F480783
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 786 | 328 | 787 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_12224878|Ga0105249_122248782 |
| Length | 121 |
| Sequence | LRDQFQNFPGPNGQFQNFKIKKMKLSDVLIKPILSEKANAQQDKLRRFAFKVARKANKLEIKKAVEEFYGVNVVDVNTTVVPGKNKTRFTKAGFISGQKPGYKKAFVTVAEGETIDLYANV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 7 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 206 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 207 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 215 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 216 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 219 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 220 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 221 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 222 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 223 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 224 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 225 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 226 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 227 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 228 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 229 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 230 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 231 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 232 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 233 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 234 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 235 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 318 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 319 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 320 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 323 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 324 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 325 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.07 |
| Metatranscriptomes | 2.93 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.29 |
| Nodule | 0 |
| Rhizoplane | 2.93 |
| Rhizosphere | 92.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001390 | 3300002459 | Bacteria | 5082 |
| 2 | rootH1_10008428 | 3300003316 | Bacteria | 1574 |
| 3 | rootH1_10008428 | 3300003323 | Bacteria | 3403 |
| 4 | rootH1_10137063 | 3300003316 | Bacteria | 1655 |
| 5 | rootH2_10022358 | 3300003320 | Bacteria | 1611 |
| 6 | rootL2_10149151 | 3300003322 | Bacteria | 1647 |
| 7 | rootH1_10083104 | 3300003323 | Bacteria | 3052 |
| 8 | Ga0058859_11572014 | 3300004798 | Bacteria | 1268 |
| 9 | Ga0058860_12028199 | 3300004801 | Unclassified | 684 |
| 10 | Ga0058860_12218397 | 3300004801 | Bacteria | 879 |
| 11 | Ga0065716_1019128 | 3300005277 | Unclassified | 519 |
| 12 | Ga0065714_10176271 | 3300005288 | Bacteria | 982 |
| 13 | Ga0065714_10177684 | 3300005288 | Bacteria | 929 |
| 14 | Ga0065704_10233298 | 3300005289 | Bacteria | 1036 |
| 15 | Ga0065704_10358180 | 3300005289 | Bacteria | 801 |
| 16 | Ga0065712_10010764 | 3300005290 | Bacteria | 1916 |
| 17 | Ga0065712_10020318 | 3300005290 | Bacteria | 1543 |
| 18 | Ga0065712_10181032 | 3300005290 | Bacteria | 1176 |
| 19 | Ga0065715_10474826 | 3300005293 | Bacteria | 798 |
| 20 | Ga0065707_10333640 | 3300005295 | Bacteria | 945 |
| 21 | Ga0070658_10430094 | 3300005327 | Bacteria | 1136 |
| 22 | Ga0070658_11652234 | 3300005327 | Bacteria | 555 |
| 23 | Ga0070676_10080339 | 3300005328 | Bacteria | 1976 |
| 24 | Ga0070676_10152918 | 3300005328 | Bacteria | 1479 |
| 25 | Ga0070676_10983853 | 3300005328 | Unclassified | 632 |
| 26 | Ga0070676_11173912 | 3300005328 | Bacteria | 582 |
| 27 | Ga0070683_100012473 | 3300005329 | Bacteria | 7386 |
| 28 | Ga0070683_100013707 | 3300005329 | Bacteria | 7078 |
| 29 | Ga0070690_100012030 | 3300005330 | Bacteria | 5079 |
| 30 | Ga0070690_100241897 | 3300005330 | Bacteria | 1273 |
| 31 | Ga0070690_100271982 | 3300005330 | Bacteria | 1205 |
| 32 | Ga0070690_100608450 | 3300005330 | Bacteria | 830 |
| 33 | Ga0070670_100158102 | 3300005331 | Bacteria | 1963 |
| 34 | Ga0070670_100296962 | 3300005331 | Bacteria | 1412 |
| 35 | Ga0070670_100405561 | 3300005331 | Bacteria | 1204 |
| 36 | Ga0070677_10044332 | 3300005333 | Bacteria | 1769 |
| 37 | Ga0070677_10295001 | 3300005333 | Bacteria | 822 |
| 38 | Ga0070677_10329637 | 3300005333 | Bacteria | 784 |
| 39 | Ga0068869_100017755 | 3300005334 | Bacteria | 4832 |
| 40 | Ga0068869_100164027 | 3300005334 | Bacteria | 1731 |
| 41 | Ga0068869_100186493 | 3300005334 | Unclassified | 1629 |
| 42 | Ga0068869_100635703 | 3300005334 | Bacteria | 905 |
| 43 | Ga0068869_100885241 | 3300005334 | Bacteria | 772 |
| 44 | Ga0068869_101329351 | 3300005334 | Bacteria | 635 |
| 45 | Ga0070666_10047180 | 3300005335 | Bacteria | 2891 |
| 46 | Ga0070682_100000039 | 3300005337 | Bacteria | 144400 |
| 47 | Ga0070682_100054491 | 3300005337 | Bacteria | 2509 |
| 48 | Ga0070682_100066166 | 3300005337 | Bacteria | 2299 |
| 49 | Ga0070682_100774566 | 3300005337 | Bacteria | 777 |
| 50 | Ga0070682_101451664 | 3300005337 | Unclassified | 588 |
| 51 | Ga0068868_100017514 | 3300005338 | Bacteria | 5340 |
| 52 | Ga0068868_100123647 | 3300005338 | Bacteria | 2111 |
| 53 | Ga0068868_100425091 | 3300005338 | Bacteria | 1151 |
| 54 | Ga0068868_100595145 | 3300005338 | Bacteria | 979 |
| 55 | Ga0070660_100979665 | 3300005339 | Unclassified | 714 |
| 56 | Ga0070689_101381644 | 3300005340 | Unclassified | 636 |
| 57 | Ga0070687_100128780 | 3300005343 | Bacteria | 1458 |
| 58 | Ga0070687_101437085 | 3300005343 | Bacteria | 517 |
| 59 | Ga0070687_101482004 | 3300005343 | Unclassified | 510 |
| 60 | Ga0070661_100401046 | 3300005344 | Bacteria | 1084 |
| 61 | Ga0070661_101094601 | 3300005344 | Bacteria | 664 |
| 62 | Ga0070668_100050126 | 3300005347 | Bacteria | 3214 |
| 63 | Ga0070668_100155369 | 3300005347 | Bacteria | 1853 |
| 64 | Ga0070669_100164458 | 3300005353 | Bacteria | 1726 |
| 65 | Ga0070669_100264468 | 3300005353 | Unclassified | 1374 |
| 66 | Ga0070669_100724776 | 3300005353 | Bacteria | 841 |
| 67 | Ga0070669_100771408 | 3300005353 | Bacteria | 816 |
| 68 | Ga0070669_100999050 | 3300005353 | Bacteria | 718 |
| 69 | Ga0070675_100304522 | 3300005354 | Bacteria | 1405 |
| 70 | Ga0070675_100348087 | 3300005354 | Bacteria | 1314 |
| 71 | Ga0070675_101352475 | 3300005354 | Bacteria | 656 |
| 72 | Ga0070671_100027874 | 3300005355 | Bacteria | 4650 |
| 73 | Ga0070671_100059066 | 3300005355 | Bacteria | 3191 |
| 74 | Ga0070671_100524570 | 3300005355 | Bacteria | 1020 |
| 75 | Ga0070671_100739459 | 3300005355 | Bacteria | 854 |
| 76 | Ga0070671_101113529 | 3300005355 | Bacteria | 694 |
| 77 | Ga0070674_100816159 | 3300005356 | Unclassified | 806 |
| 78 | Ga0070673_100030215 | 3300005364 | Bacteria | 4050 |
| 79 | Ga0070673_100373624 | 3300005364 | Bacteria | 1270 |
| 80 | Ga0070673_100782635 | 3300005364 | Bacteria | 880 |
| 81 | Ga0070673_100908377 | 3300005364 | Unclassified | 817 |
| 82 | Ga0070673_101586386 | 3300005364 | Bacteria | 618 |
| 83 | Ga0070673_102274756 | 3300005364 | Bacteria | 515 |
| 84 | Ga0070688_100496873 | 3300005365 | Bacteria | 919 |
| 85 | Ga0070659_100010418 | 3300005366 | Bacteria | 6838 |
| 86 | Ga0070659_100293641 | 3300005366 | Bacteria | 1354 |
| 87 | Ga0070667_100162213 | 3300005367 | Bacteria | 1969 |
| 88 | Ga0070667_100187787 | 3300005367 | Bacteria | 1830 |
| 89 | Ga0070667_100367061 | 3300005367 | Bacteria | 1305 |
| 90 | Ga0070667_100446979 | 3300005367 | Bacteria | 1181 |
| 91 | Ga0070667_100497691 | 3300005367 | Bacteria | 1117 |
| 92 | Ga0070667_101994815 | 3300005367 | Bacteria | 547 |
| 93 | Ga0070667_102150443 | 3300005367 | Unclassified | 526 |
| 94 | Ga0070667_102341496 | 3300005367 | Bacteria | 503 |
| 95 | Ga0070701_10030686 | 3300005438 | Bacteria | 2661 |
| 96 | Ga0070700_100400731 | 3300005441 | Bacteria | 1031 |
| 97 | Ga0070700_101288740 | 3300005441 | Bacteria | 613 |
| 98 | Ga0070694_100152300 | 3300005444 | Bacteria | 1690 |
| 99 | Ga0070663_100824540 | 3300005455 | Bacteria | 797 |
| 100 | Ga0070678_100124839 | 3300005456 | Bacteria | 2036 |
| 101 | Ga0070678_100197824 | 3300005456 | Bacteria | 1657 |
| 102 | Ga0070678_100310570 | 3300005456 | Bacteria | 1343 |
| 103 | Ga0070678_100397012 | 3300005456 | Bacteria | 1197 |
| 104 | Ga0070678_101138746 | 3300005456 | Bacteria | 722 |
| 105 | Ga0070678_101813579 | 3300005456 | Bacteria | 575 |
| 106 | Ga0070662_100044485 | 3300005457 | Bacteria | 3180 |
| 107 | Ga0068867_100011408 | 3300005459 | Bacteria | 6270 |
| 108 | Ga0068867_100031243 | 3300005459 | Bacteria | 3843 |
| 109 | Ga0068867_100218385 | 3300005459 | Bacteria | 1535 |
| 110 | Ga0068867_100461505 | 3300005459 | Bacteria | 1084 |
| 111 | Ga0068867_100843120 | 3300005459 | Bacteria | 821 |
| 112 | Ga0068867_101068658 | 3300005459 | Bacteria | 735 |
| 113 | Ga0068867_101090094 | 3300005459 | Bacteria | 729 |
| 114 | Ga0070685_10075150 | 3300005466 | Bacteria | 2012 |
| 115 | Ga0070685_10108040 | 3300005466 | Bacteria | 1709 |
| 116 | Ga0070698_100002339 | 3300005471 | Bacteria | 20947 |
| 117 | Ga0070698_100002802 | 3300005471 | Bacteria | 19186 |
| 118 | Ga0070698_100021125 | 3300005471 | Bacteria | 6820 |
| 119 | Ga0070698_100241874 | 3300005471 | Bacteria | 1738 |
| 120 | Ga0070684_100050088 | 3300005535 | Bacteria | 3627 |
| 121 | Ga0070684_100069741 | 3300005535 | Bacteria | 3091 |
| 122 | Ga0070684_101742365 | 3300005535 | Bacteria | 588 |
| 123 | Ga0068853_100013022 | 3300005539 | Bacteria | 6782 |
| 124 | Ga0068853_100021938 | 3300005539 | Bacteria | 5326 |
| 125 | Ga0068853_100053834 | 3300005539 | Bacteria | 3466 |
| 126 | Ga0068853_100177645 | 3300005539 | Bacteria | 1930 |
| 127 | Ga0068853_100187386 | 3300005539 | Bacteria | 1878 |
| 128 | Ga0068853_100672055 | 3300005539 | Unclassified | 987 |
| 129 | Ga0068853_101262350 | 3300005539 | Bacteria | 714 |
| 130 | Ga0068853_101423282 | 3300005539 | Bacteria | 671 |
| 131 | Ga0070672_100140535 | 3300005543 | Bacteria | 1991 |
| 132 | Ga0070672_100268088 | 3300005543 | Bacteria | 1441 |
| 133 | Ga0070672_101033833 | 3300005543 | Bacteria | 729 |
| 134 | Ga0070672_101073298 | 3300005543 | Unclassified | 715 |
| 135 | Ga0070672_101368455 | 3300005543 | Bacteria | 633 |
| 136 | Ga0070686_100131761 | 3300005544 | Bacteria | 1730 |
| 137 | Ga0070686_100339360 | 3300005544 | Bacteria | 1125 |
| 138 | Ga0070695_100328010 | 3300005545 | Unclassified | 1140 |
| 139 | Ga0070665_101230939 | 3300005548 | Bacteria | 759 |
| 140 | Ga0070665_101676357 | 3300005548 | Bacteria | 643 |
| 141 | Ga0070665_102105013 | 3300005548 | Bacteria | 569 |
| 142 | Ga0070704_100100614 | 3300005549 | Bacteria | 2177 |
| 143 | Ga0068855_100000133 | 3300005563 | Bacteria | 94906 |
| 144 | Ga0068855_100161856 | 3300005563 | Bacteria | 2539 |
| 145 | Ga0068855_101205999 | 3300005563 | Bacteria | 787 |
| 146 | Ga0068855_101297998 | 3300005563 | Bacteria | 753 |
| 147 | Ga0070664_100041775 | 3300005564 | Bacteria | 3870 |
| 148 | Ga0070664_101314925 | 3300005564 | Bacteria | 683 |
| 149 | Ga0068857_100018409 | 3300005577 | Bacteria | 6129 |
| 150 | Ga0068857_100049652 | 3300005577 | Bacteria | 3722 |
| 151 | Ga0068857_100085136 | 3300005577 | Bacteria | 2825 |
| 152 | Ga0068857_100200825 | 3300005577 | Bacteria | 1817 |
| 153 | Ga0068857_100410529 | 3300005577 | Bacteria | 1261 |
| 154 | Ga0068857_101296490 | 3300005577 | Bacteria | 707 |
| 155 | Ga0068854_100142005 | 3300005578 | Bacteria | 1844 |
| 156 | Ga0068854_100203791 | 3300005578 | Bacteria | 1557 |
| 157 | Ga0068854_100261616 | 3300005578 | Bacteria | 1385 |
| 158 | Ga0068854_101028985 | 3300005578 | Bacteria | 730 |
| 159 | Ga0068856_100324230 | 3300005614 | Bacteria | 1558 |
| 160 | Ga0068856_102538049 | 3300005614 | Bacteria | 519 |
| 161 | Ga0070702_100049731 | 3300005615 | Bacteria | 2392 |
| 162 | Ga0070702_101226973 | 3300005615 | Unclassified | 606 |
| 163 | Ga0068852_100001842 | 3300005616 | Bacteria | 14407 |
| 164 | Ga0068852_100054084 | 3300005616 | Bacteria | 3459 |
| 165 | Ga0068852_100399528 | 3300005616 | Unclassified | 1352 |
| 166 | Ga0068852_100541074 | 3300005616 | Bacteria | 1164 |
| 167 | Ga0068852_100548083 | 3300005616 | Bacteria | 1157 |
| 168 | Ga0068852_100770817 | 3300005616 | Unclassified | 975 |
| 169 | Ga0068859_100000536 | 3300005617 | Bacteria | 37574 |
| 170 | Ga0068859_100224760 | 3300005617 | Bacteria | 1965 |
| 171 | Ga0068859_100378987 | 3300005617 | Unclassified | 1510 |
| 172 | Ga0068859_101038780 | 3300005617 | Bacteria | 900 |
| 173 | Ga0068859_101113972 | 3300005617 | Bacteria | 868 |
| 174 | Ga0068859_101363145 | 3300005617 | Bacteria | 782 |
| 175 | Ga0068859_102320201 | 3300005617 | Bacteria | 592 |
| 176 | Ga0068864_100078002 | 3300005618 | Bacteria | 2898 |
| 177 | Ga0068864_100107079 | 3300005618 | Bacteria | 2486 |
| 178 | Ga0068864_100700002 | 3300005618 | Unclassified | 990 |
| 179 | Ga0068864_100774454 | 3300005618 | Bacteria | 941 |
| 180 | Ga0068864_101231108 | 3300005618 | Bacteria | 748 |
| 181 | Ga0068864_101277046 | 3300005618 | Unclassified | 734 |
| 182 | Ga0068864_101578938 | 3300005618 | Unclassified | 660 |
| 183 | Ga0068866_10167116 | 3300005718 | Bacteria | 1288 |
| 184 | Ga0068866_10244880 | 3300005718 | Bacteria | 1094 |
| 185 | Ga0068866_10804666 | 3300005718 | Bacteria | 654 |
| 186 | Ga0068861_100134738 | 3300005719 | Bacteria | 2009 |
| 187 | Ga0068861_100209084 | 3300005719 | Bacteria | 1642 |
| 188 | Ga0068861_100261089 | 3300005719 | Bacteria | 1483 |
| 189 | Ga0068861_100272552 | 3300005719 | Bacteria | 1454 |
| 190 | Ga0068861_100297679 | 3300005719 | Bacteria | 1396 |
| 191 | Ga0068861_100609875 | 3300005719 | Bacteria | 1003 |
| 192 | Ga0068861_101741185 | 3300005719 | Bacteria | 617 |
| 193 | Ga0068861_102418491 | 3300005719 | Bacteria | 528 |
| 194 | Ga0068851_10309859 | 3300005834 | Bacteria | 909 |
| 195 | Ga0068851_11042207 | 3300005834 | Bacteria | 517 |
| 196 | Ga0068870_10172613 | 3300005840 | Bacteria | 1291 |
| 197 | Ga0068870_10681471 | 3300005840 | Bacteria | 707 |
| 198 | Ga0068863_100098427 | 3300005841 | Bacteria | 2778 |
| 199 | Ga0068863_100114726 | 3300005841 | Bacteria | 2566 |
| 200 | Ga0068863_100410048 | 3300005841 | Bacteria | 1326 |
| 201 | Ga0068863_101278366 | 3300005841 | Bacteria | 740 |
| 202 | Ga0068863_102614408 | 3300005841 | Bacteria | 514 |
| 203 | Ga0068858_100109140 | 3300005842 | Bacteria | 2583 |
| 204 | Ga0068858_101055247 | 3300005842 | Bacteria | 797 |
| 205 | Ga0068858_101414979 | 3300005842 | Unclassified | 685 |
| 206 | Ga0068860_100010482 | 3300005843 | Bacteria | 9162 |
| 207 | Ga0068860_100173927 | 3300005843 | Bacteria | 2081 |
| 208 | Ga0068860_100280646 | 3300005843 | Bacteria | 1628 |
| 209 | Ga0068860_100788115 | 3300005843 | Bacteria | 963 |
| 210 | Ga0068860_100793324 | 3300005843 | Bacteria | 960 |
| 211 | Ga0068860_100916554 | 3300005843 | Bacteria | 893 |
| 212 | Ga0068860_102626909 | 3300005843 | Bacteria | 523 |
| 213 | Ga0068860_102799295 | 3300005843 | Bacteria | 506 |
| 214 | Ga0068862_100032080 | 3300005844 | Bacteria | 4438 |
| 215 | Ga0068862_100714805 | 3300005844 | Bacteria | 971 |
| 216 | Ga0068862_101540653 | 3300005844 | Bacteria | 671 |
| 217 | Ga0075432_10114297 | 3300006058 | Unclassified | 1009 |
| 218 | Ga0070715_10041724 | 3300006163 | Bacteria | 1924 |
| 219 | Ga0070715_10073647 | 3300006163 | Bacteria | 1532 |
| 220 | Ga0070715_10127624 | 3300006163 | Bacteria | 1220 |
| 221 | Ga0075366_10082945 | 3300006195 | Bacteria | 1915 |
| 222 | Ga0075366_10508980 | 3300006195 | Unclassified | 744 |
| 223 | Ga0097621_100003401 | 3300006237 | Bacteria | 10956 |
| 224 | Ga0097621_100036790 | 3300006237 | Bacteria | 3917 |
| 225 | Ga0097621_100050215 | 3300006237 | Bacteria | 3391 |
| 226 | Ga0097621_100410740 | 3300006237 | Bacteria | 1213 |
| 227 | Ga0097621_100422407 | 3300006237 | Bacteria | 1197 |
| 228 | Ga0097621_100537595 | 3300006237 | Bacteria | 1062 |
| 229 | Ga0097621_100680226 | 3300006237 | Bacteria | 946 |
| 230 | Ga0075370_10173219 | 3300006353 | Bacteria | 1269 |
| 231 | Ga0075370_10537878 | 3300006353 | Unclassified | 706 |
| 232 | Ga0075370_10824576 | 3300006353 | Bacteria | 566 |
| 233 | Ga0068871_100000955 | 3300006358 | Bacteria | 19316 |
| 234 | Ga0068871_100108578 | 3300006358 | Bacteria | 2332 |
| 235 | Ga0068871_100134279 | 3300006358 | Bacteria | 2100 |
| 236 | Ga0068871_101138415 | 3300006358 | Bacteria | 730 |
| 237 | Ga0068871_101638411 | 3300006358 | Bacteria | 609 |
| 238 | Ga0068871_101751436 | 3300006358 | Bacteria | 590 |
| 239 | Ga0075428_100029189 | 3300006844 | Bacteria | 6103 |
| 240 | Ga0075428_100044984 | 3300006844 | Bacteria | 4851 |
| 241 | Ga0075428_100527725 | 3300006844 | Bacteria | 1262 |
| 242 | Ga0075428_101374511 | 3300006844 | Bacteria | 741 |
| 243 | Ga0075431_100019798 | 3300006847 | Bacteria | 6870 |
| 244 | Ga0075431_101149999 | 3300006847 | Bacteria | 740 |
| 245 | Ga0075434_100562446 | 3300006871 | Unclassified | 1160 |
| 246 | Ga0075434_101019333 | 3300006871 | Bacteria | 842 |
| 247 | Ga0075429_100003790 | 3300006880 | Bacteria | 12900 |
| 248 | Ga0075429_100060787 | 3300006880 | Bacteria | 3290 |
| 249 | Ga0075429_100874597 | 3300006880 | Bacteria | 787 |
| 250 | Ga0075429_100912786 | 3300006880 | Bacteria | 768 |
| 251 | Ga0068865_100093466 | 3300006881 | Bacteria | 2187 |
| 252 | Ga0068865_100114198 | 3300006881 | Bacteria | 1997 |
| 253 | Ga0068865_100507273 | 3300006881 | Bacteria | 1007 |
| 254 | Ga0068865_100704319 | 3300006881 | Bacteria | 863 |
| 255 | Ga0068865_100729034 | 3300006881 | Unclassified | 849 |
| 256 | Ga0068865_100782855 | 3300006881 | Bacteria | 822 |
| 257 | Ga0097620_100000536 | 3300006931 | Bacteria | 37574 |
| 258 | Ga0097620_100224745 | 3300006931 | Bacteria | 1965 |
| 259 | Ga0097620_100379009 | 3300006931 | Unclassified | 1510 |
| 260 | Ga0097620_101038841 | 3300006931 | Bacteria | 900 |
| 261 | Ga0097620_101113995 | 3300006931 | Bacteria | 868 |
| 262 | Ga0097620_101363753 | 3300006931 | Bacteria | 782 |
| 263 | Ga0097620_102320234 | 3300006931 | Bacteria | 592 |
| 264 | Ga0105240_10000398 | 3300009093 | Bacteria | 81045 |
| 265 | Ga0105240_10173346 | 3300009093 | Bacteria | 2552 |
| 266 | Ga0105240_10283628 | 3300009093 | Bacteria | 1902 |
| 267 | Ga0105240_10350445 | 3300009093 | Bacteria | 1675 |
| 268 | Ga0105240_10386714 | 3300009093 | Bacteria | 1579 |
| 269 | Ga0111539_10667745 | 3300009094 | Bacteria | 1210 |
| 270 | Ga0111539_10990779 | 3300009094 | Unclassified | 977 |
| 271 | Ga0105245_10068029 | 3300009098 | Bacteria | 3226 |
| 272 | Ga0105245_10901803 | 3300009098 | Bacteria | 926 |
| 273 | Ga0105247_10002304 | 3300009101 | Bacteria | 13045 |
| 274 | Ga0105247_10204681 | 3300009101 | Bacteria | 1328 |
| 275 | Ga0105247_11197407 | 3300009101 | Bacteria | 605 |
| 276 | Ga0105247_11490134 | 3300009101 | Bacteria | 551 |
| 277 | Ga0114129_10303837 | 3300009147 | Bacteria | 2126 |
| 278 | Ga0105243_10711600 | 3300009148 | Unclassified | 980 |
| 279 | Ga0105243_11307499 | 3300009148 | Bacteria | 742 |
| 280 | Ga0105243_11603262 | 3300009148 | Bacteria | 677 |
| 281 | Ga0105243_12456353 | 3300009148 | Bacteria | 560 |
| 282 | Ga0105241_10409198 | 3300009174 | Unclassified | 1192 |
| 283 | Ga0105241_10443550 | 3300009174 | Bacteria | 1147 |
| 284 | Ga0105242_10055628 | 3300009176 | Bacteria | 3237 |
| 285 | Ga0105242_10102158 | 3300009176 | Bacteria | 2431 |
| 286 | Ga0105242_10134109 | 3300009176 | Bacteria | 2141 |
| 287 | Ga0105242_10336272 | 3300009176 | Bacteria | 1390 |
| 288 | Ga0105242_10515400 | 3300009176 | Bacteria | 1140 |
| 289 | Ga0105242_10522285 | 3300009176 | Bacteria | 1133 |
| 290 | Ga0105242_10634254 | 3300009176 | Bacteria | 1037 |
| 291 | Ga0105242_10815531 | 3300009176 | Bacteria | 925 |
| 292 | Ga0105242_10912916 | 3300009176 | Bacteria | 879 |
| 293 | Ga0105242_11229804 | 3300009176 | Bacteria | 769 |
| 294 | Ga0105242_11444208 | 3300009176 | Bacteria | 717 |
| 295 | Ga0105248_10052937 | 3300009177 | Bacteria | 4555 |
| 296 | Ga0105237_10018987 | 3300009545 | Bacteria | 7105 |
| 297 | Ga0105237_10342700 | 3300009545 | Bacteria | 1499 |
| 298 | Ga0105237_12443590 | 3300009545 | Unclassified | 533 |
| 299 | Ga0105238_11080276 | 3300009551 | Unclassified | 825 |
| 300 | Ga0105238_11200524 | 3300009551 | Bacteria | 783 |
| 301 | Ga0105238_11941973 | 3300009551 | Bacteria | 622 |
| 302 | Ga0105249_10000806 | 3300009553 | Bacteria | 28220 |
| 303 | Ga0105249_10025715 | 3300009553 | Bacteria | 5302 |
| 304 | Ga0105249_10053538 | 3300009553 | Bacteria | 3689 |
| 305 | Ga0105249_10075766 | 3300009553 | Bacteria | 3116 |
| 306 | Ga0105249_10077951 | 3300009553 | Bacteria | 3074 |
| 307 | Ga0105249_10308059 | 3300009553 | Bacteria | 1591 |
| 308 | Ga0105249_10500048 | 3300009553 | Bacteria | 1261 |
| 309 | Ga0105249_11267198 | 3300009553 | Unclassified | 809 |
| 310 | Ga0105249_11603973 | 3300009553 | Bacteria | 723 |
| 311 | Ga0105249_11961295 | 3300009553 | Bacteria | 658 |
| 312 | Ga0105249_12224878 | 3300009553 | Bacteria | 621 |
| 313 | Ga0105239_10188341 | 3300010375 | Bacteria | 2310 |
| 314 | Ga0105239_10444888 | 3300010375 | Bacteria | 1470 |
| 315 | Ga0105239_12305401 | 3300010375 | Bacteria | 626 |
| 316 | Ga0105246_10290685 | 3300011119 | Bacteria | 1315 |
| 317 | Ga0105246_11464053 | 3300011119 | Bacteria | 640 |
| 318 | Ga0105246_12047322 | 3300011119 | Bacteria | 553 |
| 319 | Ga0157373_10041402 | 3300013100 | Bacteria | 3295 |
| 320 | Ga0157373_10175037 | 3300013100 | Bacteria | 1510 |
| 321 | Ga0157371_10036963 | 3300013102 | Bacteria | 3497 |
| 322 | Ga0157371_10043957 | 3300013102 | Bacteria | 3182 |
| 323 | Ga0157370_10011345 | 3300013104 | Bacteria | 9332 |
| 324 | Ga0157370_10017050 | 3300013104 | Bacteria | 7340 |
| 325 | Ga0157370_10022725 | 3300013104 | Bacteria | 6240 |
| 326 | Ga0157370_10146677 | 3300013104 | Bacteria | 2197 |
| 327 | Ga0157370_10565943 | 3300013104 | Unclassified | 1041 |
| 328 | Ga0157369_10063647 | 3300013105 | Bacteria | 3973 |
| 329 | Ga0157369_10100758 | 3300013105 | Bacteria | 3079 |
| 330 | Ga0157369_10548844 | 3300013105 | Bacteria | 1194 |
| 331 | Ga0157369_12193327 | 3300013105 | Bacteria | 560 |
| 332 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 333 | Ga0157374_10418497 | 3300013296 | Bacteria | 1338 |
| 334 | Ga0157374_11124223 | 3300013296 | Bacteria | 806 |
| 335 | Ga0157374_11268781 | 3300013296 | Bacteria | 758 |
| 336 | Ga0157374_11708945 | 3300013296 | Bacteria | 654 |
| 337 | Ga0157378_10012000 | 3300013297 | Bacteria | 7586 |
| 338 | Ga0157378_10025313 | 3300013297 | Bacteria | 5226 |
| 339 | Ga0157378_10079785 | 3300013297 | Bacteria | 2955 |
| 340 | Ga0157378_10292781 | 3300013297 | Unclassified | 1573 |
| 341 | Ga0157378_10538693 | 3300013297 | Bacteria | 1171 |
| 342 | Ga0157378_10580476 | 3300013297 | Bacteria | 1130 |
| 343 | Ga0157378_11227888 | 3300013297 | Bacteria | 789 |
| 344 | Ga0157378_12243419 | 3300013297 | Bacteria | 597 |
| 345 | Ga0163162_10022373 | 3300013306 | Bacteria | 6230 |
| 346 | Ga0163162_10024199 | 3300013306 | Bacteria | 5993 |
| 347 | Ga0163162_10299937 | 3300013306 | Bacteria | 1739 |
| 348 | Ga0163162_10350615 | 3300013306 | Bacteria | 1609 |
| 349 | Ga0163162_12140365 | 3300013306 | Bacteria | 642 |
| 350 | Ga0157372_10016644 | 3300013307 | Bacteria | 7892 |
| 351 | Ga0157372_10051126 | 3300013307 | Bacteria | 4598 |
| 352 | Ga0157372_10219265 | 3300013307 | Bacteria | 2205 |
| 353 | Ga0157372_10999635 | 3300013307 | Bacteria | 969 |
| 354 | Ga0157372_11106207 | 3300013307 | Bacteria | 917 |
| 355 | Ga0157372_12765166 | 3300013307 | Bacteria | 563 |
| 356 | Ga0157375_10001463 | 3300013308 | Bacteria | 20315 |
| 357 | Ga0157375_10005027 | 3300013308 | Bacteria | 11484 |
| 358 | Ga0157375_10159900 | 3300013308 | Bacteria | 2394 |
| 359 | Ga0157375_10645367 | 3300013308 | Bacteria | 1215 |
| 360 | Ga0157375_11820428 | 3300013308 | Bacteria | 722 |
| 361 | Ga0157375_13347282 | 3300013308 | Bacteria | 534 |
| 362 | Ga0163163_10036393 | 3300014325 | Bacteria | 4781 |
| 363 | Ga0163163_10300122 | 3300014325 | Bacteria | 1659 |
| 364 | Ga0163163_10382911 | 3300014325 | Unclassified | 1464 |
| 365 | Ga0163163_10393167 | 3300014325 | Unclassified | 1444 |
| 366 | Ga0163163_10451802 | 3300014325 | Bacteria | 1345 |
| 367 | Ga0163163_12045409 | 3300014325 | Bacteria | 632 |
| 368 | Ga0163163_12402330 | 3300014325 | Bacteria | 585 |
| 369 | Ga0157380_11073201 | 3300014326 | Bacteria | 843 |
| 370 | Ga0157380_11914737 | 3300014326 | Unclassified | 654 |
| 371 | Ga0157380_12414872 | 3300014326 | Bacteria | 591 |
| 372 | Ga0157380_13015544 | 3300014326 | Bacteria | 536 |
| 373 | Ga0157377_10059401 | 3300014745 | Bacteria | 2179 |
| 374 | Ga0157377_10157358 | 3300014745 | Bacteria | 1410 |
| 375 | Ga0157377_10596912 | 3300014745 | Bacteria | 787 |
| 376 | Ga0157379_10294026 | 3300014968 | Bacteria | 1480 |
| 377 | Ga0157379_10433737 | 3300014968 | Bacteria | 1211 |
| 378 | Ga0157379_10472215 | 3300014968 | Bacteria | 1160 |
| 379 | Ga0157379_10581884 | 3300014968 | Bacteria | 1044 |
| 380 | Ga0157379_11029031 | 3300014968 | Bacteria | 786 |
| 381 | Ga0157379_11058351 | 3300014968 | Bacteria | 776 |
| 382 | Ga0157379_11924823 | 3300014968 | Bacteria | 583 |
| 383 | Ga0157379_11942415 | 3300014968 | Bacteria | 581 |
| 384 | Ga0157376_10008523 | 3300014969 | Bacteria | 7404 |
| 385 | Ga0157376_10022078 | 3300014969 | Bacteria | 4953 |
| 386 | Ga0157376_10110820 | 3300014969 | Bacteria | 2415 |
| 387 | Ga0157376_10135197 | 3300014969 | Bacteria | 2205 |
| 388 | Ga0157376_10205661 | 3300014969 | Bacteria | 1814 |
| 389 | Ga0157376_11314513 | 3300014969 | Bacteria | 753 |
| 390 | Ga0163161_10001357 | 3300017792 | Bacteria | 18206 |
| 391 | Ga0163161_10015767 | 3300017792 | Bacteria | 5269 |
| 392 | Ga0163161_10052210 | 3300017792 | Bacteria | 2963 |
| 393 | Ga0163161_10380022 | 3300017792 | Unclassified | 1129 |
| 394 | Ga0206356_11242059 | 3300020070 | Bacteria | 2349 |
| 395 | Ga0206352_10807008 | 3300020078 | Unclassified | 964 |
| 396 | Ga0206352_10905181 | 3300020078 | Bacteria | 1339 |
| 397 | Ga0154015_1594150 | 3300020610 | Unclassified | 514 |
| 398 | Ga0207666_1058299 | 3300025271 | Bacteria | 616 |
| 399 | Ga0207697_10169011 | 3300025315 | Bacteria | 956 |
| 400 | Ga0207697_10239158 | 3300025315 | Bacteria | 802 |
| 401 | Ga0207656_10013408 | 3300025321 | Bacteria | 3133 |
| 402 | Ga0207656_10177343 | 3300025321 | Bacteria | 1021 |
| 403 | Ga0207682_10003346 | 3300025893 | Bacteria | 6992 |
| 404 | Ga0207642_10027020 | 3300025899 | Bacteria | 2344 |
| 405 | Ga0207642_10742750 | 3300025899 | Bacteria | 621 |
| 406 | Ga0207642_11103263 | 3300025899 | Bacteria | 513 |
| 407 | Ga0207710_10002332 | 3300025900 | Bacteria | 8872 |
| 408 | Ga0207688_10158876 | 3300025901 | Bacteria | 1339 |
| 409 | Ga0207680_10055057 | 3300025903 | Bacteria | 2396 |
| 410 | Ga0207680_10148616 | 3300025903 | Bacteria | 1560 |
| 411 | Ga0207680_11316308 | 3300025903 | Bacteria | 514 |
| 412 | Ga0207647_10020448 | 3300025904 | Bacteria | 4439 |
| 413 | Ga0207685_10187861 | 3300025905 | Bacteria | 962 |
| 414 | Ga0207685_10381598 | 3300025905 | Bacteria | 718 |
| 415 | Ga0207645_10025677 | 3300025907 | Bacteria | 3811 |
| 416 | Ga0207645_10058686 | 3300025907 | Bacteria | 2457 |
| 417 | Ga0207645_10158170 | 3300025907 | Bacteria | 1481 |
| 418 | Ga0207645_10373454 | 3300025907 | Bacteria | 956 |
| 419 | Ga0207645_10844175 | 3300025907 | Bacteria | 623 |
| 420 | Ga0207705_10732079 | 3300025909 | Bacteria | 768 |
| 421 | Ga0207705_11503884 | 3300025909 | Bacteria | 510 |
| 422 | Ga0207684_10515844 | 3300025910 | Bacteria | 1024 |
| 423 | Ga0207654_10036156 | 3300025911 | Bacteria | 2757 |
| 424 | Ga0207654_10616040 | 3300025911 | Bacteria | 775 |
| 425 | Ga0207654_11289273 | 3300025911 | Bacteria | 532 |
| 426 | Ga0207695_10000076 | 3300025913 | Bacteria | 307969 |
| 427 | Ga0207695_10000090 | 3300025913 | Bacteria | 272143 |
| 428 | Ga0207695_10015473 | 3300025913 | Bacteria | 8978 |
| 429 | Ga0207695_10350323 | 3300025913 | Bacteria | 1364 |
| 430 | Ga0207695_10946680 | 3300025913 | Bacteria | 741 |
| 431 | Ga0207695_11129584 | 3300025913 | Unclassified | 663 |
| 432 | Ga0207671_10037137 | 3300025914 | Bacteria | 3613 |
| 433 | Ga0207671_10040157 | 3300025914 | Bacteria | 3463 |
| 434 | Ga0207662_10027651 | 3300025918 | Bacteria | 3274 |
| 435 | Ga0207657_10699411 | 3300025919 | Bacteria | 787 |
| 436 | Ga0207649_10277452 | 3300025920 | Bacteria | 1217 |
| 437 | Ga0207649_10444890 | 3300025920 | Bacteria | 977 |
| 438 | Ga0207649_11145177 | 3300025920 | Bacteria | 614 |
| 439 | Ga0207681_10201509 | 3300025923 | Bacteria | 1528 |
| 440 | Ga0207681_10272524 | 3300025923 | Bacteria | 1329 |
| 441 | Ga0207681_10382313 | 3300025923 | Bacteria | 1133 |
| 442 | Ga0207681_10786939 | 3300025923 | Bacteria | 794 |
| 443 | Ga0207681_11069873 | 3300025923 | Bacteria | 677 |
| 444 | Ga0207650_10074493 | 3300025925 | Bacteria | 2559 |
| 445 | Ga0207650_10959364 | 3300025925 | Bacteria | 727 |
| 446 | Ga0207687_10195190 | 3300025927 | Bacteria | 1578 |
| 447 | Ga0207644_10059737 | 3300025931 | Bacteria | 2758 |
| 448 | Ga0207644_10072425 | 3300025931 | Bacteria | 2523 |
| 449 | Ga0207644_10129993 | 3300025931 | Bacteria | 1927 |
| 450 | Ga0207690_10024446 | 3300025932 | Bacteria | 3784 |
| 451 | Ga0207706_10006478 | 3300025933 | Bacteria | 10869 |
| 452 | Ga0207706_10163522 | 3300025933 | Bacteria | 1956 |
| 453 | Ga0207706_10205207 | 3300025933 | Bacteria | 1728 |
| 454 | Ga0207706_10675849 | 3300025933 | Bacteria | 883 |
| 455 | Ga0207686_10127335 | 3300025934 | Bacteria | 1742 |
| 456 | Ga0207686_10744788 | 3300025934 | Bacteria | 782 |
| 457 | Ga0207686_10981767 | 3300025934 | Bacteria | 685 |
| 458 | Ga0207686_11247268 | 3300025934 | Bacteria | 609 |
| 459 | Ga0207709_10209441 | 3300025935 | Bacteria | 1398 |
| 460 | Ga0207709_10375537 | 3300025935 | Unclassified | 1080 |
| 461 | Ga0207670_10014554 | 3300025936 | Bacteria | 4674 |
| 462 | Ga0207669_10053018 | 3300025937 | Bacteria | 2441 |
| 463 | Ga0207669_10828706 | 3300025937 | Bacteria | 769 |
| 464 | Ga0207704_10130848 | 3300025938 | Bacteria | 1737 |
| 465 | Ga0207704_10160734 | 3300025938 | Bacteria | 1598 |
| 466 | Ga0207704_10308805 | 3300025938 | Bacteria | 1215 |
| 467 | Ga0207704_10354971 | 3300025938 | Bacteria | 1143 |
| 468 | Ga0207704_10573488 | 3300025938 | Bacteria | 920 |
| 469 | Ga0207704_10592339 | 3300025938 | Bacteria | 907 |
| 470 | Ga0207704_10754359 | 3300025938 | Bacteria | 810 |
| 471 | Ga0207691_10049197 | 3300025940 | Bacteria | 3863 |
| 472 | Ga0207691_10596608 | 3300025940 | Bacteria | 935 |
| 473 | Ga0207691_10601825 | 3300025940 | Bacteria | 930 |
| 474 | Ga0207711_10092009 | 3300025941 | Bacteria | 2669 |
| 475 | Ga0207711_10182599 | 3300025941 | Bacteria | 1908 |
| 476 | Ga0207689_10010127 | 3300025942 | Bacteria | 8127 |
| 477 | Ga0207689_10014249 | 3300025942 | Bacteria | 6765 |
| 478 | Ga0207689_10045231 | 3300025942 | Bacteria | 3641 |
| 479 | Ga0207689_10075403 | 3300025942 | Bacteria | 2772 |
| 480 | Ga0207689_10167478 | 3300025942 | Bacteria | 1810 |
| 481 | Ga0207689_10182503 | 3300025942 | Bacteria | 1730 |
| 482 | Ga0207689_10388301 | 3300025942 | Bacteria | 1163 |
| 483 | Ga0207689_11138320 | 3300025942 | Bacteria | 657 |
| 484 | Ga0207661_10019703 | 3300025944 | Bacteria | 5035 |
| 485 | Ga0207661_10134049 | 3300025944 | Bacteria | 2125 |
| 486 | Ga0207679_10067722 | 3300025945 | Bacteria | 2679 |
| 487 | Ga0207679_11540553 | 3300025945 | Bacteria | 609 |
| 488 | Ga0207679_11893687 | 3300025945 | Bacteria | 544 |
| 489 | Ga0207667_10000453 | 3300025949 | Bacteria | 54929 |
| 490 | Ga0207667_10003602 | 3300025949 | Bacteria | 19111 |
| 491 | Ga0207667_10848084 | 3300025949 | Bacteria | 908 |
| 492 | Ga0207651_10568917 | 3300025960 | Bacteria | 987 |
| 493 | Ga0207651_10845061 | 3300025960 | Bacteria | 813 |
| 494 | Ga0207651_11274784 | 3300025960 | Bacteria | 660 |
| 495 | Ga0207651_11459083 | 3300025960 | Bacteria | 616 |
| 496 | Ga0207651_11486572 | 3300025960 | Bacteria | 610 |
| 497 | Ga0207651_11550697 | 3300025960 | Unclassified | 597 |
| 498 | Ga0207712_10016968 | 3300025961 | Bacteria | 4723 |
| 499 | Ga0207712_10082309 | 3300025961 | Bacteria | 2346 |
| 500 | Ga0207712_10082897 | 3300025961 | Bacteria | 2339 |
| 501 | Ga0207712_10318884 | 3300025961 | Bacteria | 1282 |
| 502 | Ga0207712_10407934 | 3300025961 | Bacteria | 1144 |
| 503 | Ga0207712_10441535 | 3300025961 | Bacteria | 1102 |
| 504 | Ga0207668_10074158 | 3300025972 | Bacteria | 2442 |
| 505 | Ga0207668_10149486 | 3300025972 | Bacteria | 1806 |
| 506 | Ga0207668_10161771 | 3300025972 | Bacteria | 1745 |
| 507 | Ga0207668_10788732 | 3300025972 | Bacteria | 840 |
| 508 | Ga0207640_10016977 | 3300025981 | Bacteria | 4249 |
| 509 | Ga0207640_10020295 | 3300025981 | Bacteria | 3944 |
| 510 | Ga0207640_10766513 | 3300025981 | Bacteria | 833 |
| 511 | Ga0207640_11296657 | 3300025981 | Bacteria | 650 |
| 512 | Ga0207658_10051578 | 3300025986 | Bacteria | 3032 |
| 513 | Ga0207658_10348489 | 3300025986 | Bacteria | 1289 |
| 514 | Ga0207658_10646178 | 3300025986 | Unclassified | 953 |
| 515 | Ga0207658_10752020 | 3300025986 | Bacteria | 883 |
| 516 | Ga0207658_10982032 | 3300025986 | Bacteria | 770 |
| 517 | Ga0207658_11852353 | 3300025986 | Bacteria | 550 |
| 518 | Ga0207677_10192753 | 3300026023 | Unclassified | 1613 |
| 519 | Ga0207677_11416784 | 3300026023 | Bacteria | 640 |
| 520 | Ga0207677_11726196 | 3300026023 | Bacteria | 581 |
| 521 | Ga0207677_12206673 | 3300026023 | Bacteria | 512 |
| 522 | Ga0207703_10835435 | 3300026035 | Bacteria | 880 |
| 523 | Ga0207703_11346948 | 3300026035 | Unclassified | 686 |
| 524 | Ga0207639_10003633 | 3300026041 | Bacteria | 10364 |
| 525 | Ga0207639_10022533 | 3300026041 | Bacteria | 4538 |
| 526 | Ga0207639_10268603 | 3300026041 | Bacteria | 1495 |
| 527 | Ga0207639_10822112 | 3300026041 | Unclassified | 866 |
| 528 | Ga0207639_11005787 | 3300026041 | Bacteria | 781 |
| 529 | Ga0207639_11159955 | 3300026041 | Bacteria | 725 |
| 530 | Ga0207639_11951241 | 3300026041 | Unclassified | 548 |
| 531 | Ga0207639_12158344 | 3300026041 | Bacteria | 518 |
| 532 | Ga0207678_11086737 | 3300026067 | Bacteria | 708 |
| 533 | Ga0207708_10887412 | 3300026075 | Bacteria | 771 |
| 534 | Ga0207641_10025754 | 3300026088 | Bacteria | 4850 |
| 535 | Ga0207641_10043824 | 3300026088 | Bacteria | 3760 |
| 536 | Ga0207641_10091863 | 3300026088 | Bacteria | 2657 |
| 537 | Ga0207641_10138043 | 3300026088 | Bacteria | 2196 |
| 538 | Ga0207641_10393151 | 3300026088 | Bacteria | 1330 |
| 539 | Ga0207641_10545068 | 3300026088 | Unclassified | 1131 |
| 540 | Ga0207641_10841836 | 3300026088 | Unclassified | 909 |
| 541 | Ga0207641_11232996 | 3300026088 | Bacteria | 748 |
| 542 | Ga0207648_10009109 | 3300026089 | Bacteria | 9541 |
| 543 | Ga0207648_10028462 | 3300026089 | Bacteria | 4954 |
| 544 | Ga0207648_10176788 | 3300026089 | Bacteria | 1888 |
| 545 | Ga0207648_10232893 | 3300026089 | Bacteria | 1639 |
| 546 | Ga0207648_10242935 | 3300026089 | Bacteria | 1603 |
| 547 | Ga0207648_10247850 | 3300026089 | Bacteria | 1587 |
| 548 | Ga0207648_10967696 | 3300026089 | Bacteria | 796 |
| 549 | Ga0207648_11127784 | 3300026089 | Bacteria | 736 |
| 550 | Ga0207676_10067110 | 3300026095 | Bacteria | 2864 |
| 551 | Ga0207676_10083440 | 3300026095 | Bacteria | 2602 |
| 552 | Ga0207676_10363238 | 3300026095 | Unclassified | 1342 |
| 553 | Ga0207676_10529410 | 3300026095 | Bacteria | 1123 |
| 554 | Ga0207676_10680396 | 3300026095 | Bacteria | 995 |
| 555 | Ga0207674_10009949 | 3300026116 | Bacteria | 10820 |
| 556 | Ga0207674_10022667 | 3300026116 | Bacteria | 6740 |
| 557 | Ga0207674_10025546 | 3300026116 | Bacteria | 6296 |
| 558 | Ga0207674_10147351 | 3300026116 | Bacteria | 2312 |
| 559 | Ga0207674_10169071 | 3300026116 | Bacteria | 2140 |
| 560 | Ga0207674_10171366 | 3300026116 | Bacteria | 2124 |
| 561 | Ga0207675_100049685 | 3300026118 | Bacteria | 3913 |
| 562 | Ga0207675_100068632 | 3300026118 | Bacteria | 3313 |
| 563 | Ga0207675_100119254 | 3300026118 | Bacteria | 2495 |
| 564 | Ga0207675_100303650 | 3300026118 | Bacteria | 1555 |
| 565 | Ga0207675_100605687 | 3300026118 | Bacteria | 1099 |
| 566 | Ga0207675_102223409 | 3300026118 | Bacteria | 563 |
| 567 | Ga0207683_10024454 | 3300026121 | Bacteria | 5203 |
| 568 | Ga0207683_10097053 | 3300026121 | Bacteria | 2628 |
| 569 | Ga0207683_10236552 | 3300026121 | Bacteria | 1666 |
| 570 | Ga0207683_10315533 | 3300026121 | Bacteria | 1431 |
| 571 | Ga0207683_10583777 | 3300026121 | Bacteria | 1034 |
| 572 | Ga0207698_10013166 | 3300026142 | Bacteria | 5446 |
| 573 | Ga0207698_10136904 | 3300026142 | Bacteria | 2103 |
| 574 | Ga0207698_10142388 | 3300026142 | Unclassified | 2068 |
| 575 | Ga0207698_10232664 | 3300026142 | Bacteria | 1674 |
| 576 | Ga0207698_10795200 | 3300026142 | Unclassified | 948 |
| 577 | Ga0207698_10935954 | 3300026142 | Unclassified | 875 |
| 578 | Ga0207698_11010308 | 3300026142 | Bacteria | 843 |
| 579 | Ga0207698_11320253 | 3300026142 | Bacteria | 736 |
| 580 | Ga0207428_10733645 | 3300027907 | Bacteria | 705 |
| 581 | Ga0268266_11387499 | 3300028379 | Bacteria | 678 |
| 582 | Ga0268266_11635247 | 3300028379 | Bacteria | 620 |
| 583 | Ga0268265_10154569 | 3300028380 | Bacteria | 1940 |
| 584 | Ga0268265_11076656 | 3300028380 | Unclassified | 797 |
| 585 | Ga0268265_11280978 | 3300028380 | Bacteria | 732 |
| 586 | Ga0268265_11286890 | 3300028380 | Bacteria | 731 |
| 587 | Ga0268265_11542435 | 3300028380 | Bacteria | 668 |
| 588 | Ga0268265_12395546 | 3300028380 | Bacteria | 534 |
| 589 | Ga0268264_10015090 | 3300028381 | Bacteria | 6337 |
| 590 | Ga0268264_10061228 | 3300028381 | Bacteria | 3157 |
| 591 | Ga0268264_10061558 | 3300028381 | Bacteria | 3149 |
| 592 | Ga0268264_10274759 | 3300028381 | Bacteria | 1575 |
| 593 | Ga0268264_10356042 | 3300028381 | Bacteria | 1395 |
| 594 | Ga0268264_10378729 | 3300028381 | Bacteria | 1354 |
| 595 | Ga0268264_10905782 | 3300028381 | Bacteria | 885 |
| 596 | Ga0268264_11184690 | 3300028381 | Bacteria | 773 |
| 597 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 598 | Ga0265327_10000244 | 3300031251 | Bacteria | 108867 |
| 599 | Ga0307513_10184519 | 3300031456 | Bacteria | 1945 |
| 600 | Ga0307516_10677783 | 3300031730 | Bacteria | 687 |
| 601 | Ga0307410_10133130 | 3300031852 | Bacteria | 1829 |
| 602 | Ga0307410_10259089 | 3300031852 | Bacteria | 1356 |
| 603 | Ga0307406_11795591 | 3300031901 | Bacteria | 545 |
| 604 | Ga0307406_12063053 | 3300031901 | Bacteria | 510 |
| 605 | Ga0307407_10489098 | 3300031903 | Unclassified | 900 |
| 606 | Ga0307412_11035174 | 3300031911 | Bacteria | 727 |
| 607 | Ga0307412_12087980 | 3300031911 | Bacteria | 526 |
| 608 | Ga0307409_102113213 | 3300031995 | Bacteria | 593 |
| 609 | Ga0307416_103535673 | 3300032002 | Unclassified | 523 |
| 610 | Ga0307415_100359048 | 3300032126 | Bacteria | 1230 |
| 611 | Ga0307510_10000380 | 3300033180 | Bacteria | 42243 |
| 612 | Ga0373934_0362481 | 3300035086 | Bacteria | 604 |
| 613 | Ga0373944_0058556 | 3300035089 | Bacteria | 1231 |
| 614 | Ga0373952_0052040 | 3300035092 | Bacteria | 979 |
| 615 | Ga0373923_0362113 | 3300035111 | Bacteria | 694 |
| 616 | Ga0373936_0177866 | 3300035113 | Bacteria | 932 |
| 617 | Ga0373956_0041135 | 3300035119 | Bacteria | 2052 |
| 618 | Ga0373943_0248315 | 3300035170 | Bacteria | 999 |
| 619 | Ga0373943_0913604 | 3300035170 | Bacteria | 525 |
| 620 | Ga0373946_0183334 | 3300035171 | Bacteria | 995 |
| 621 | Ga0373955_0466007 | 3300035172 | Bacteria | 770 |
| 622 | Ga0373955_0929755 | 3300035172 | Bacteria | 535 |
| 623 | Ga0373924_0042226 | 3300035410 | Bacteria | 1870 |
| 624 | Ga0373931_0337062 | 3300035691 | Bacteria | 941 |
| 625 | Ga0373935_0121189 | 3300035692 | Bacteria | 1748 |
| 626 | Ga0373935_1323371 | 3300035692 | Bacteria | 538 |
| 627 | Ga0373933_0073414 | 3300035724 | Bacteria | 2084 |
| 628 | Ga0373947_0572452 | 3300035725 | Bacteria | 769 |
| 629 | Ga0373947_0957318 | 3300035725 | Unclassified | 584 |
| 630 | Ga0373937_0002462 | 3300036401 | Bacteria | 15390 |
| 631 | Ga0373925_0228924 | 3300037068 | Bacteria | 1486 |
| 632 | Ga0395900_0017444 | 3300037418 | Bacteria | 7328 |
| 633 | Ga0395898_0002718 | 3300037466 | Bacteria | 20408 |
| 634 | Ga0395901_0158362 | 3300038443 | Bacteria | 2378 |
| 635 | Ga0436361_1211924 | 3300039447 | Bacteria | 2151 |
| 636 | Ga0439436_0186659 | 3300041404 | Bacteria | 591 |
| 637 | Ga0439439_0031503 | 3300041406 | Bacteria | 1352 |
| 638 | Ga0439466_0112609 | 3300041411 | Bacteria | 843 |
| 639 | Ga0451790_27755 | 3300041444 | Bacteria | 696 |
| 640 | Ga0451790_40603 | 3300041444 | Bacteria | 575 |
| 641 | Ga0451790_41286 | 3300041444 | Bacteria | 1130 |
| 642 | Ga0451791_1111960 | 3300041451 | Bacteria | 534 |
| 643 | Ga0451791_1436515 | 3300041451 | Bacteria | 1339 |
| 644 | Ga0451793_0068821 | 3300041452 | Bacteria | 806 |
| 645 | Ga0451797_0340668 | 3300041453 | Bacteria | 793 |
| 646 | Ga0451798_0476184 | 3300041458 | Bacteria | 541 |
| 647 | Ga0451798_0824705 | 3300041458 | Bacteria | 586 |
| 648 | Ga0451798_1169930 | 3300041458 | Unclassified | 645 |
| 649 | Ga0451800_0032641 | 3300041459 | Bacteria | 679 |
| 650 | Ga0451800_1619468 | 3300041459 | Bacteria | 834 |
| 651 | Ga0451802_0502259 | 3300041460 | Bacteria | 612 |
| 652 | Ga0451802_2117121 | 3300041460 | Bacteria | 916 |
| 653 | Ga0451807_0407082 | 3300041486 | Bacteria | 883 |
| 654 | Ga0451807_2654774 | 3300041486 | Bacteria | 1064 |
| 655 | Ga0451833_0686487 | 3300041491 | Bacteria | 803 |
| 656 | Ga0451839_0104913 | 3300041496 | Bacteria | 1387 |
| 657 | Ga0451843_1604042 | 3300041509 | Bacteria | 1309 |
| 658 | Ga0451843_1614837 | 3300041509 | Bacteria | 751 |
| 659 | Ga0439431_0132096 | 3300041997 | Bacteria | 701 |
| 660 | Ga0439441_008819 | 3300042001 | Bacteria | 1657 |
| 661 | Ga0439443_037532 | 3300042003 | Bacteria | 818 |
| 662 | Ga0439448_0216964 | 3300042005 | Bacteria | 672 |
| 663 | Ga0439432_123592 | 3300042006 | Bacteria | 766 |
| 664 | Ga0439449_0078529 | 3300042007 | Bacteria | 1217 |
| 665 | Ga0439452_025585 | 3300042010 | Bacteria | 1497 |
| 666 | Ga0439457_062867 | 3300042014 | Bacteria | 842 |
| 667 | Ga0439462_0015306 | 3300042015 | Bacteria | 1977 |
| 668 | Ga0450920_054549 | 3300042122 | Unclassified | 804 |
| 669 | Ga0450923_013606 | 3300042125 | Bacteria | 1497 |
| 670 | Ga0450894_006068 | 3300042131 | Bacteria | 1563 |
| 671 | Ga0450898_004710 | 3300042134 | Bacteria | 2031 |
| 672 | Ga0450906_059401 | 3300042145 | Bacteria | 679 |
| 673 | Ga0439434_0002227 | 3300042435 | Bacteria | 5629 |
| 674 | Ga0439444_0116582 | 3300042437 | Bacteria | 619 |
| 675 | Ga0450918_061096 | 3300042531 | Bacteria | 696 |
| 676 | Ga0453683_0417783 | 3300044673 | Bacteria | 865 |
| 677 | Ga0466965_0097561 | 3300044683 | Bacteria | 1500 |
| 678 | Ga0466964_0333770 | 3300044706 | Bacteria | 774 |
| 679 | Ga0453684_0435002 | 3300044712 | Bacteria | 1463 |
| 680 | Ga0466968_0672124 | 3300044735 | Unclassified | 527 |
| 681 | Ga0466970_0802014 | 3300044765 | Unclassified | 551 |
| 682 | Ga0466959_1068377 | 3300045049 | Bacteria | 537 |
| 683 | Ga0495592_0058314 | 3300046454 | Bacteria | 2848 |
| 684 | Ga0495603_0256095 | 3300046455 | Bacteria | 1008 |
| 685 | Ga0495638_0083919 | 3300046460 | Bacteria | 1929 |
| 686 | Ga0495638_0223917 | 3300046460 | Bacteria | 1050 |
| 687 | Ga0495651_0964554 | 3300046462 | Bacteria | 519 |
| 688 | Ga0495653_0072724 | 3300046463 | Bacteria | 2567 |
| 689 | Ga0495650_0024366 | 3300046471 | Bacteria | 2859 |
| 690 | Ga0495580_0262447 | 3300046472 | Bacteria | 1181 |
| 691 | Ga0495580_0766867 | 3300046472 | Bacteria | 627 |
| 692 | Ga0495582_0388122 | 3300046473 | Bacteria | 805 |
| 693 | Ga0495594_0471937 | 3300046499 | Bacteria | 713 |
| 694 | Ga0495606_0006493 | 3300046507 | Bacteria | 10759 |
| 695 | Ga0495608_0012072 | 3300046511 | Bacteria | 6005 |
| 696 | Ga0495618_0020169 | 3300046514 | Bacteria | 4104 |
| 697 | Ga0495628_0008937 | 3300046516 | Bacteria | 8568 |
| 698 | Ga0495630_0017830 | 3300046517 | Bacteria | 5207 |
| 699 | Ga0495630_1173261 | 3300046517 | Bacteria | 581 |
| 700 | Ga0495652_0566666 | 3300046529 | Bacteria | 779 |
| 701 | Ga0495640_0024578 | 3300046533 | Bacteria | 4382 |
| 702 | Ga0495587_0115395 | 3300046536 | Bacteria | 1541 |
| 703 | Ga0495598_0047315 | 3300046537 | Bacteria | 1282 |
| 704 | Ga0495598_0412749 | 3300046537 | Bacteria | 529 |
| 705 | Ga0495667_0041562 | 3300046559 | Bacteria | 3049 |
| 706 | Ga0495668_0000191 | 3300046616 | Bacteria | 90923 |
| 707 | Ga0495634_0023809 | 3300046642 | Bacteria | 4302 |
| 708 | Ga0495625_0344288 | 3300046660 | Bacteria | 944 |
| 709 | Ga0495635_0033509 | 3300046663 | Bacteria | 3563 |
| 710 | Ga0495657_0324594 | 3300046675 | Bacteria | 914 |
| 711 | Ga0495647_0408132 | 3300046681 | Bacteria | 625 |
| 712 | Ga0495613_0151946 | 3300046689 | Bacteria | 1651 |
| 713 | Ga0495613_0316598 | 3300046689 | Bacteria | 1078 |
| 714 | Ga0495670_0031502 | 3300046691 | Bacteria | 2636 |
| 715 | Ga0495649_0332965 | 3300046694 | Unclassified | 769 |
| 716 | Ga0495649_0606467 | 3300046694 | Bacteria | 540 |
| 717 | Ga0495600_0257975 | 3300046809 | Bacteria | 1108 |
| 718 | Ga0495604_0070404 | 3300047317 | Bacteria | 2649 |
| 719 | Ga0495636_0174575 | 3300047318 | Bacteria | 973 |
| 720 | Ga0495674_0303326 | 3300047319 | Bacteria | 1304 |
| 721 | Ga0495676_0504416 | 3300047321 | Bacteria | 794 |
| 722 | Ga0495680_0035982 | 3300047322 | Bacteria | 3981 |
| 723 | Ga0495686_0231403 | 3300047472 | Bacteria | 1046 |
| 724 | Ga0496100_0763862 | 3300048903 | Unclassified | 756 |
| 725 | Ga0496101_0111499 | 3300048904 | Bacteria | 2059 |
| 726 | Ga0496104_0731446 | 3300048907 | Bacteria | 897 |
| 727 | Ga0496105_0930522 | 3300048908 | Bacteria | 654 |
| 728 | Ga0496109_0900193 | 3300048912 | Bacteria | 823 |
| 729 | Ga0496111_0747131 | 3300048914 | Bacteria | 710 |
| 730 | Ga0496114_0294487 | 3300048917 | Bacteria | 1432 |
| 731 | Ga0496126_1006528 | 3300048929 | Bacteria | 625 |
| 732 | Ga0501306_007578 | 3300049127 | Bacteria | 1303 |
| 733 | Ga0501345_07567 | 3300049134 | Bacteria | 526 |
| 734 | Ga0501311_072167 | 3300049527 | Unclassified | 575 |
| 735 | Ga0501313_022447 | 3300049529 | Unclassified | 787 |
| 736 | Ga0501315_079438 | 3300049531 | Bacteria | 555 |
| 737 | Ga0501316_046441 | 3300049532 | Unclassified | 616 |
| 738 | Ga0501320_012948 | 3300049536 | Bacteria | 885 |
| 739 | Ga0501321_018570 | 3300049537 | Bacteria | 845 |
| 740 | Ga0501336_003998 | 3300049552 | Bacteria | 1020 |
| 741 | Ga0501031_0005772 | 3300049568 | Bacteria | 8068 |
| 742 | Ga0501033_0114330 | 3300049570 | Bacteria | 1962 |
| 743 | Ga0501034_0038226 | 3300049571 | Bacteria | 4860 |
| 744 | Ga0501036_0009955 | 3300049572 | Bacteria | 7829 |
| 745 | Ga0501037_0032648 | 3300049573 | Bacteria | 3845 |
| 746 | Ga0501038_0005905 | 3300049574 | Bacteria | 11315 |
| 747 | Ga0501039_0013024 | 3300049575 | Bacteria | 6357 |
| 748 | Ga0501043_0009337 | 3300049579 | Bacteria | 7705 |
| 749 | Ga0501046_0052113 | 3300049580 | Bacteria | 3226 |
| 750 | Ga0501047_0443886 | 3300049581 | Unclassified | 1127 |
| 751 | Ga0501047_0864956 | 3300049581 | Bacteria | 718 |
| 752 | Ga0501072_0348421 | 3300049588 | Unclassified | 1176 |
| 753 | Ga0501073_0069872 | 3300049589 | Bacteria | 2447 |
| 754 | Ga0501080_0032906 | 3300049742 | Bacteria | 4838 |
| 755 | Ga0501274_038594 | 3300049771 | Bacteria | 566 |
| 756 | Ga0501035_0050477 | 3300049822 | Bacteria | 3728 |
| 757 | Ga0501044_0004248 | 3300049823 | Bacteria | 16071 |
| 758 | Ga0501044_0037946 | 3300049823 | Bacteria | 5034 |
| 759 | Ga0501044_0123100 | 3300049823 | Unclassified | 2593 |
| 760 | nmdc:mga0k408_399816_c1 | 3300050493 | Bacteria | 818 |
| 761 | nmdc:mga0k408_62578_c1 | 3300050493 | Bacteria | 2164 |
| 762 | nmdc:mga07m45_379224_c1 | 3300050496 | Bacteria | 821 |
| 763 | nmdc:mga07m45_69219_c1 | 3300050496 | Bacteria | 2006 |
| 764 | nmdc:mga07m45_735907_c1 | 3300050496 | Bacteria | 566 |
| 765 | nmdc:mga09592_471205_c1 | 3300050508 | Bacteria | 1083 |
| 766 | nmdc:mga09592_656665_c1 | 3300050508 | Bacteria | 895 |
| 767 | nmdc:mga09592_70262_c1 | 3300050508 | Bacteria | 2971 |
| 768 | nmdc:mga09592_926671_c1 | 3300050508 | Bacteria | 731 |
| 769 | nmdc:mga0qj67_1010971_c1 | 3300050509 | Bacteria | 652 |
| 770 | nmdc:mga0qj67_85711_c1 | 3300050509 | Bacteria | 2527 |
| 771 | nmdc:mga06r32_145795_c1 | 3300050510 | Bacteria | 2345 |
| 772 | nmdc:mga0n895_1080853_c1 | 3300050512 | Bacteria | 780 |
| 773 | nmdc:mga0n895_485544_c1 | 3300050512 | Unclassified | 1245 |
| 774 | nmdc:mga0a205_797619_c1 | 3300050515 | Bacteria | 792 |
| 775 | Ga0495619_0017003 | 3300053085 | Bacteria | 4610 |
| 776 | Ga0500562_013235 | 3300053108 | Bacteria | 2105 |
| 777 | Ga0500593_103971 | 3300053117 | Bacteria | 1180 |
| 778 | Ga0500559_0530160 | 3300053136 | Bacteria | 539 |
| 779 | Ga0500588_0236510 | 3300053146 | Bacteria | 684 |
| 780 | Ga0500616_0139029 | 3300053153 | Bacteria | 1138 |
| 781 | Ga0500622_0391746 | 3300053156 | Unclassified | 566 |
| 782 | Ga0500611_000032 | 3300053727 | Bacteria | 83927 |
| 783 | Ga0500645_051002 | 3300053730 | Bacteria | 1207 |
| 784 | Ga0587091_224114 | 3300059511 | Bacteria | 516 |
| 785 | Ga0587109_059983 | 3300059624 | Unclassified | 799 |
| 786 | Ga0587128_118650 | 3300059630 | Bacteria | 574 |
| 787 | Ga0587067_084412 | 3300059640 | Bacteria | 709 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005289 | Ga0065704_10358180 | Ga0065704_103581801 | 98 |
| 2 | 3300041444 | Ga0451790_40603 | Ga0451790_40603_34_330 | 98 |
| 3 | 3300041486 | Ga0451807_2654774 | Ga0451807_2654774_474_770 | 98 |
| 4 | 3300046616 | Ga0495668_0000191 | Ga0495668_0000191_42422_42718 | 98 |
| 5 | 3300048929 | Ga0496126_1006528 | Ga0496126_1006528_240_536 | 98 |
| 6 | 3300053136 | Ga0500559_0530160 | Ga0500559_0530160_119_415 | 98 |
| 7 | 3300002459 | JGI24751J29686_10001390 | JGI24751J29686_100013905 | 99 |
| 8 | 3300003316 | rootH1_10008428 | rootH1_100084282 | 99 |
| 9 | 3300003316 | rootH1_10137063 | rootH1_101370632 | 99 |
| 10 | 3300003320 | rootH2_10022358 | rootH2_100223582 | 99 |
| 11 | 3300003322 | rootL2_10149151 | rootL2_101491512 | 99 |
| 12 | 3300003323 | rootH1_10083104 | rootH1_100831044 | 99 |
| 13 | 3300004798 | Ga0058859_11572014 | Ga0058859_115720142 | 99 |
| 14 | 3300004801 | Ga0058860_12028199 | Ga0058860_120281992 | 99 |
| 15 | 3300004801 | Ga0058860_12218397 | Ga0058860_122183971 | 99 |
| 16 | 3300005277 | Ga0065716_1019128 | Ga0065716_10191282 | 99 |
| 17 | 3300005288 | Ga0065714_10176271 | Ga0065714_101762712 | 99 |
| 18 | 3300005288 | Ga0065714_10177684 | Ga0065714_101776841 | 99 |
| 19 | 3300005289 | Ga0065704_10233298 | Ga0065704_102332981 | 99 |
| 20 | 3300005290 | Ga0065712_10010764 | Ga0065712_100107642 | 99 |
| 21 | 3300005290 | Ga0065712_10020318 | Ga0065712_100203182 | 99 |
| 22 | 3300005290 | Ga0065712_10181032 | Ga0065712_101810321 | 99 |
| 23 | 3300005293 | Ga0065715_10474826 | Ga0065715_104748262 | 99 |
| 24 | 3300005295 | Ga0065707_10333640 | Ga0065707_103336401 | 99 |
| 25 | 3300005327 | Ga0070658_10430094 | Ga0070658_104300942 | 99 |
| 26 | 3300005327 | Ga0070658_11652234 | Ga0070658_116522341 | 99 |
| 27 | 3300005328 | Ga0070676_10080339 | Ga0070676_100803394 | 99 |
| 28 | 3300005328 | Ga0070676_10152918 | Ga0070676_101529182 | 99 |
| 29 | 3300005328 | Ga0070676_10983853 | Ga0070676_109838532 | 99 |
| 30 | 3300005328 | Ga0070676_11173912 | Ga0070676_111739121 | 99 |
| 31 | 3300005329 | Ga0070683_100012473 | Ga0070683_10001247313 | 99 |
| 32 | 3300005329 | Ga0070683_100013707 | Ga0070683_1000137075 | 99 |
| 33 | 3300005330 | Ga0070690_100012030 | Ga0070690_1000120305 | 99 |
| 34 | 3300005330 | Ga0070690_100241897 | Ga0070690_1002418972 | 99 |
| 35 | 3300005330 | Ga0070690_100271982 | Ga0070690_1002719822 | 99 |
| 36 | 3300005330 | Ga0070690_100608450 | Ga0070690_1006084502 | 99 |
| 37 | 3300005331 | Ga0070670_100158102 | Ga0070670_1001581022 | 99 |
| 38 | 3300005331 | Ga0070670_100296962 | Ga0070670_1002969622 | 99 |
| 39 | 3300005331 | Ga0070670_100405561 | Ga0070670_1004055612 | 99 |
| 40 | 3300005333 | Ga0070677_10044332 | Ga0070677_100443323 | 99 |
| 41 | 3300005333 | Ga0070677_10295001 | Ga0070677_102950012 | 99 |
| 42 | 3300005333 | Ga0070677_10329637 | Ga0070677_103296372 | 99 |
| 43 | 3300005334 | Ga0068869_100017755 | Ga0068869_1000177553 | 99 |
| 44 | 3300005334 | Ga0068869_100164027 | Ga0068869_1001640272 | 99 |
| 45 | 3300005334 | Ga0068869_100186493 | Ga0068869_1001864931 | 99 |
| 46 | 3300005334 | Ga0068869_100635703 | Ga0068869_1006357032 | 99 |
| 47 | 3300005334 | Ga0068869_100885241 | Ga0068869_1008852412 | 99 |
| 48 | 3300005334 | Ga0068869_101329351 | Ga0068869_1013293511 | 99 |
| 49 | 3300005335 | Ga0070666_10047180 | Ga0070666_100471806 | 99 |
| 50 | 3300005337 | Ga0070682_100000039 | Ga0070682_10000003994 | 99 |
| 51 | 3300005337 | Ga0070682_100054491 | Ga0070682_1000544912 | 99 |
| 52 | 3300005337 | Ga0070682_100066166 | Ga0070682_1000661663 | 99 |
| 53 | 3300005337 | Ga0070682_100774566 | Ga0070682_1007745662 | 99 |
| 54 | 3300005337 | Ga0070682_101451664 | Ga0070682_1014516642 | 99 |
| 55 | 3300005338 | Ga0068868_100017514 | Ga0068868_1000175144 | 99 |
| 56 | 3300005338 | Ga0068868_100123647 | Ga0068868_1001236473 | 99 |
| 57 | 3300005338 | Ga0068868_100425091 | Ga0068868_1004250911 | 99 |
| 58 | 3300005338 | Ga0068868_100595145 | Ga0068868_1005951452 | 99 |
| 59 | 3300005339 | Ga0070660_100979665 | Ga0070660_1009796651 | 99 |
| 60 | 3300005340 | Ga0070689_101381644 | Ga0070689_1013816441 | 99 |
| 61 | 3300005343 | Ga0070687_100128780 | Ga0070687_1001287803 | 99 |
| 62 | 3300005343 | Ga0070687_101437085 | Ga0070687_1014370851 | 99 |
| 63 | 3300005343 | Ga0070687_101482004 | Ga0070687_1014820041 | 99 |
| 64 | 3300005344 | Ga0070661_100401046 | Ga0070661_1004010462 | 99 |
| 65 | 3300005344 | Ga0070661_101094601 | Ga0070661_1010946011 | 99 |
| 66 | 3300005347 | Ga0070668_100050126 | Ga0070668_1000501265 | 99 |
| 67 | 3300005347 | Ga0070668_100155369 | Ga0070668_1001553691 | 99 |
| 68 | 3300005353 | Ga0070669_100164458 | Ga0070669_1001644581 | 99 |
| 69 | 3300005353 | Ga0070669_100264468 | Ga0070669_1002644682 | 99 |
| 70 | 3300005353 | Ga0070669_100724776 | Ga0070669_1007247762 | 99 |
| 71 | 3300005353 | Ga0070669_100771408 | Ga0070669_1007714082 | 99 |
| 72 | 3300005353 | Ga0070669_100999050 | Ga0070669_1009990502 | 99 |
| 73 | 3300005354 | Ga0070675_100304522 | Ga0070675_1003045222 | 99 |
| 74 | 3300005354 | Ga0070675_100348087 | Ga0070675_1003480872 | 99 |
| 75 | 3300005354 | Ga0070675_101352475 | Ga0070675_1013524752 | 99 |
| 76 | 3300005355 | Ga0070671_100027874 | Ga0070671_1000278749 | 99 |
| 77 | 3300005355 | Ga0070671_100059066 | Ga0070671_1000590664 | 99 |
| 78 | 3300005355 | Ga0070671_100524570 | Ga0070671_1005245702 | 99 |
| 79 | 3300005355 | Ga0070671_100739459 | Ga0070671_1007394592 | 99 |
| 80 | 3300005355 | Ga0070671_101113529 | Ga0070671_1011135291 | 99 |
| 81 | 3300005356 | Ga0070674_100816159 | Ga0070674_1008161591 | 99 |
| 82 | 3300005364 | Ga0070673_100030215 | Ga0070673_1000302157 | 99 |
| 83 | 3300005364 | Ga0070673_100373624 | Ga0070673_1003736242 | 99 |
| 84 | 3300005364 | Ga0070673_100782635 | Ga0070673_1007826352 | 99 |
| 85 | 3300005364 | Ga0070673_100908377 | Ga0070673_1009083772 | 99 |
| 86 | 3300005364 | Ga0070673_101586386 | Ga0070673_1015863862 | 99 |
| 87 | 3300005364 | Ga0070673_102274756 | Ga0070673_1022747561 | 99 |
| 88 | 3300005365 | Ga0070688_100496873 | Ga0070688_1004968732 | 99 |
| 89 | 3300005366 | Ga0070659_100010418 | Ga0070659_1000104183 | 99 |
| 90 | 3300005366 | Ga0070659_100293641 | Ga0070659_1002936412 | 99 |
| 91 | 3300005367 | Ga0070667_100162213 | Ga0070667_1001622133 | 99 |
| 92 | 3300005367 | Ga0070667_100187787 | Ga0070667_1001877873 | 99 |
| 93 | 3300005367 | Ga0070667_100367061 | Ga0070667_1003670612 | 99 |
| 94 | 3300005367 | Ga0070667_100446979 | Ga0070667_1004469792 | 99 |
| 95 | 3300005367 | Ga0070667_100497691 | Ga0070667_1004976912 | 99 |
| 96 | 3300005367 | Ga0070667_101994815 | Ga0070667_1019948152 | 99 |
| 97 | 3300005367 | Ga0070667_102150443 | Ga0070667_1021504431 | 99 |
| 98 | 3300005367 | Ga0070667_102341496 | Ga0070667_1023414961 | 99 |
| 99 | 3300005438 | Ga0070701_10030686 | Ga0070701_100306865 | 99 |
| 100 | 3300005441 | Ga0070700_100400731 | Ga0070700_1004007312 | 99 |
| 101 | 3300005441 | Ga0070700_101288740 | Ga0070700_1012887401 | 99 |
| 102 | 3300005444 | Ga0070694_100152300 | Ga0070694_1001523003 | 99 |
| 103 | 3300005455 | Ga0070663_100824540 | Ga0070663_1008245402 | 99 |
| 104 | 3300005456 | Ga0070678_100124839 | Ga0070678_1001248391 | 99 |
| 105 | 3300005456 | Ga0070678_100197824 | Ga0070678_1001978242 | 99 |
| 106 | 3300005456 | Ga0070678_100310570 | Ga0070678_1003105702 | 99 |
| 107 | 3300005456 | Ga0070678_100397012 | Ga0070678_1003970122 | 99 |
| 108 | 3300005456 | Ga0070678_101138746 | Ga0070678_1011387462 | 99 |
| 109 | 3300005456 | Ga0070678_101813579 | Ga0070678_1018135791 | 99 |
| 110 | 3300005457 | Ga0070662_100044485 | Ga0070662_1000444853 | 99 |
| 111 | 3300005459 | Ga0068867_100011408 | Ga0068867_1000114085 | 99 |
| 112 | 3300005459 | Ga0068867_100031243 | Ga0068867_1000312432 | 99 |
| 113 | 3300005459 | Ga0068867_100218385 | Ga0068867_1002183853 | 99 |
| 114 | 3300005459 | Ga0068867_100461505 | Ga0068867_1004615052 | 99 |
| 115 | 3300005459 | Ga0068867_100843120 | Ga0068867_1008431202 | 99 |
| 116 | 3300005459 | Ga0068867_101068658 | Ga0068867_1010686582 | 99 |
| 117 | 3300005459 | Ga0068867_101090094 | Ga0068867_1010900942 | 99 |
| 118 | 3300005466 | Ga0070685_10075150 | Ga0070685_100751502 | 99 |
| 119 | 3300005466 | Ga0070685_10108040 | Ga0070685_101080403 | 99 |
| 120 | 3300005471 | Ga0070698_100002339 | Ga0070698_10000233919 | 99 |
| 121 | 3300005471 | Ga0070698_100002802 | Ga0070698_10000280225 | 99 |
| 122 | 3300005471 | Ga0070698_100021125 | Ga0070698_1000211253 | 99 |
| 123 | 3300005471 | Ga0070698_100241874 | Ga0070698_1002418742 | 99 |
| 124 | 3300005535 | Ga0070684_100050088 | Ga0070684_1000500886 | 99 |
| 125 | 3300005535 | Ga0070684_100069741 | Ga0070684_1000697412 | 99 |
| 126 | 3300005535 | Ga0070684_101742365 | Ga0070684_1017423651 | 99 |
| 127 | 3300005539 | Ga0068853_100013022 | Ga0068853_1000130222 | 99 |
| 128 | 3300005539 | Ga0068853_100021938 | Ga0068853_10002193810 | 99 |
| 129 | 3300005539 | Ga0068853_100053834 | Ga0068853_1000538345 | 99 |
| 130 | 3300005539 | Ga0068853_100177645 | Ga0068853_1001776451 | 99 |
| 131 | 3300005539 | Ga0068853_100187386 | Ga0068853_1001873862 | 99 |
| 132 | 3300005539 | Ga0068853_100672055 | Ga0068853_1006720551 | 99 |
| 133 | 3300005539 | Ga0068853_101262350 | Ga0068853_1012623502 | 99 |
| 134 | 3300005539 | Ga0068853_101423282 | Ga0068853_1014232822 | 99 |
| 135 | 3300005543 | Ga0070672_100140535 | Ga0070672_1001405354 | 99 |
| 136 | 3300005543 | Ga0070672_100268088 | Ga0070672_1002680882 | 99 |
| 137 | 3300005543 | Ga0070672_101033833 | Ga0070672_1010338332 | 99 |
| 138 | 3300005543 | Ga0070672_101073298 | Ga0070672_1010732982 | 99 |
| 139 | 3300005543 | Ga0070672_101368455 | Ga0070672_1013684551 | 99 |
| 140 | 3300005544 | Ga0070686_100131761 | Ga0070686_1001317612 | 99 |
| 141 | 3300005544 | Ga0070686_100339360 | Ga0070686_1003393602 | 99 |
| 142 | 3300005545 | Ga0070695_100328010 | Ga0070695_1003280102 | 99 |
| 143 | 3300005548 | Ga0070665_101230939 | Ga0070665_1012309391 | 99 |
| 144 | 3300005548 | Ga0070665_101676357 | Ga0070665_1016763572 | 99 |
| 145 | 3300005548 | Ga0070665_102105013 | Ga0070665_1021050132 | 99 |
| 146 | 3300005549 | Ga0070704_100100614 | Ga0070704_1001006142 | 99 |
| 147 | 3300005563 | Ga0068855_100000133 | Ga0068855_1000001335 | 99 |
| 148 | 3300005563 | Ga0068855_100161856 | Ga0068855_1001618562 | 99 |
| 149 | 3300005563 | Ga0068855_101205999 | Ga0068855_1012059992 | 99 |
| 150 | 3300005563 | Ga0068855_101297998 | Ga0068855_1012979982 | 99 |
| 151 | 3300005564 | Ga0070664_100041775 | Ga0070664_1000417752 | 99 |
| 152 | 3300005564 | Ga0070664_101314925 | Ga0070664_1013149252 | 99 |
| 153 | 3300005577 | Ga0068857_100018409 | Ga0068857_1000184096 | 99 |
| 154 | 3300005577 | Ga0068857_100049652 | Ga0068857_1000496525 | 99 |
| 155 | 3300005577 | Ga0068857_100085136 | Ga0068857_1000851363 | 99 |
| 156 | 3300005577 | Ga0068857_100200825 | Ga0068857_1002008251 | 99 |
| 157 | 3300005577 | Ga0068857_100410529 | Ga0068857_1004105293 | 99 |
| 158 | 3300005577 | Ga0068857_101296490 | Ga0068857_1012964901 | 99 |
| 159 | 3300005578 | Ga0068854_100142005 | Ga0068854_1001420052 | 99 |
| 160 | 3300005578 | Ga0068854_100203791 | Ga0068854_1002037911 | 99 |
| 161 | 3300005578 | Ga0068854_100261616 | Ga0068854_1002616162 | 99 |
| 162 | 3300005578 | Ga0068854_101028985 | Ga0068854_1010289851 | 99 |
| 163 | 3300005614 | Ga0068856_100324230 | Ga0068856_1003242302 | 99 |
| 164 | 3300005614 | Ga0068856_102538049 | Ga0068856_1025380492 | 99 |
| 165 | 3300005615 | Ga0070702_100049731 | Ga0070702_1000497312 | 99 |
| 166 | 3300005615 | Ga0070702_101226973 | Ga0070702_1012269732 | 99 |
| 167 | 3300005616 | Ga0068852_100001842 | Ga0068852_1000018428 | 99 |
| 168 | 3300005616 | Ga0068852_100054084 | Ga0068852_1000540845 | 99 |
| 169 | 3300005616 | Ga0068852_100399528 | Ga0068852_1003995282 | 99 |
| 170 | 3300005616 | Ga0068852_100541074 | Ga0068852_1005410742 | 99 |
| 171 | 3300005616 | Ga0068852_100548083 | Ga0068852_1005480832 | 99 |
| 172 | 3300005616 | Ga0068852_100770817 | Ga0068852_1007708172 | 99 |
| 173 | 3300005617 | Ga0068859_100000536 | Ga0068859_10000053616 | 99 |
| 174 | 3300005617 | Ga0068859_100224760 | Ga0068859_1002247603 | 99 |
| 175 | 3300005617 | Ga0068859_100378987 | Ga0068859_1003789872 | 99 |
| 176 | 3300005617 | Ga0068859_101038780 | Ga0068859_1010387802 | 99 |
| 177 | 3300005617 | Ga0068859_101113972 | Ga0068859_1011139722 | 99 |
| 178 | 3300005617 | Ga0068859_101363145 | Ga0068859_1013631452 | 99 |
| 179 | 3300005617 | Ga0068859_102320201 | Ga0068859_1023202012 | 99 |
| 180 | 3300005618 | Ga0068864_100078002 | Ga0068864_1000780024 | 99 |
| 181 | 3300005618 | Ga0068864_100107079 | Ga0068864_1001070792 | 99 |
| 182 | 3300005618 | Ga0068864_100700002 | Ga0068864_1007000021 | 99 |
| 183 | 3300005618 | Ga0068864_100774454 | Ga0068864_1007744542 | 99 |
| 184 | 3300005618 | Ga0068864_101231108 | Ga0068864_1012311082 | 99 |
| 185 | 3300005618 | Ga0068864_101277046 | Ga0068864_1012770462 | 99 |
| 186 | 3300005618 | Ga0068864_101578938 | Ga0068864_1015789382 | 99 |
| 187 | 3300005718 | Ga0068866_10167116 | Ga0068866_101671163 | 99 |
| 188 | 3300005718 | Ga0068866_10244880 | Ga0068866_102448802 | 99 |
| 189 | 3300005718 | Ga0068866_10804666 | Ga0068866_108046662 | 99 |
| 190 | 3300005719 | Ga0068861_100134738 | Ga0068861_1001347382 | 99 |
| 191 | 3300005719 | Ga0068861_100209084 | Ga0068861_1002090842 | 99 |
| 192 | 3300005719 | Ga0068861_100261089 | Ga0068861_1002610892 | 99 |
| 193 | 3300005719 | Ga0068861_100272552 | Ga0068861_1002725523 | 99 |
| 194 | 3300005719 | Ga0068861_100297679 | Ga0068861_1002976792 | 99 |
| 195 | 3300005719 | Ga0068861_100609875 | Ga0068861_1006098752 | 99 |
| 196 | 3300005719 | Ga0068861_101741185 | Ga0068861_1017411851 | 99 |
| 197 | 3300005719 | Ga0068861_102418491 | Ga0068861_1024184911 | 99 |
| 198 | 3300005834 | Ga0068851_10309859 | Ga0068851_103098592 | 99 |
| 199 | 3300005834 | Ga0068851_11042207 | Ga0068851_110422071 | 99 |
| 200 | 3300005840 | Ga0068870_10172613 | Ga0068870_101726132 | 99 |
| 201 | 3300005840 | Ga0068870_10681471 | Ga0068870_106814713 | 99 |
| 202 | 3300005841 | Ga0068863_100098427 | Ga0068863_1000984272 | 99 |
| 203 | 3300005841 | Ga0068863_100114726 | Ga0068863_1001147262 | 99 |
| 204 | 3300005841 | Ga0068863_100410048 | Ga0068863_1004100482 | 99 |
| 205 | 3300005841 | Ga0068863_101278366 | Ga0068863_1012783662 | 99 |
| 206 | 3300005841 | Ga0068863_102614408 | Ga0068863_1026144082 | 99 |
| 207 | 3300005842 | Ga0068858_100109140 | Ga0068858_1001091404 | 99 |
| 208 | 3300005842 | Ga0068858_101055247 | Ga0068858_1010552471 | 99 |
| 209 | 3300005842 | Ga0068858_101414979 | Ga0068858_1014149791 | 99 |
| 210 | 3300005843 | Ga0068860_100010482 | Ga0068860_1000104826 | 99 |
| 211 | 3300005843 | Ga0068860_100173927 | Ga0068860_1001739273 | 99 |
| 212 | 3300005843 | Ga0068860_100280646 | Ga0068860_1002806462 | 99 |
| 213 | 3300005843 | Ga0068860_100788115 | Ga0068860_1007881152 | 99 |
| 214 | 3300005843 | Ga0068860_100793324 | Ga0068860_1007933242 | 99 |
| 215 | 3300005843 | Ga0068860_100916554 | Ga0068860_1009165542 | 99 |
| 216 | 3300005843 | Ga0068860_102626909 | Ga0068860_1026269091 | 99 |
| 217 | 3300005843 | Ga0068860_102799295 | Ga0068860_1027992951 | 99 |
| 218 | 3300005844 | Ga0068862_100032080 | Ga0068862_1000320807 | 99 |
| 219 | 3300005844 | Ga0068862_100714805 | Ga0068862_1007148052 | 99 |
| 220 | 3300005844 | Ga0068862_101540653 | Ga0068862_1015406532 | 99 |
| 221 | 3300006058 | Ga0075432_10114297 | Ga0075432_101142972 | 99 |
| 222 | 3300006163 | Ga0070715_10041724 | Ga0070715_100417242 | 99 |
| 223 | 3300006163 | Ga0070715_10073647 | Ga0070715_100736472 | 99 |
| 224 | 3300006163 | Ga0070715_10127624 | Ga0070715_101276242 | 99 |
| 225 | 3300006195 | Ga0075366_10082945 | Ga0075366_100829452 | 99 |
| 226 | 3300006195 | Ga0075366_10508980 | Ga0075366_105089802 | 99 |
| 227 | 3300006237 | Ga0097621_100003401 | Ga0097621_1000034013 | 99 |
| 228 | 3300006237 | Ga0097621_100036790 | Ga0097621_1000367903 | 99 |
| 229 | 3300006237 | Ga0097621_100050215 | Ga0097621_1000502152 | 99 |
| 230 | 3300006237 | Ga0097621_100410740 | Ga0097621_1004107401 | 99 |
| 231 | 3300006237 | Ga0097621_100422407 | Ga0097621_1004224072 | 99 |
| 232 | 3300006237 | Ga0097621_100537595 | Ga0097621_1005375952 | 99 |
| 233 | 3300006237 | Ga0097621_100680226 | Ga0097621_1006802262 | 99 |
| 234 | 3300006353 | Ga0075370_10173219 | Ga0075370_101732193 | 99 |
| 235 | 3300006353 | Ga0075370_10537878 | Ga0075370_105378781 | 99 |
| 236 | 3300006353 | Ga0075370_10824576 | Ga0075370_108245762 | 99 |
| 237 | 3300006358 | Ga0068871_100000955 | Ga0068871_10000095519 | 99 |
| 238 | 3300006358 | Ga0068871_100108578 | Ga0068871_1001085783 | 99 |
| 239 | 3300006358 | Ga0068871_100134279 | Ga0068871_1001342792 | 99 |
| 240 | 3300006358 | Ga0068871_101138415 | Ga0068871_1011384151 | 99 |
| 241 | 3300006358 | Ga0068871_101638411 | Ga0068871_1016384112 | 99 |
| 242 | 3300006358 | Ga0068871_101751436 | Ga0068871_1017514361 | 99 |
| 243 | 3300006844 | Ga0075428_100029189 | Ga0075428_1000291894 | 99 |
| 244 | 3300006844 | Ga0075428_100044984 | Ga0075428_1000449846 | 99 |
| 245 | 3300006844 | Ga0075428_100527725 | Ga0075428_1005277252 | 99 |
| 246 | 3300006844 | Ga0075428_101374511 | Ga0075428_1013745111 | 99 |
| 247 | 3300006847 | Ga0075431_100019798 | Ga0075431_1000197982 | 99 |
| 248 | 3300006847 | Ga0075431_101149999 | Ga0075431_1011499992 | 99 |
| 249 | 3300006871 | Ga0075434_100562446 | Ga0075434_1005624462 | 99 |
| 250 | 3300006871 | Ga0075434_101019333 | Ga0075434_1010193331 | 99 |
| 251 | 3300006880 | Ga0075429_100003790 | Ga0075429_10000379012 | 99 |
| 252 | 3300006880 | Ga0075429_100060787 | Ga0075429_1000607874 | 99 |
| 253 | 3300006880 | Ga0075429_100874597 | Ga0075429_1008745972 | 99 |
| 254 | 3300006880 | Ga0075429_100912786 | Ga0075429_1009127862 | 99 |
| 255 | 3300006881 | Ga0068865_100093466 | Ga0068865_1000934663 | 99 |
| 256 | 3300006881 | Ga0068865_100114198 | Ga0068865_1001141983 | 99 |
| 257 | 3300006881 | Ga0068865_100507273 | Ga0068865_1005072732 | 99 |
| 258 | 3300006881 | Ga0068865_100704319 | Ga0068865_1007043192 | 99 |
| 259 | 3300006881 | Ga0068865_100729034 | Ga0068865_1007290341 | 99 |
| 260 | 3300006881 | Ga0068865_100782855 | Ga0068865_1007828552 | 99 |
| 261 | 3300006931 | Ga0097620_100000536 | Ga0097620_10000053616 | 99 |
| 262 | 3300006931 | Ga0097620_100224745 | Ga0097620_1002247453 | 99 |
| 263 | 3300006931 | Ga0097620_100379009 | Ga0097620_1003790092 | 99 |
| 264 | 3300006931 | Ga0097620_101038841 | Ga0097620_1010388412 | 99 |
| 265 | 3300006931 | Ga0097620_101113995 | Ga0097620_1011139952 | 99 |
| 266 | 3300006931 | Ga0097620_101363753 | Ga0097620_1013637532 | 99 |
| 267 | 3300006931 | Ga0097620_102320234 | Ga0097620_1023202342 | 99 |
| 268 | 3300009093 | Ga0105240_10000398 | Ga0105240_1000039864 | 99 |
| 269 | 3300009093 | Ga0105240_10173346 | Ga0105240_101733465 | 99 |
| 270 | 3300009093 | Ga0105240_10283628 | Ga0105240_102836281 | 99 |
| 271 | 3300009093 | Ga0105240_10350445 | Ga0105240_103504452 | 99 |
| 272 | 3300009093 | Ga0105240_10386714 | Ga0105240_103867142 | 99 |
| 273 | 3300009094 | Ga0111539_10667745 | Ga0111539_106677452 | 99 |
| 274 | 3300009094 | Ga0111539_10990779 | Ga0111539_109907792 | 99 |
| 275 | 3300009098 | Ga0105245_10068029 | Ga0105245_100680293 | 99 |
| 276 | 3300009098 | Ga0105245_10901803 | Ga0105245_109018032 | 99 |
| 277 | 3300009101 | Ga0105247_10002304 | Ga0105247_100023048 | 99 |
| 278 | 3300009101 | Ga0105247_10204681 | Ga0105247_102046812 | 99 |
| 279 | 3300009101 | Ga0105247_11197407 | Ga0105247_111974072 | 99 |
| 280 | 3300009101 | Ga0105247_11490134 | Ga0105247_114901341 | 99 |
| 281 | 3300009147 | Ga0114129_10303837 | Ga0114129_103038372 | 99 |
| 282 | 3300009148 | Ga0105243_10711600 | Ga0105243_107116002 | 99 |
| 283 | 3300009148 | Ga0105243_11307499 | Ga0105243_113074991 | 99 |
| 284 | 3300009148 | Ga0105243_11603262 | Ga0105243_116032622 | 99 |
| 285 | 3300009148 | Ga0105243_12456353 | Ga0105243_124563532 | 99 |
| 286 | 3300009174 | Ga0105241_10409198 | Ga0105241_104091982 | 99 |
| 287 | 3300009174 | Ga0105241_10443550 | Ga0105241_104435502 | 99 |
| 288 | 3300009176 | Ga0105242_10055628 | Ga0105242_100556282 | 99 |
| 289 | 3300009176 | Ga0105242_10102158 | Ga0105242_101021582 | 99 |
| 290 | 3300009176 | Ga0105242_10134109 | Ga0105242_101341095 | 99 |
| 291 | 3300009176 | Ga0105242_10336272 | Ga0105242_103362722 | 99 |
| 292 | 3300009176 | Ga0105242_10515400 | Ga0105242_105154002 | 99 |
| 293 | 3300009176 | Ga0105242_10522285 | Ga0105242_105222852 | 99 |
| 294 | 3300009176 | Ga0105242_10634254 | Ga0105242_106342542 | 99 |
| 295 | 3300009176 | Ga0105242_10815531 | Ga0105242_108155312 | 99 |
| 296 | 3300009176 | Ga0105242_10912916 | Ga0105242_109129162 | 99 |
| 297 | 3300009176 | Ga0105242_11229804 | Ga0105242_112298042 | 99 |
| 298 | 3300009176 | Ga0105242_11444208 | Ga0105242_114442082 | 99 |
| 299 | 3300009177 | Ga0105248_10052937 | Ga0105248_100529375 | 99 |
| 300 | 3300009545 | Ga0105237_10018987 | Ga0105237_100189872 | 99 |
| 301 | 3300009545 | Ga0105237_10342700 | Ga0105237_103427002 | 99 |
| 302 | 3300009545 | Ga0105237_12443590 | Ga0105237_124435901 | 99 |
| 303 | 3300009551 | Ga0105238_11080276 | Ga0105238_110802762 | 99 |
| 304 | 3300009551 | Ga0105238_11200524 | Ga0105238_112005242 | 99 |
| 305 | 3300009551 | Ga0105238_11941973 | Ga0105238_119419731 | 99 |
| 306 | 3300009553 | Ga0105249_10000806 | Ga0105249_1000080611 | 99 |
| 307 | 3300009553 | Ga0105249_10025715 | Ga0105249_100257156 | 99 |
| 308 | 3300009553 | Ga0105249_10053538 | Ga0105249_100535385 | 99 |
| 309 | 3300009553 | Ga0105249_10075766 | Ga0105249_100757665 | 99 |
| 310 | 3300009553 | Ga0105249_10077951 | Ga0105249_100779514 | 99 |
| 311 | 3300009553 | Ga0105249_10308059 | Ga0105249_103080593 | 99 |
| 312 | 3300009553 | Ga0105249_10500048 | Ga0105249_105000482 | 99 |
| 313 | 3300009553 | Ga0105249_11267198 | Ga0105249_112671982 | 99 |
| 314 | 3300009553 | Ga0105249_11603973 | Ga0105249_116039732 | 99 |
| 315 | 3300009553 | Ga0105249_11961295 | Ga0105249_119612952 | 99 |
| 316 | 3300009553 | Ga0105249_12224878 | Ga0105249_122248782 | 99 |
| 317 | 3300010375 | Ga0105239_10188341 | Ga0105239_101883414 | 99 |
| 318 | 3300010375 | Ga0105239_10444888 | Ga0105239_104448882 | 99 |
| 319 | 3300010375 | Ga0105239_12305401 | Ga0105239_123054012 | 99 |
| 320 | 3300011119 | Ga0105246_10290685 | Ga0105246_102906852 | 99 |
| 321 | 3300011119 | Ga0105246_11464053 | Ga0105246_114640531 | 99 |
| 322 | 3300011119 | Ga0105246_12047322 | Ga0105246_120473222 | 99 |
| 323 | 3300013100 | Ga0157373_10041402 | Ga0157373_100414023 | 99 |
| 324 | 3300013100 | Ga0157373_10175037 | Ga0157373_101750371 | 99 |
| 325 | 3300013102 | Ga0157371_10036963 | Ga0157371_100369634 | 99 |
| 326 | 3300013102 | Ga0157371_10043957 | Ga0157371_100439573 | 99 |
| 327 | 3300013104 | Ga0157370_10011345 | Ga0157370_100113458 | 99 |
| 328 | 3300013104 | Ga0157370_10017050 | Ga0157370_100170504 | 99 |
| 329 | 3300013104 | Ga0157370_10022725 | Ga0157370_100227255 | 99 |
| 330 | 3300013104 | Ga0157370_10146677 | Ga0157370_101466773 | 99 |
| 331 | 3300013104 | Ga0157370_10565943 | Ga0157370_105659432 | 99 |
| 332 | 3300013105 | Ga0157369_10063647 | Ga0157369_100636473 | 99 |
| 333 | 3300013105 | Ga0157369_10100758 | Ga0157369_101007582 | 99 |
| 334 | 3300013105 | Ga0157369_10548844 | Ga0157369_105488442 | 99 |
| 335 | 3300013105 | Ga0157369_12193327 | Ga0157369_121933272 | 99 |
| 336 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001389 | 99 |
| 337 | 3300013296 | Ga0157374_10418497 | Ga0157374_104184972 | 99 |
| 338 | 3300013296 | Ga0157374_11124223 | Ga0157374_111242232 | 99 |
| 339 | 3300013296 | Ga0157374_11268781 | Ga0157374_112687812 | 99 |
| 340 | 3300013296 | Ga0157374_11708945 | Ga0157374_117089452 | 99 |
| 341 | 3300013297 | Ga0157378_10012000 | Ga0157378_100120005 | 99 |
| 342 | 3300013297 | Ga0157378_10025313 | Ga0157378_100253135 | 99 |
| 343 | 3300013297 | Ga0157378_10079785 | Ga0157378_100797852 | 99 |
| 344 | 3300013297 | Ga0157378_10292781 | Ga0157378_102927813 | 99 |
| 345 | 3300013297 | Ga0157378_10538693 | Ga0157378_105386932 | 99 |
| 346 | 3300013297 | Ga0157378_10580476 | Ga0157378_105804762 | 99 |
| 347 | 3300013297 | Ga0157378_11227888 | Ga0157378_112278882 | 99 |
| 348 | 3300013297 | Ga0157378_12243419 | Ga0157378_122434192 | 99 |
| 349 | 3300013306 | Ga0163162_10022373 | Ga0163162_100223732 | 99 |
| 350 | 3300013306 | Ga0163162_10024199 | Ga0163162_100241992 | 99 |
| 351 | 3300013306 | Ga0163162_10299937 | Ga0163162_102999373 | 99 |
| 352 | 3300013306 | Ga0163162_10350615 | Ga0163162_103506152 | 99 |
| 353 | 3300013306 | Ga0163162_12140365 | Ga0163162_121403651 | 99 |
| 354 | 3300013307 | Ga0157372_10016644 | Ga0157372_100166447 | 99 |
| 355 | 3300013307 | Ga0157372_10051126 | Ga0157372_100511265 | 99 |
| 356 | 3300013307 | Ga0157372_10219265 | Ga0157372_102192653 | 99 |
| 357 | 3300013307 | Ga0157372_10999635 | Ga0157372_109996352 | 99 |
| 358 | 3300013307 | Ga0157372_11106207 | Ga0157372_111062072 | 99 |
| 359 | 3300013307 | Ga0157372_12765166 | Ga0157372_127651662 | 99 |
| 360 | 3300013308 | Ga0157375_10001463 | Ga0157375_1000146325 | 99 |
| 361 | 3300013308 | Ga0157375_10005027 | Ga0157375_100050275 | 99 |
| 362 | 3300013308 | Ga0157375_10159900 | Ga0157375_101599004 | 99 |
| 363 | 3300013308 | Ga0157375_10645367 | Ga0157375_106453672 | 99 |
| 364 | 3300013308 | Ga0157375_11820428 | Ga0157375_118204282 | 99 |
| 365 | 3300013308 | Ga0157375_13347282 | Ga0157375_133472821 | 99 |
| 366 | 3300014325 | Ga0163163_10036393 | Ga0163163_100363935 | 99 |
| 367 | 3300014325 | Ga0163163_10300122 | Ga0163163_103001222 | 99 |
| 368 | 3300014325 | Ga0163163_10382911 | Ga0163163_103829112 | 99 |
| 369 | 3300014325 | Ga0163163_10393167 | Ga0163163_103931672 | 99 |
| 370 | 3300014325 | Ga0163163_10451802 | Ga0163163_104518022 | 99 |
| 371 | 3300014325 | Ga0163163_12045409 | Ga0163163_120454092 | 99 |
| 372 | 3300014325 | Ga0163163_12402330 | Ga0163163_124023301 | 99 |
| 373 | 3300014326 | Ga0157380_11073201 | Ga0157380_110732011 | 99 |
| 374 | 3300014326 | Ga0157380_11914737 | Ga0157380_119147372 | 99 |
| 375 | 3300014326 | Ga0157380_12414872 | Ga0157380_124148722 | 99 |
| 376 | 3300014326 | Ga0157380_13015544 | Ga0157380_130155441 | 99 |
| 377 | 3300014745 | Ga0157377_10059401 | Ga0157377_100594013 | 99 |
| 378 | 3300014745 | Ga0157377_10157358 | Ga0157377_101573582 | 99 |
| 379 | 3300014745 | Ga0157377_10596912 | Ga0157377_105969121 | 99 |
| 380 | 3300014968 | Ga0157379_10294026 | Ga0157379_102940263 | 99 |
| 381 | 3300014968 | Ga0157379_10433737 | Ga0157379_104337372 | 99 |
| 382 | 3300014968 | Ga0157379_10472215 | Ga0157379_104722152 | 99 |
| 383 | 3300014968 | Ga0157379_10581884 | Ga0157379_105818841 | 99 |
| 384 | 3300014968 | Ga0157379_11029031 | Ga0157379_110290311 | 99 |
| 385 | 3300014968 | Ga0157379_11058351 | Ga0157379_110583512 | 99 |
| 386 | 3300014968 | Ga0157379_11924823 | Ga0157379_119248232 | 99 |
| 387 | 3300014968 | Ga0157379_11942415 | Ga0157379_119424152 | 99 |
| 388 | 3300014969 | Ga0157376_10008523 | Ga0157376_100085232 | 99 |
| 389 | 3300014969 | Ga0157376_10022078 | Ga0157376_100220784 | 99 |
| 390 | 3300014969 | Ga0157376_10110820 | Ga0157376_101108203 | 99 |
| 391 | 3300014969 | Ga0157376_10135197 | Ga0157376_101351973 | 99 |
| 392 | 3300014969 | Ga0157376_10205661 | Ga0157376_102056613 | 99 |
| 393 | 3300014969 | Ga0157376_11314513 | Ga0157376_113145132 | 99 |
| 394 | 3300017792 | Ga0163161_10001357 | Ga0163161_1000135714 | 99 |
| 395 | 3300017792 | Ga0163161_10015767 | Ga0163161_100157675 | 99 |
| 396 | 3300017792 | Ga0163161_10052210 | Ga0163161_100522105 | 99 |
| 397 | 3300017792 | Ga0163161_10380022 | Ga0163161_103800222 | 99 |
| 398 | 3300020070 | Ga0206356_11242059 | Ga0206356_112420594 | 99 |
| 399 | 3300020078 | Ga0206352_10807008 | Ga0206352_108070082 | 99 |
| 400 | 3300020078 | Ga0206352_10905181 | Ga0206352_109051812 | 99 |
| 401 | 3300020610 | Ga0154015_1594150 | Ga0154015_15941502 | 99 |
| 402 | 3300025271 | Ga0207666_1058299 | Ga0207666_10582992 | 99 |
| 403 | 3300025315 | Ga0207697_10169011 | Ga0207697_101690112 | 99 |
| 404 | 3300025315 | Ga0207697_10239158 | Ga0207697_102391582 | 99 |
| 405 | 3300025321 | Ga0207656_10013408 | Ga0207656_100134085 | 99 |
| 406 | 3300025321 | Ga0207656_10177343 | Ga0207656_101773432 | 99 |
| 407 | 3300025893 | Ga0207682_10003346 | Ga0207682_100033462 | 99 |
| 408 | 3300025899 | Ga0207642_10027020 | Ga0207642_100270202 | 99 |
| 409 | 3300025899 | Ga0207642_10742750 | Ga0207642_107427502 | 99 |
| 410 | 3300025899 | Ga0207642_11103263 | Ga0207642_111032632 | 99 |
| 411 | 3300025900 | Ga0207710_10002332 | Ga0207710_100023326 | 99 |
| 412 | 3300025901 | Ga0207688_10158876 | Ga0207688_101588763 | 99 |
| 413 | 3300025903 | Ga0207680_10055057 | Ga0207680_100550572 | 99 |
| 414 | 3300025903 | Ga0207680_10148616 | Ga0207680_101486162 | 99 |
| 415 | 3300025903 | Ga0207680_11316308 | Ga0207680_113163082 | 99 |
| 416 | 3300025904 | Ga0207647_10020448 | Ga0207647_100204485 | 99 |
| 417 | 3300025905 | Ga0207685_10187861 | Ga0207685_101878612 | 99 |
| 418 | 3300025905 | Ga0207685_10381598 | Ga0207685_103815982 | 99 |
| 419 | 3300025907 | Ga0207645_10025677 | Ga0207645_100256772 | 99 |
| 420 | 3300025907 | Ga0207645_10058686 | Ga0207645_100586862 | 99 |
| 421 | 3300025907 | Ga0207645_10158170 | Ga0207645_101581701 | 99 |
| 422 | 3300025907 | Ga0207645_10373454 | Ga0207645_103734542 | 99 |
| 423 | 3300025907 | Ga0207645_10844175 | Ga0207645_108441751 | 99 |
| 424 | 3300025909 | Ga0207705_10732079 | Ga0207705_107320792 | 99 |
| 425 | 3300025909 | Ga0207705_11503884 | Ga0207705_115038841 | 99 |
| 426 | 3300025910 | Ga0207684_10515844 | Ga0207684_105158442 | 99 |
| 427 | 3300025911 | Ga0207654_10036156 | Ga0207654_100361563 | 99 |
| 428 | 3300025911 | Ga0207654_10616040 | Ga0207654_106160402 | 99 |
| 429 | 3300025911 | Ga0207654_11289273 | Ga0207654_112892731 | 99 |
| 430 | 3300025913 | Ga0207695_10000076 | Ga0207695_1000007642 | 99 |
| 431 | 3300025913 | Ga0207695_10000090 | Ga0207695_1000009042 | 99 |
| 432 | 3300025913 | Ga0207695_10015473 | Ga0207695_100154734 | 99 |
| 433 | 3300025913 | Ga0207695_10350323 | Ga0207695_103503232 | 99 |
| 434 | 3300025913 | Ga0207695_10946680 | Ga0207695_109466802 | 99 |
| 435 | 3300025913 | Ga0207695_11129584 | Ga0207695_111295841 | 99 |
| 436 | 3300025914 | Ga0207671_10037137 | Ga0207671_100371372 | 99 |
| 437 | 3300025914 | Ga0207671_10040157 | Ga0207671_100401574 | 99 |
| 438 | 3300025918 | Ga0207662_10027651 | Ga0207662_100276514 | 99 |
| 439 | 3300025919 | Ga0207657_10699411 | Ga0207657_106994112 | 99 |
| 440 | 3300025920 | Ga0207649_10277452 | Ga0207649_102774521 | 99 |
| 441 | 3300025920 | Ga0207649_10444890 | Ga0207649_104448901 | 99 |
| 442 | 3300025920 | Ga0207649_11145177 | Ga0207649_111451772 | 99 |
| 443 | 3300025923 | Ga0207681_10201509 | Ga0207681_102015092 | 99 |
| 444 | 3300025923 | Ga0207681_10272524 | Ga0207681_102725243 | 99 |
| 445 | 3300025923 | Ga0207681_10382313 | Ga0207681_103823131 | 99 |
| 446 | 3300025923 | Ga0207681_10786939 | Ga0207681_107869391 | 99 |
| 447 | 3300025923 | Ga0207681_11069873 | Ga0207681_110698732 | 99 |
| 448 | 3300025925 | Ga0207650_10074493 | Ga0207650_100744932 | 99 |
| 449 | 3300025925 | Ga0207650_10959364 | Ga0207650_109593642 | 99 |
| 450 | 3300025927 | Ga0207687_10195190 | Ga0207687_101951902 | 99 |
| 451 | 3300025931 | Ga0207644_10059737 | Ga0207644_100597373 | 99 |
| 452 | 3300025931 | Ga0207644_10072425 | Ga0207644_100724254 | 99 |
| 453 | 3300025931 | Ga0207644_10129993 | Ga0207644_101299933 | 99 |
| 454 | 3300025932 | Ga0207690_10024446 | Ga0207690_100244464 | 99 |
| 455 | 3300025933 | Ga0207706_10006478 | Ga0207706_100064783 | 99 |
| 456 | 3300025933 | Ga0207706_10163522 | Ga0207706_101635223 | 99 |
| 457 | 3300025933 | Ga0207706_10205207 | Ga0207706_102052072 | 99 |
| 458 | 3300025933 | Ga0207706_10675849 | Ga0207706_106758492 | 99 |
| 459 | 3300025934 | Ga0207686_10127335 | Ga0207686_101273352 | 99 |
| 460 | 3300025934 | Ga0207686_10744788 | Ga0207686_107447882 | 99 |
| 461 | 3300025934 | Ga0207686_10981767 | Ga0207686_109817672 | 99 |
| 462 | 3300025934 | Ga0207686_11247268 | Ga0207686_112472682 | 99 |
| 463 | 3300025935 | Ga0207709_10209441 | Ga0207709_102094412 | 99 |
| 464 | 3300025935 | Ga0207709_10375537 | Ga0207709_103755372 | 99 |
| 465 | 3300025936 | Ga0207670_10014554 | Ga0207670_100145544 | 99 |
| 466 | 3300025937 | Ga0207669_10053018 | Ga0207669_100530184 | 99 |
| 467 | 3300025937 | Ga0207669_10828706 | Ga0207669_108287062 | 99 |
| 468 | 3300025938 | Ga0207704_10130848 | Ga0207704_101308482 | 99 |
| 469 | 3300025938 | Ga0207704_10160734 | Ga0207704_101607342 | 99 |
| 470 | 3300025938 | Ga0207704_10308805 | Ga0207704_103088052 | 99 |
| 471 | 3300025938 | Ga0207704_10354971 | Ga0207704_103549712 | 99 |
| 472 | 3300025938 | Ga0207704_10573488 | Ga0207704_105734882 | 99 |
| 473 | 3300025938 | Ga0207704_10592339 | Ga0207704_105923391 | 99 |
| 474 | 3300025938 | Ga0207704_10754359 | Ga0207704_107543592 | 99 |
| 475 | 3300025940 | Ga0207691_10049197 | Ga0207691_100491972 | 99 |
| 476 | 3300025940 | Ga0207691_10596608 | Ga0207691_105966082 | 99 |
| 477 | 3300025940 | Ga0207691_10601825 | Ga0207691_106018252 | 99 |
| 478 | 3300025941 | Ga0207711_10092009 | Ga0207711_100920092 | 99 |
| 479 | 3300025941 | Ga0207711_10182599 | Ga0207711_101825992 | 99 |
| 480 | 3300025942 | Ga0207689_10010127 | Ga0207689_100101276 | 99 |
| 481 | 3300025942 | Ga0207689_10014249 | Ga0207689_100142496 | 99 |
| 482 | 3300025942 | Ga0207689_10045231 | Ga0207689_100452315 | 99 |
| 483 | 3300025942 | Ga0207689_10075403 | Ga0207689_100754033 | 99 |
| 484 | 3300025942 | Ga0207689_10167478 | Ga0207689_101674783 | 99 |
| 485 | 3300025942 | Ga0207689_10182503 | Ga0207689_101825033 | 99 |
| 486 | 3300025942 | Ga0207689_10388301 | Ga0207689_103883012 | 99 |
| 487 | 3300025942 | Ga0207689_11138320 | Ga0207689_111383202 | 99 |
| 488 | 3300025944 | Ga0207661_10019703 | Ga0207661_100197035 | 99 |
| 489 | 3300025944 | Ga0207661_10134049 | Ga0207661_101340492 | 99 |
| 490 | 3300025945 | Ga0207679_10067722 | Ga0207679_100677224 | 99 |
| 491 | 3300025945 | Ga0207679_11540553 | Ga0207679_115405532 | 99 |
| 492 | 3300025945 | Ga0207679_11893687 | Ga0207679_118936872 | 99 |
| 493 | 3300025949 | Ga0207667_10000453 | Ga0207667_1000045351 | 99 |
| 494 | 3300025949 | Ga0207667_10003602 | Ga0207667_100036028 | 99 |
| 495 | 3300025949 | Ga0207667_10848084 | Ga0207667_108480842 | 99 |
| 496 | 3300025960 | Ga0207651_10568917 | Ga0207651_105689171 | 99 |
| 497 | 3300025960 | Ga0207651_10845061 | Ga0207651_108450612 | 99 |
| 498 | 3300025960 | Ga0207651_11274784 | Ga0207651_112747842 | 99 |
| 499 | 3300025960 | Ga0207651_11459083 | Ga0207651_114590832 | 99 |
| 500 | 3300025960 | Ga0207651_11486572 | Ga0207651_114865722 | 99 |
| 501 | 3300025960 | Ga0207651_11550697 | Ga0207651_115506972 | 99 |
| 502 | 3300025961 | Ga0207712_10016968 | Ga0207712_100169682 | 99 |
| 503 | 3300025961 | Ga0207712_10082309 | Ga0207712_100823093 | 99 |
| 504 | 3300025961 | Ga0207712_10082897 | Ga0207712_100828971 | 99 |
| 505 | 3300025961 | Ga0207712_10318884 | Ga0207712_103188842 | 99 |
| 506 | 3300025961 | Ga0207712_10407934 | Ga0207712_104079342 | 99 |
| 507 | 3300025961 | Ga0207712_10441535 | Ga0207712_104415352 | 99 |
| 508 | 3300025972 | Ga0207668_10074158 | Ga0207668_100741582 | 99 |
| 509 | 3300025972 | Ga0207668_10149486 | Ga0207668_101494864 | 99 |
| 510 | 3300025972 | Ga0207668_10161771 | Ga0207668_101617712 | 99 |
| 511 | 3300025972 | Ga0207668_10788732 | Ga0207668_107887322 | 99 |
| 512 | 3300025981 | Ga0207640_10016977 | Ga0207640_100169779 | 99 |
| 513 | 3300025981 | Ga0207640_10020295 | Ga0207640_100202953 | 99 |
| 514 | 3300025981 | Ga0207640_10766513 | Ga0207640_107665132 | 99 |
| 515 | 3300025981 | Ga0207640_11296657 | Ga0207640_112966571 | 99 |
| 516 | 3300025986 | Ga0207658_10051578 | Ga0207658_100515782 | 99 |
| 517 | 3300025986 | Ga0207658_10348489 | Ga0207658_103484892 | 99 |
| 518 | 3300025986 | Ga0207658_10646178 | Ga0207658_106461782 | 99 |
| 519 | 3300025986 | Ga0207658_10752020 | Ga0207658_107520202 | 99 |
| 520 | 3300025986 | Ga0207658_10982032 | Ga0207658_109820321 | 99 |
| 521 | 3300025986 | Ga0207658_11852353 | Ga0207658_118523531 | 99 |
| 522 | 3300026023 | Ga0207677_10192753 | Ga0207677_101927532 | 99 |
| 523 | 3300026023 | Ga0207677_11416784 | Ga0207677_114167841 | 99 |
| 524 | 3300026023 | Ga0207677_11726196 | Ga0207677_117261962 | 99 |
| 525 | 3300026023 | Ga0207677_12206673 | Ga0207677_122066731 | 99 |
| 526 | 3300026035 | Ga0207703_10835435 | Ga0207703_108354352 | 99 |
| 527 | 3300026035 | Ga0207703_11346948 | Ga0207703_113469482 | 99 |
| 528 | 3300026041 | Ga0207639_10003633 | Ga0207639_1000363319 | 99 |
| 529 | 3300026041 | Ga0207639_10022533 | Ga0207639_100225333 | 99 |
| 530 | 3300026041 | Ga0207639_10268603 | Ga0207639_102686031 | 99 |
| 531 | 3300026041 | Ga0207639_10822112 | Ga0207639_108221122 | 99 |
| 532 | 3300026041 | Ga0207639_11005787 | Ga0207639_110057872 | 99 |
| 533 | 3300026041 | Ga0207639_11159955 | Ga0207639_111599552 | 99 |
| 534 | 3300026041 | Ga0207639_11951241 | Ga0207639_119512411 | 99 |
| 535 | 3300026041 | Ga0207639_12158344 | Ga0207639_121583441 | 99 |
| 536 | 3300026067 | Ga0207678_11086737 | Ga0207678_110867372 | 99 |
| 537 | 3300026075 | Ga0207708_10887412 | Ga0207708_108874122 | 99 |
| 538 | 3300026088 | Ga0207641_10025754 | Ga0207641_100257546 | 99 |
| 539 | 3300026088 | Ga0207641_10043824 | Ga0207641_100438243 | 99 |
| 540 | 3300026088 | Ga0207641_10091863 | Ga0207641_100918633 | 99 |
| 541 | 3300026088 | Ga0207641_10138043 | Ga0207641_101380434 | 99 |
| 542 | 3300026088 | Ga0207641_10393151 | Ga0207641_103931512 | 99 |
| 543 | 3300026088 | Ga0207641_10545068 | Ga0207641_105450682 | 99 |
| 544 | 3300026088 | Ga0207641_10841836 | Ga0207641_108418362 | 99 |
| 545 | 3300026088 | Ga0207641_11232996 | Ga0207641_112329962 | 99 |
| 546 | 3300026089 | Ga0207648_10009109 | Ga0207648_100091095 | 99 |
| 547 | 3300026089 | Ga0207648_10028462 | Ga0207648_100284623 | 99 |
| 548 | 3300026089 | Ga0207648_10176788 | Ga0207648_101767882 | 99 |
| 549 | 3300026089 | Ga0207648_10232893 | Ga0207648_102328932 | 99 |
| 550 | 3300026089 | Ga0207648_10242935 | Ga0207648_102429353 | 99 |
| 551 | 3300026089 | Ga0207648_10247850 | Ga0207648_102478502 | 99 |
| 552 | 3300026089 | Ga0207648_10967696 | Ga0207648_109676962 | 99 |
| 553 | 3300026089 | Ga0207648_11127784 | Ga0207648_111277842 | 99 |
| 554 | 3300026095 | Ga0207676_10067110 | Ga0207676_100671104 | 99 |
| 555 | 3300026095 | Ga0207676_10083440 | Ga0207676_100834402 | 99 |
| 556 | 3300026095 | Ga0207676_10363238 | Ga0207676_103632382 | 99 |
| 557 | 3300026095 | Ga0207676_10529410 | Ga0207676_105294102 | 99 |
| 558 | 3300026095 | Ga0207676_10680396 | Ga0207676_106803961 | 99 |
| 559 | 3300026116 | Ga0207674_10009949 | Ga0207674_100099497 | 99 |
| 560 | 3300026116 | Ga0207674_10022667 | Ga0207674_100226676 | 99 |
| 561 | 3300026116 | Ga0207674_10025546 | Ga0207674_100255463 | 99 |
| 562 | 3300026116 | Ga0207674_10147351 | Ga0207674_101473511 | 99 |
| 563 | 3300026116 | Ga0207674_10169071 | Ga0207674_101690712 | 99 |
| 564 | 3300026116 | Ga0207674_10171366 | Ga0207674_101713663 | 99 |
| 565 | 3300026118 | Ga0207675_100049685 | Ga0207675_1000496854 | 99 |
| 566 | 3300026118 | Ga0207675_100068632 | Ga0207675_1000686323 | 99 |
| 567 | 3300026118 | Ga0207675_100119254 | Ga0207675_1001192542 | 99 |
| 568 | 3300026118 | Ga0207675_100303650 | Ga0207675_1003036502 | 99 |
| 569 | 3300026118 | Ga0207675_100605687 | Ga0207675_1006056872 | 99 |
| 570 | 3300026118 | Ga0207675_102223409 | Ga0207675_1022234092 | 99 |
| 571 | 3300026121 | Ga0207683_10024454 | Ga0207683_100244542 | 99 |
| 572 | 3300026121 | Ga0207683_10097053 | Ga0207683_100970535 | 99 |
| 573 | 3300026121 | Ga0207683_10236552 | Ga0207683_102365523 | 99 |
| 574 | 3300026121 | Ga0207683_10315533 | Ga0207683_103155332 | 99 |
| 575 | 3300026121 | Ga0207683_10583777 | Ga0207683_105837772 | 99 |
| 576 | 3300026142 | Ga0207698_10013166 | Ga0207698_100131663 | 99 |
| 577 | 3300026142 | Ga0207698_10136904 | Ga0207698_101369043 | 99 |
| 578 | 3300026142 | Ga0207698_10142388 | Ga0207698_101423882 | 99 |
| 579 | 3300026142 | Ga0207698_10232664 | Ga0207698_102326642 | 99 |
| 580 | 3300026142 | Ga0207698_10795200 | Ga0207698_107952002 | 99 |
| 581 | 3300026142 | Ga0207698_10935954 | Ga0207698_109359541 | 99 |
| 582 | 3300026142 | Ga0207698_11010308 | Ga0207698_110103081 | 99 |
| 583 | 3300026142 | Ga0207698_11320253 | Ga0207698_113202532 | 99 |
| 584 | 3300027907 | Ga0207428_10733645 | Ga0207428_107336452 | 99 |
| 585 | 3300028379 | Ga0268266_11387499 | Ga0268266_113874992 | 99 |
| 586 | 3300028379 | Ga0268266_11635247 | Ga0268266_116352472 | 99 |
| 587 | 3300028380 | Ga0268265_10154569 | Ga0268265_101545693 | 99 |
| 588 | 3300028380 | Ga0268265_11076656 | Ga0268265_110766561 | 99 |
| 589 | 3300028380 | Ga0268265_11280978 | Ga0268265_112809782 | 99 |
| 590 | 3300028380 | Ga0268265_11286890 | Ga0268265_112868901 | 99 |
| 591 | 3300028380 | Ga0268265_11542435 | Ga0268265_115424352 | 99 |
| 592 | 3300028380 | Ga0268265_12395546 | Ga0268265_123955461 | 99 |
| 593 | 3300028381 | Ga0268264_10015090 | Ga0268264_100150905 | 99 |
| 594 | 3300028381 | Ga0268264_10061228 | Ga0268264_100612282 | 99 |
| 595 | 3300028381 | Ga0268264_10061558 | Ga0268264_100615581 | 99 |
| 596 | 3300028381 | Ga0268264_10274759 | Ga0268264_102747592 | 99 |
| 597 | 3300028381 | Ga0268264_10356042 | Ga0268264_103560422 | 99 |
| 598 | 3300028381 | Ga0268264_10378729 | Ga0268264_103787291 | 99 |
| 599 | 3300028381 | Ga0268264_10905782 | Ga0268264_109057822 | 99 |
| 600 | 3300028381 | Ga0268264_11184690 | Ga0268264_111846901 | 99 |
| 601 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000011747 | 99 |
| 602 | 3300031251 | Ga0265327_10000244 | Ga0265327_10000244104 | 99 |
| 603 | 3300031456 | Ga0307513_10184519 | Ga0307513_101845192 | 99 |
| 604 | 3300031730 | Ga0307516_10677783 | Ga0307516_106777832 | 99 |
| 605 | 3300031852 | Ga0307410_10133130 | Ga0307410_101331302 | 99 |
| 606 | 3300031852 | Ga0307410_10259089 | Ga0307410_102590892 | 99 |
| 607 | 3300031901 | Ga0307406_11795591 | Ga0307406_117955911 | 99 |
| 608 | 3300031901 | Ga0307406_12063053 | Ga0307406_120630531 | 99 |
| 609 | 3300031903 | Ga0307407_10489098 | Ga0307407_104890982 | 99 |
| 610 | 3300031911 | Ga0307412_11035174 | Ga0307412_110351741 | 99 |
| 611 | 3300031911 | Ga0307412_12087980 | Ga0307412_120879801 | 99 |
| 612 | 3300031995 | Ga0307409_102113213 | Ga0307409_1021132131 | 99 |
| 613 | 3300032002 | Ga0307416_103535673 | Ga0307416_1035356731 | 99 |
| 614 | 3300032126 | Ga0307415_100359048 | Ga0307415_1003590482 | 99 |
| 615 | 3300033180 | Ga0307510_10000380 | Ga0307510_1000038029 | 99 |
| 616 | 3300035086 | Ga0373934_0362481 | Ga0373934_0362481_289_588 | 99 |
| 617 | 3300035089 | Ga0373944_0058556 | Ga0373944_0058556_792_1091 | 99 |
| 618 | 3300035092 | Ga0373952_0052040 | Ga0373952_0052040_660_959 | 99 |
| 619 | 3300035111 | Ga0373923_0362113 | Ga0373923_0362113_47_346 | 99 |
| 620 | 3300035113 | Ga0373936_0177866 | Ga0373936_0177866_162_461 | 99 |
| 621 | 3300035119 | Ga0373956_0041135 | Ga0373956_0041135_1687_1986 | 99 |
| 622 | 3300035170 | Ga0373943_0248315 | Ga0373943_0248315_131_430 | 99 |
| 623 | 3300035170 | Ga0373943_0913604 | Ga0373943_0913604_55_354 | 99 |
| 624 | 3300035171 | Ga0373946_0183334 | Ga0373946_0183334_467_766 | 99 |
| 625 | 3300035172 | Ga0373955_0466007 | Ga0373955_0466007_300_599 | 99 |
| 626 | 3300035172 | Ga0373955_0929755 | Ga0373955_0929755_54_353 | 99 |
| 627 | 3300035410 | Ga0373924_0042226 | Ga0373924_0042226_442_741 | 99 |
| 628 | 3300035691 | Ga0373931_0337062 | Ga0373931_0337062_606_905 | 99 |
| 629 | 3300035692 | Ga0373935_0121189 | Ga0373935_0121189_1107_1406 | 99 |
| 630 | 3300035692 | Ga0373935_1323371 | Ga0373935_1323371_223_522 | 99 |
| 631 | 3300035724 | Ga0373933_0073414 | Ga0373933_0073414_964_1263 | 99 |
| 632 | 3300035725 | Ga0373947_0572452 | Ga0373947_0572452_321_620 | 99 |
| 633 | 3300035725 | Ga0373947_0957318 | Ga0373947_0957318_227_526 | 99 |
| 634 | 3300036401 | Ga0373937_0002462 | Ga0373937_0002462_5584_5883 | 99 |
| 635 | 3300037068 | Ga0373925_0228924 | Ga0373925_0228924_375_674 | 99 |
| 636 | 3300037418 | Ga0395900_0017444 | Ga0395900_0017444_5869_6168 | 99 |
| 637 | 3300037466 | Ga0395898_0002718 | Ga0395898_0002718_18569_18868 | 99 |
| 638 | 3300038443 | Ga0395901_0158362 | Ga0395901_0158362_727_1026 | 99 |
| 639 | 3300039447 | Ga0436361_1211924 | Ga0436361_1211924_1506_1805 | 99 |
| 640 | 3300041404 | Ga0439436_0186659 | Ga0439436_0186659_75_374 | 99 |
| 641 | 3300041406 | Ga0439439_0031503 | Ga0439439_0031503_305_604 | 99 |
| 642 | 3300041411 | Ga0439466_0112609 | Ga0439466_0112609_432_731 | 99 |
| 643 | 3300041444 | Ga0451790_27755 | Ga0451790_27755_259_561 | 99 |
| 644 | 3300041444 | Ga0451790_41286 | Ga0451790_41286_98_400 | 99 |
| 645 | 3300041451 | Ga0451791_1111960 | Ga0451791_1111960_129_428 | 99 |
| 646 | 3300041451 | Ga0451791_1436515 | Ga0451791_1436515_824_1123 | 99 |
| 647 | 3300041452 | Ga0451793_0068821 | Ga0451793_0068821_186_485 | 99 |
| 648 | 3300041453 | Ga0451797_0340668 | Ga0451797_0340668_368_667 | 99 |
| 649 | 3300041458 | Ga0451798_0476184 | Ga0451798_0476184_56_355 | 99 |
| 650 | 3300041458 | Ga0451798_0824705 | Ga0451798_0824705_37_339 | 99 |
| 651 | 3300041458 | Ga0451798_1169930 | Ga0451798_1169930_300_602 | 99 |
| 652 | 3300041459 | Ga0451800_0032641 | Ga0451800_0032641_349_651 | 99 |
| 653 | 3300041459 | Ga0451800_1619468 | Ga0451800_1619468_382_681 | 99 |
| 654 | 3300041460 | Ga0451802_0502259 | Ga0451802_0502259_217_516 | 99 |
| 655 | 3300041460 | Ga0451802_2117121 | Ga0451802_2117121_190_489 | 99 |
| 656 | 3300041486 | Ga0451807_0407082 | Ga0451807_0407082_323_622 | 99 |
| 657 | 3300041491 | Ga0451833_0686487 | Ga0451833_0686487_338_637 | 99 |
| 658 | 3300041496 | Ga0451839_0104913 | Ga0451839_0104913_27_326 | 99 |
| 659 | 3300041509 | Ga0451843_1604042 | Ga0451843_1604042_815_1114 | 99 |
| 660 | 3300041509 | Ga0451843_1614837 | Ga0451843_1614837_50_349 | 99 |
| 661 | 3300041997 | Ga0439431_0132096 | Ga0439431_0132096_360_659 | 99 |
| 662 | 3300042001 | Ga0439441_008819 | Ga0439441_008819_618_917 | 99 |
| 663 | 3300042003 | Ga0439443_037532 | Ga0439443_037532_455_754 | 99 |
| 664 | 3300042005 | Ga0439448_0216964 | Ga0439448_0216964_77_376 | 99 |
| 665 | 3300042006 | Ga0439432_123592 | Ga0439432_123592_259_558 | 99 |
| 666 | 3300042007 | Ga0439449_0078529 | Ga0439449_0078529_799_1098 | 99 |
| 667 | 3300042010 | Ga0439452_025585 | Ga0439452_025585_540_839 | 99 |
| 668 | 3300042014 | Ga0439457_062867 | Ga0439457_062867_300_599 | 99 |
| 669 | 3300042015 | Ga0439462_0015306 | Ga0439462_0015306_1637_1936 | 99 |
| 670 | 3300042122 | Ga0450920_054549 | Ga0450920_054549_32_331 | 99 |
| 671 | 3300042125 | Ga0450923_013606 | Ga0450923_013606_229_528 | 99 |
| 672 | 3300042131 | Ga0450894_006068 | Ga0450894_006068_970_1269 | 99 |
| 673 | 3300042134 | Ga0450898_004710 | Ga0450898_004710_844_1143 | 99 |
| 674 | 3300042145 | Ga0450906_059401 | Ga0450906_059401_190_489 | 99 |
| 675 | 3300042435 | Ga0439434_0002227 | Ga0439434_0002227_637_936 | 99 |
| 676 | 3300042437 | Ga0439444_0116582 | Ga0439444_0116582_59_358 | 99 |
| 677 | 3300042531 | Ga0450918_061096 | Ga0450918_061096_60_359 | 99 |
| 678 | 3300044673 | Ga0453683_0417783 | Ga0453683_0417783_281_580 | 99 |
| 679 | 3300044683 | Ga0466965_0097561 | Ga0466965_0097561_482_781 | 99 |
| 680 | 3300044706 | Ga0466964_0333770 | Ga0466964_0333770_267_566 | 99 |
| 681 | 3300044712 | Ga0453684_0435002 | Ga0453684_0435002_1039_1449 | 99 |
| 682 | 3300044735 | Ga0466968_0672124 | Ga0466968_0672124_20_319 | 99 |
| 683 | 3300044765 | Ga0466970_0802014 | Ga0466970_0802014_62_361 | 99 |
| 684 | 3300045049 | Ga0466959_1068377 | Ga0466959_1068377_157_456 | 99 |
| 685 | 3300046454 | Ga0495592_0058314 | Ga0495592_0058314_2150_2449 | 99 |
| 686 | 3300046455 | Ga0495603_0256095 | Ga0495603_0256095_117_416 | 99 |
| 687 | 3300046460 | Ga0495638_0083919 | Ga0495638_0083919_44_343 | 99 |
| 688 | 3300046460 | Ga0495638_0223917 | Ga0495638_0223917_23_322 | 99 |
| 689 | 3300046462 | Ga0495651_0964554 | Ga0495651_0964554_82_381 | 99 |
| 690 | 3300046463 | Ga0495653_0072724 | Ga0495653_0072724_2116_2415 | 99 |
| 691 | 3300046471 | Ga0495650_0024366 | Ga0495650_0024366_2056_2355 | 99 |
| 692 | 3300046472 | Ga0495580_0262447 | Ga0495580_0262447_554_853 | 99 |
| 693 | 3300046472 | Ga0495580_0766867 | Ga0495580_0766867_11_310 | 99 |
| 694 | 3300046473 | Ga0495582_0388122 | Ga0495582_0388122_324_623 | 99 |
| 695 | 3300046499 | Ga0495594_0471937 | Ga0495594_0471937_114_413 | 99 |
| 696 | 3300046507 | Ga0495606_0006493 | Ga0495606_0006493_2946_3245 | 99 |
| 697 | 3300046511 | Ga0495608_0012072 | Ga0495608_0012072_3080_3379 | 99 |
| 698 | 3300046514 | Ga0495618_0020169 | Ga0495618_0020169_1741_2040 | 99 |
| 699 | 3300046516 | Ga0495628_0008937 | Ga0495628_0008937_7769_8068 | 99 |
| 700 | 3300046517 | Ga0495630_0017830 | Ga0495630_0017830_4535_4834 | 99 |
| 701 | 3300046517 | Ga0495630_1173261 | Ga0495630_1173261_48_347 | 99 |
| 702 | 3300046529 | Ga0495652_0566666 | Ga0495652_0566666_172_471 | 99 |
| 703 | 3300046533 | Ga0495640_0024578 | Ga0495640_0024578_2336_2635 | 99 |
| 704 | 3300046536 | Ga0495587_0115395 | Ga0495587_0115395_1015_1314 | 99 |
| 705 | 3300046537 | Ga0495598_0047315 | Ga0495598_0047315_62_364 | 99 |
| 706 | 3300046537 | Ga0495598_0412749 | Ga0495598_0412749_11_310 | 99 |
| 707 | 3300046559 | Ga0495667_0041562 | Ga0495667_0041562_309_608 | 99 |
| 708 | 3300046642 | Ga0495634_0023809 | Ga0495634_0023809_41_340 | 99 |
| 709 | 3300046660 | Ga0495625_0344288 | Ga0495625_0344288_262_561 | 99 |
| 710 | 3300046663 | Ga0495635_0033509 | Ga0495635_0033509_588_887 | 99 |
| 711 | 3300046675 | Ga0495657_0324594 | Ga0495657_0324594_524_823 | 99 |
| 712 | 3300046681 | Ga0495647_0408132 | Ga0495647_0408132_200_499 | 99 |
| 713 | 3300046689 | Ga0495613_0151946 | Ga0495613_0151946_10_309 | 99 |
| 714 | 3300046689 | Ga0495613_0316598 | Ga0495613_0316598_531_830 | 99 |
| 715 | 3300046691 | Ga0495670_0031502 | Ga0495670_0031502_965_1264 | 99 |
| 716 | 3300046694 | Ga0495649_0332965 | Ga0495649_0332965_190_489 | 99 |
| 717 | 3300046694 | Ga0495649_0606467 | Ga0495649_0606467_161_460 | 99 |
| 718 | 3300046809 | Ga0495600_0257975 | Ga0495600_0257975_711_1010 | 99 |
| 719 | 3300047317 | Ga0495604_0070404 | Ga0495604_0070404_1554_1853 | 99 |
| 720 | 3300047318 | Ga0495636_0174575 | Ga0495636_0174575_659_958 | 99 |
| 721 | 3300047319 | Ga0495674_0303326 | Ga0495674_0303326_12_311 | 99 |
| 722 | 3300047321 | Ga0495676_0504416 | Ga0495676_0504416_323_622 | 99 |
| 723 | 3300047322 | Ga0495680_0035982 | Ga0495680_0035982_2042_2341 | 99 |
| 724 | 3300047472 | Ga0495686_0231403 | Ga0495686_0231403_60_359 | 99 |
| 725 | 3300048903 | Ga0496100_0763862 | Ga0496100_0763862_280_579 | 99 |
| 726 | 3300048904 | Ga0496101_0111499 | Ga0496101_0111499_1577_1876 | 99 |
| 727 | 3300048907 | Ga0496104_0731446 | Ga0496104_0731446_210_509 | 99 |
| 728 | 3300048908 | Ga0496105_0930522 | Ga0496105_0930522_333_632 | 99 |
| 729 | 3300048912 | Ga0496109_0900193 | Ga0496109_0900193_452_751 | 99 |
| 730 | 3300048914 | Ga0496111_0747131 | Ga0496111_0747131_52_351 | 99 |
| 731 | 3300048917 | Ga0496114_0294487 | Ga0496114_0294487_416_715 | 99 |
| 732 | 3300049127 | Ga0501306_007578 | Ga0501306_007578_372_671 | 99 |
| 733 | 3300049134 | Ga0501345_07567 | Ga0501345_07567_86_385 | 99 |
| 734 | 3300049527 | Ga0501311_072167 | Ga0501311_072167_191_490 | 99 |
| 735 | 3300049529 | Ga0501313_022447 | Ga0501313_022447_127_426 | 99 |
| 736 | 3300049531 | Ga0501315_079438 | Ga0501315_079438_180_479 | 99 |
| 737 | 3300049532 | Ga0501316_046441 | Ga0501316_046441_149_448 | 99 |
| 738 | 3300049536 | Ga0501320_012948 | Ga0501320_012948_446_745 | 99 |
| 739 | 3300049537 | Ga0501321_018570 | Ga0501321_018570_396_695 | 99 |
| 740 | 3300049552 | Ga0501336_003998 | Ga0501336_003998_489_788 | 99 |
| 741 | 3300049568 | Ga0501031_0005772 | Ga0501031_0005772_5319_5618 | 99 |
| 742 | 3300049570 | Ga0501033_0114330 | Ga0501033_0114330_815_1114 | 99 |
| 743 | 3300049571 | Ga0501034_0038226 | Ga0501034_0038226_463_762 | 99 |
| 744 | 3300049572 | Ga0501036_0009955 | Ga0501036_0009955_2784_3083 | 99 |
| 745 | 3300049573 | Ga0501037_0032648 | Ga0501037_0032648_1677_1976 | 99 |
| 746 | 3300049574 | Ga0501038_0005905 | Ga0501038_0005905_2937_3236 | 99 |
| 747 | 3300049575 | Ga0501039_0013024 | Ga0501039_0013024_2855_3154 | 99 |
| 748 | 3300049579 | Ga0501043_0009337 | Ga0501043_0009337_5294_5593 | 99 |
| 749 | 3300049580 | Ga0501046_0052113 | Ga0501046_0052113_347_646 | 99 |
| 750 | 3300049581 | Ga0501047_0443886 | Ga0501047_0443886_194_493 | 99 |
| 751 | 3300049581 | Ga0501047_0864956 | Ga0501047_0864956_78_377 | 99 |
| 752 | 3300049588 | Ga0501072_0348421 | Ga0501072_0348421_673_972 | 99 |
| 753 | 3300049589 | Ga0501073_0069872 | Ga0501073_0069872_1900_2199 | 99 |
| 754 | 3300049742 | Ga0501080_0032906 | Ga0501080_0032906_2536_2835 | 99 |
| 755 | 3300049771 | Ga0501274_038594 | Ga0501274_038594_143_442 | 99 |
| 756 | 3300049822 | Ga0501035_0050477 | Ga0501035_0050477_709_1008 | 99 |
| 757 | 3300049823 | Ga0501044_0004248 | Ga0501044_0004248_6273_6572 | 99 |
| 758 | 3300049823 | Ga0501044_0037946 | Ga0501044_0037946_2244_2543 | 99 |
| 759 | 3300049823 | Ga0501044_0123100 | Ga0501044_0123100_748_1047 | 99 |
| 760 | 3300050493 | nmdc:mga0k408_399816_c1 | nmdc:mga0k408_399816_c1_462_761 | 99 |
| 761 | 3300050493 | nmdc:mga0k408_62578_c1 | nmdc:mga0k408_62578_c1_1288_1587 | 99 |
| 762 | 3300050496 | nmdc:mga07m45_379224_c1 | nmdc:mga07m45_379224_c1_320_619 | 99 |
| 763 | 3300050496 | nmdc:mga07m45_69219_c1 | nmdc:mga07m45_69219_c1_1019_1318 | 99 |
| 764 | 3300050496 | nmdc:mga07m45_735907_c1 | nmdc:mga07m45_735907_c1_74_373 | 99 |
| 765 | 3300050508 | nmdc:mga09592_471205_c1 | nmdc:mga09592_471205_c1_757_1056 | 99 |
| 766 | 3300050508 | nmdc:mga09592_656665_c1 | nmdc:mga09592_656665_c1_112_411 | 99 |
| 767 | 3300050508 | nmdc:mga09592_70262_c1 | nmdc:mga09592_70262_c1_2525_2824 | 99 |
| 768 | 3300050508 | nmdc:mga09592_926671_c1 | nmdc:mga09592_926671_c1_342_641 | 99 |
| 769 | 3300050509 | nmdc:mga0qj67_1010971_c1 | nmdc:mga0qj67_1010971_c1_186_485 | 99 |
| 770 | 3300050509 | nmdc:mga0qj67_85711_c1 | nmdc:mga0qj67_85711_c1_314_613 | 99 |
| 771 | 3300050510 | nmdc:mga06r32_145795_c1 | nmdc:mga06r32_145795_c1_742_1041 | 99 |
| 772 | 3300050512 | nmdc:mga0n895_1080853_c1 | nmdc:mga0n895_1080853_c1_63_362 | 99 |
| 773 | 3300050512 | nmdc:mga0n895_485544_c1 | nmdc:mga0n895_485544_c1_716_1015 | 99 |
| 774 | 3300050515 | nmdc:mga0a205_797619_c1 | nmdc:mga0a205_797619_c1_353_652 | 99 |
| 775 | 3300053085 | Ga0495619_0017003 | Ga0495619_0017003_474_773 | 99 |
| 776 | 3300053108 | Ga0500562_013235 | Ga0500562_013235_353_652 | 99 |
| 777 | 3300053117 | Ga0500593_103971 | Ga0500593_103971_457_756 | 99 |
| 778 | 3300053146 | Ga0500588_0236510 | Ga0500588_0236510_194_493 | 99 |
| 779 | 3300053153 | Ga0500616_0139029 | Ga0500616_0139029_313_612 | 99 |
| 780 | 3300053156 | Ga0500622_0391746 | Ga0500622_0391746_20_319 | 99 |
| 781 | 3300053727 | Ga0500611_000032 | Ga0500611_000032_81392_81691 | 99 |
| 782 | 3300053730 | Ga0500645_051002 | Ga0500645_051002_467_766 | 99 |
| 783 | 3300059511 | Ga0587091_224114 | Ga0587091_224114_87_386 | 99 |
| 784 | 3300059624 | Ga0587109_059983 | Ga0587109_059983_108_407 | 99 |
| 785 | 3300059630 | Ga0587128_118650 | Ga0587128_118650_33_332 | 99 |
| 786 | 3300059640 | Ga0587067_084412 | Ga0587067_084412_373_672 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zj3-assembly1.cif.gz_Lk | cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis | 0.9334 | 3 | 92 |
| 7zq6-assembly1.cif.gz_t | 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain | 0.9237 | 3 | 93 |
| 6fu8-assembly1.cif.gz_C | ul23 beta hairpin loop deletion of e.coli ribosome | 0.9142 | 2 | 93 |
| 7jil-assembly1.cif.gz_T | 70s ribosome flavobacterium johnsoniae | 0.9113 | 6 | 94 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9113 | 3 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9142 | 2 | 93 | 3.30.70.330 |
| 5x8tU01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8959 | 6 | 92 | 3.30.70.330 |
| af_D3ZFK7_36_158_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8904 | 1 | 91 | 3.30.70.330 |
| 1w2bR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8767 | 5 | 92 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8725 | 2 | 93 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1YTJ9-F1-model_v4 | 50S ribosomal protein L23 | 0.956 | 25 | 99 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A5C7MNT9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9551 | 1 | 96 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-B4U746-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9502 | 1 | 98 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A388KAW6-F1-model_v4 | Ribosomal protein L23/L25 N-terminal domain-containing protein | 0.9456 | 3 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A433WCS1-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9357 | 1 | 99 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar