570 | Ga0500644_0000570_9217_10176 | 319 |
| 781 | 3300053094 | Ga0500566_0027276 | Ga0500566_0027276_777_1736 | 319 |
| 782 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_996310_997269 | 319 |
| 783 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1106904_1107863 | 319 |
| 784 | 3300053730 | Ga0500645_000156 | Ga0500645_000156_7916_8875 | 319 |
| 785 | 3300054114 | Ga0501084_0043312 | Ga0501084_0043312_704_1666 | 319 |
| 786 | 3300054114 | Ga0501084_0229438 | Ga0501084_0229438_355_1317 | 319 |
| 787 | 3300060353 | Ga0501082_0177158 | Ga0501082_0177158_221_1180 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5n5e-assembly1.cif.gz_e | crystal structure of encapsulated ferritin domain from pyrococcus furiosus pfc_05175 | 0.9936 | 97 | 148 |
| 7s5c-assembly1.cif.gz_F | m. xanthus ferritin-like protein encb | 0.9618 | 97 | 148 |
| 7s5c-assembly1.cif.gz_J | m. xanthus ferritin-like protein encb | 0.9587 | 97 | 148 |
| 6suw-assembly3.cif.gz_V | crystal structure of rhodospirillum rubrum rru_a0973 e31a variant | 0.9045 | 91 | 148 |
| 5l89-assembly3.cif.gz_c | crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a | 0.9039 | 91 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5l89W00 | Special;Helix non-globular;Helix Hairpins; | 0.9048 | 91 | 148 | 6.10.140.1960 |
| 5l89c00 | Special;Helix non-globular;Helix Hairpins; | 0.9039 | 91 | 148 | 6.10.140.1960 |
| 3k6cB00 | Special;Helix non-globular;Helix Hairpins; | 0.9029 | 98 | 150 | 6.10.140.1960 |
| 5l8bP00 | Special;Helix non-globular;Helix Hairpins; | 0.9021 | 91 | 148 | 6.10.140.1960 |
| 5l8bd00 | Special;Helix non-globular;Helix Hairpins; | 0.9002 | 91 | 148 | 6.10.140.1960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529NKI1-F1-model_v4 | Rubrerythrin family protein | 0.9981 | 2 | 81 |
GO:0016491
GO:0046872 |
| AF-A0A7W0ML71-F1-model_v4 | Rubrerythrin family protein | 0.992 | 2 | 144 |
GO:0016491
GO:0046872 |
| AF-A0A529U558-F1-model_v4 | deleted | 0.9913 | 2 | 107 |
|
| AF-X1CHA1-F1-model_v4 | Rubrerythrin diiron-binding domain-containing protein | 0.9861 | 2 | 86 |
GO:0016491
GO:0046872 |
| AF-A0A2V9ZKR0-F1-model_v4 | Rubrerythrin | 0.985 | 2 | 87 |
GO:0016491
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar