F480783

General Info

Members Datasets Scaffolds Average Seq Length
786 328 787 99

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12224878|Ga0105249_122248782
Length 121
Sequence LRDQFQNFPGPNGQFQNFKIKKMKLSDVLIKPILSEKANAQQDKLRRFAFKVARKANKLEIKKAVEEFYGVNVVDVNTTVVPGKNKTRFTKAGFISGQKPGYKKAFVTVAEGETIDLYANV

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
207 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
208 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
209 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
210 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
219 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
220 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
221 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
222 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
223 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
224 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
225 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
228 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
229 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
277 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
318 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 2.93
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001390 3300002459 Bacteria 5082
2 rootH1_10008428 3300003316 Bacteria 1574
3 rootH1_10008428 3300003323 Bacteria 3403
4 rootH1_10137063 3300003316 Bacteria 1655
5 rootH2_10022358 3300003320 Bacteria 1611
6 rootL2_10149151 3300003322 Bacteria 1647
7 rootH1_10083104 3300003323 Bacteria 3052
8 Ga0058859_11572014 3300004798 Bacteria 1268
9 Ga0058860_12028199 3300004801 Unclassified 684
10 Ga0058860_12218397 3300004801 Bacteria 879
11 Ga0065716_1019128 3300005277 Unclassified 519
12 Ga0065714_10176271 3300005288 Bacteria 982
13 Ga0065714_10177684 3300005288 Bacteria 929
14 Ga0065704_10233298 3300005289 Bacteria 1036
15 Ga0065704_10358180 3300005289 Bacteria 801
16 Ga0065712_10010764 3300005290 Bacteria 1916
17 Ga0065712_10020318 3300005290 Bacteria 1543
18 Ga0065712_10181032 3300005290 Bacteria 1176
19 Ga0065715_10474826 3300005293 Bacteria 798
20 Ga0065707_10333640 3300005295 Bacteria 945
21 Ga0070658_10430094 3300005327 Bacteria 1136
22 Ga0070658_11652234 3300005327 Bacteria 555
23 Ga0070676_10080339 3300005328 Bacteria 1976
24 Ga0070676_10152918 3300005328 Bacteria 1479
25 Ga0070676_10983853 3300005328 Unclassified 632
26 Ga0070676_11173912 3300005328 Bacteria 582
27 Ga0070683_100012473 3300005329 Bacteria 7386
28 Ga0070683_100013707 3300005329 Bacteria 7078
29 Ga0070690_100012030 3300005330 Bacteria 5079
30 Ga0070690_100241897 3300005330 Bacteria 1273
31 Ga0070690_100271982 3300005330 Bacteria 1205
32 Ga0070690_100608450 3300005330 Bacteria 830
33 Ga0070670_100158102 3300005331 Bacteria 1963
34 Ga0070670_100296962 3300005331 Bacteria 1412
35 Ga0070670_100405561 3300005331 Bacteria 1204
36 Ga0070677_10044332 3300005333 Bacteria 1769
37 Ga0070677_10295001 3300005333 Bacteria 822
38 Ga0070677_10329637 3300005333 Bacteria 784
39 Ga0068869_100017755 3300005334 Bacteria 4832
40 Ga0068869_100164027 3300005334 Bacteria 1731
41 Ga0068869_100186493 3300005334 Unclassified 1629
42 Ga0068869_100635703 3300005334 Bacteria 905
43 Ga0068869_100885241 3300005334 Bacteria 772
44 Ga0068869_101329351 3300005334 Bacteria 635
45 Ga0070666_10047180 3300005335 Bacteria 2891
46 Ga0070682_100000039 3300005337 Bacteria 144400
47 Ga0070682_100054491 3300005337 Bacteria 2509
48 Ga0070682_100066166 3300005337 Bacteria 2299
49 Ga0070682_100774566 3300005337 Bacteria 777
50 Ga0070682_101451664 3300005337 Unclassified 588
51 Ga0068868_100017514 3300005338 Bacteria 5340
52 Ga0068868_100123647 3300005338 Bacteria 2111
53 Ga0068868_100425091 3300005338 Bacteria 1151
54 Ga0068868_100595145 3300005338 Bacteria 979
55 Ga0070660_100979665 3300005339 Unclassified 714
56 Ga0070689_101381644 3300005340 Unclassified 636
57 Ga0070687_100128780 3300005343 Bacteria 1458
58 Ga0070687_101437085 3300005343 Bacteria 517
59 Ga0070687_101482004 3300005343 Unclassified 510
60 Ga0070661_100401046 3300005344 Bacteria 1084
61 Ga0070661_101094601 3300005344 Bacteria 664
62 Ga0070668_100050126 3300005347 Bacteria 3214
63 Ga0070668_100155369 3300005347 Bacteria 1853
64 Ga0070669_100164458 3300005353 Bacteria 1726
65 Ga0070669_100264468 3300005353 Unclassified 1374
66 Ga0070669_100724776 3300005353 Bacteria 841
67 Ga0070669_100771408 3300005353 Bacteria 816
68 Ga0070669_100999050 3300005353 Bacteria 718
69 Ga0070675_100304522 3300005354 Bacteria 1405
70 Ga0070675_100348087 3300005354 Bacteria 1314
71 Ga0070675_101352475 3300005354 Bacteria 656
72 Ga0070671_100027874 3300005355 Bacteria 4650
73 Ga0070671_100059066 3300005355 Bacteria 3191
74 Ga0070671_100524570 3300005355 Bacteria 1020
75 Ga0070671_100739459 3300005355 Bacteria 854
76 Ga0070671_101113529 3300005355 Bacteria 694
77 Ga0070674_100816159 3300005356 Unclassified 806
78 Ga0070673_100030215 3300005364 Bacteria 4050
79 Ga0070673_100373624 3300005364 Bacteria 1270
80 Ga0070673_100782635 3300005364 Bacteria 880
81 Ga0070673_100908377 3300005364 Unclassified 817
82 Ga0070673_101586386 3300005364 Bacteria 618
83 Ga0070673_102274756 3300005364 Bacteria 515
84 Ga0070688_100496873 3300005365 Bacteria 919
85 Ga0070659_100010418 3300005366 Bacteria 6838
86 Ga0070659_100293641 3300005366 Bacteria 1354
87 Ga0070667_100162213 3300005367 Bacteria 1969
88 Ga0070667_100187787 3300005367 Bacteria 1830
89 Ga0070667_100367061 3300005367 Bacteria 1305
90 Ga0070667_100446979 3300005367 Bacteria 1181
91 Ga0070667_100497691 3300005367 Bacteria 1117
92 Ga0070667_101994815 3300005367 Bacteria 547
93 Ga0070667_102150443 3300005367 Unclassified 526
94 Ga0070667_102341496 3300005367 Bacteria 503
95 Ga0070701_10030686 3300005438 Bacteria 2661
96 Ga0070700_100400731 3300005441 Bacteria 1031
97 Ga0070700_101288740 3300005441 Bacteria 613
98 Ga0070694_100152300 3300005444 Bacteria 1690
99 Ga0070663_100824540 3300005455 Bacteria 797
100 Ga0070678_100124839 3300005456 Bacteria 2036
101 Ga0070678_100197824 3300005456 Bacteria 1657
102 Ga0070678_100310570 3300005456 Bacteria 1343
103 Ga0070678_100397012 3300005456 Bacteria 1197
104 Ga0070678_101138746 3300005456 Bacteria 722
105 Ga0070678_101813579 3300005456 Bacteria 575
106 Ga0070662_100044485 3300005457 Bacteria 3180
107 Ga0068867_100011408 3300005459 Bacteria 6270
108 Ga0068867_100031243 3300005459 Bacteria 3843
109 Ga0068867_100218385 3300005459 Bacteria 1535
110 Ga0068867_100461505 3300005459 Bacteria 1084
111 Ga0068867_100843120 3300005459 Bacteria 821
112 Ga0068867_101068658 3300005459 Bacteria 735
113 Ga0068867_101090094 3300005459 Bacteria 729
114 Ga0070685_10075150 3300005466 Bacteria 2012
115 Ga0070685_10108040 3300005466 Bacteria 1709
116 Ga0070698_100002339 3300005471 Bacteria 20947
117 Ga0070698_100002802 3300005471 Bacteria 19186
118 Ga0070698_100021125 3300005471 Bacteria 6820
119 Ga0070698_100241874 3300005471 Bacteria 1738
120 Ga0070684_100050088 3300005535 Bacteria 3627
121 Ga0070684_100069741 3300005535 Bacteria 3091
122 Ga0070684_101742365 3300005535 Bacteria 588
123 Ga0068853_100013022 3300005539 Bacteria 6782
124 Ga0068853_100021938 3300005539 Bacteria 5326
125 Ga0068853_100053834 3300005539 Bacteria 3466
126 Ga0068853_100177645 3300005539 Bacteria 1930
127 Ga0068853_100187386 3300005539 Bacteria 1878
128 Ga0068853_100672055 3300005539 Unclassified 987
129 Ga0068853_101262350 3300005539 Bacteria 714
130 Ga0068853_101423282 3300005539 Bacteria 671
131 Ga0070672_100140535 3300005543 Bacteria 1991
132 Ga0070672_100268088 3300005543 Bacteria 1441
133 Ga0070672_101033833 3300005543 Bacteria 729
134 Ga0070672_101073298 3300005543 Unclassified 715
135 Ga0070672_101368455 3300005543 Bacteria 633
136 Ga0070686_100131761 3300005544 Bacteria 1730
137 Ga0070686_100339360 3300005544 Bacteria 1125
138 Ga0070695_100328010 3300005545 Unclassified 1140
139 Ga0070665_101230939 3300005548 Bacteria 759
140 Ga0070665_101676357 3300005548 Bacteria 643
141 Ga0070665_102105013 3300005548 Bacteria 569
142 Ga0070704_100100614 3300005549 Bacteria 2177
143 Ga0068855_100000133 3300005563 Bacteria 94906
144 Ga0068855_100161856 3300005563 Bacteria 2539
145 Ga0068855_101205999 3300005563 Bacteria 787
146 Ga0068855_101297998 3300005563 Bacteria 753
147 Ga0070664_100041775 3300005564 Bacteria 3870
148 Ga0070664_101314925 3300005564 Bacteria 683
149 Ga0068857_100018409 3300005577 Bacteria 6129
150 Ga0068857_100049652 3300005577 Bacteria 3722
151 Ga0068857_100085136 3300005577 Bacteria 2825
152 Ga0068857_100200825 3300005577 Bacteria 1817
153 Ga0068857_100410529 3300005577 Bacteria 1261
154 Ga0068857_101296490 3300005577 Bacteria 707
155 Ga0068854_100142005 3300005578 Bacteria 1844
156 Ga0068854_100203791 3300005578 Bacteria 1557
157 Ga0068854_100261616 3300005578 Bacteria 1385
158 Ga0068854_101028985 3300005578 Bacteria 730
159 Ga0068856_100324230 3300005614 Bacteria 1558
160 Ga0068856_102538049 3300005614 Bacteria 519
161 Ga0070702_100049731 3300005615 Bacteria 2392
162 Ga0070702_101226973 3300005615 Unclassified 606
163 Ga0068852_100001842 3300005616 Bacteria 14407
164 Ga0068852_100054084 3300005616 Bacteria 3459
165 Ga0068852_100399528 3300005616 Unclassified 1352
166 Ga0068852_100541074 3300005616 Bacteria 1164
167 Ga0068852_100548083 3300005616 Bacteria 1157
168 Ga0068852_100770817 3300005616 Unclassified 975
169 Ga0068859_100000536 3300005617 Bacteria 37574
170 Ga0068859_100224760 3300005617 Bacteria 1965
171 Ga0068859_100378987 3300005617 Unclassified 1510
172 Ga0068859_101038780 3300005617 Bacteria 900
173 Ga0068859_101113972 3300005617 Bacteria 868
174 Ga0068859_101363145 3300005617 Bacteria 782
175 Ga0068859_102320201 3300005617 Bacteria 592
176 Ga0068864_100078002 3300005618 Bacteria 2898
177 Ga0068864_100107079 3300005618 Bacteria 2486
178 Ga0068864_100700002 3300005618 Unclassified 990
179 Ga0068864_100774454 3300005618 Bacteria 941
180 Ga0068864_101231108 3300005618 Bacteria 748
181 Ga0068864_101277046 3300005618 Unclassified 734
182 Ga0068864_101578938 3300005618 Unclassified 660
183 Ga0068866_10167116 3300005718 Bacteria 1288
184 Ga0068866_10244880 3300005718 Bacteria 1094
185 Ga0068866_10804666 3300005718 Bacteria 654
186 Ga0068861_100134738 3300005719 Bacteria 2009
187 Ga0068861_100209084 3300005719 Bacteria 1642
188 Ga0068861_100261089 3300005719 Bacteria 1483
189 Ga0068861_100272552 3300005719 Bacteria 1454
190 Ga0068861_100297679 3300005719 Bacteria 1396
191 Ga0068861_100609875 3300005719 Bacteria 1003
192 Ga0068861_101741185 3300005719 Bacteria 617
193 Ga0068861_102418491 3300005719 Bacteria 528
194 Ga0068851_10309859 3300005834 Bacteria 909
195 Ga0068851_11042207 3300005834 Bacteria 517
196 Ga0068870_10172613 3300005840 Bacteria 1291
197 Ga0068870_10681471 3300005840 Bacteria 707
198 Ga0068863_100098427 3300005841 Bacteria 2778
199 Ga0068863_100114726 3300005841 Bacteria 2566
200 Ga0068863_100410048 3300005841 Bacteria 1326
201 Ga0068863_101278366 3300005841 Bacteria 740
202 Ga0068863_102614408 3300005841 Bacteria 514
203 Ga0068858_100109140 3300005842 Bacteria 2583
204 Ga0068858_101055247 3300005842 Bacteria 797
205 Ga0068858_101414979 3300005842 Unclassified 685
206 Ga0068860_100010482 3300005843 Bacteria 9162
207 Ga0068860_100173927 3300005843 Bacteria 2081
208 Ga0068860_100280646 3300005843 Bacteria 1628
209 Ga0068860_100788115 3300005843 Bacteria 963
210 Ga0068860_100793324 3300005843 Bacteria 960
211 Ga0068860_100916554 3300005843 Bacteria 893
212 Ga0068860_102626909 3300005843 Bacteria 523
213 Ga0068860_102799295 3300005843 Bacteria 506
214 Ga0068862_100032080 3300005844 Bacteria 4438
215 Ga0068862_100714805 3300005844 Bacteria 971
216 Ga0068862_101540653 3300005844 Bacteria 671
217 Ga0075432_10114297 3300006058 Unclassified 1009
218 Ga0070715_10041724 3300006163 Bacteria 1924
219 Ga0070715_10073647 3300006163 Bacteria 1532
220 Ga0070715_10127624 3300006163 Bacteria 1220
221 Ga0075366_10082945 3300006195 Bacteria 1915
222 Ga0075366_10508980 3300006195 Unclassified 744
223 Ga0097621_100003401 3300006237 Bacteria 10956
224 Ga0097621_100036790 3300006237 Bacteria 3917
225 Ga0097621_100050215 3300006237 Bacteria 3391
226 Ga0097621_100410740 3300006237 Bacteria 1213
227 Ga0097621_100422407 3300006237 Bacteria 1197
228 Ga0097621_100537595 3300006237 Bacteria 1062
229 Ga0097621_100680226 3300006237 Bacteria 946
230 Ga0075370_10173219 3300006353 Bacteria 1269
231 Ga0075370_10537878 3300006353 Unclassified 706
232 Ga0075370_10824576 3300006353 Bacteria 566
233 Ga0068871_100000955 3300006358 Bacteria 19316
234 Ga0068871_100108578 3300006358 Bacteria 2332
235 Ga0068871_100134279 3300006358 Bacteria 2100
236 Ga0068871_101138415 3300006358 Bacteria 730
237 Ga0068871_101638411 3300006358 Bacteria 609
238 Ga0068871_101751436 3300006358 Bacteria 590
239 Ga0075428_100029189 3300006844 Bacteria 6103
240 Ga0075428_100044984 3300006844 Bacteria 4851
241 Ga0075428_100527725 3300006844 Bacteria 1262
242 Ga0075428_101374511 3300006844 Bacteria 741
243 Ga0075431_100019798 3300006847 Bacteria 6870
244 Ga0075431_101149999 3300006847 Bacteria 740
245 Ga0075434_100562446 3300006871 Unclassified 1160
246 Ga0075434_101019333 3300006871 Bacteria 842
247 Ga0075429_100003790 3300006880 Bacteria 12900
248 Ga0075429_100060787 3300006880 Bacteria 3290
249 Ga0075429_100874597 3300006880 Bacteria 787
250 Ga0075429_100912786 3300006880 Bacteria 768
251 Ga0068865_100093466 3300006881 Bacteria 2187
252 Ga0068865_100114198 3300006881 Bacteria 1997
253 Ga0068865_100507273 3300006881 Bacteria 1007
254 Ga0068865_100704319 3300006881 Bacteria 863
255 Ga0068865_100729034 3300006881 Unclassified 849
256 Ga0068865_100782855 3300006881 Bacteria 822
257 Ga0097620_100000536 3300006931 Bacteria 37574
258 Ga0097620_100224745 3300006931 Bacteria 1965
259 Ga0097620_100379009 3300006931 Unclassified 1510
260 Ga0097620_101038841 3300006931 Bacteria 900
261 Ga0097620_101113995 3300006931 Bacteria 868
262 Ga0097620_101363753 3300006931 Bacteria 782
263 Ga0097620_102320234 3300006931 Bacteria 592
264 Ga0105240_10000398 3300009093 Bacteria 81045
265 Ga0105240_10173346 3300009093 Bacteria 2552
266 Ga0105240_10283628 3300009093 Bacteria 1902
267 Ga0105240_10350445 3300009093 Bacteria 1675
268 Ga0105240_10386714 3300009093 Bacteria 1579
269 Ga0111539_10667745 3300009094 Bacteria 1210
270 Ga0111539_10990779 3300009094 Unclassified 977
271 Ga0105245_10068029 3300009098 Bacteria 3226
272 Ga0105245_10901803 3300009098 Bacteria 926
273 Ga0105247_10002304 3300009101 Bacteria 13045
274 Ga0105247_10204681 3300009101 Bacteria 1328
275 Ga0105247_11197407 3300009101 Bacteria 605
276 Ga0105247_11490134 3300009101 Bacteria 551
277 Ga0114129_10303837 3300009147 Bacteria 2126
278 Ga0105243_10711600 3300009148 Unclassified 980
279 Ga0105243_11307499 3300009148 Bacteria 742
280 Ga0105243_11603262 3300009148 Bacteria 677
281 Ga0105243_12456353 3300009148 Bacteria 560
282 Ga0105241_10409198 3300009174 Unclassified 1192
283 Ga0105241_10443550 3300009174 Bacteria 1147
284 Ga0105242_10055628 3300009176 Bacteria 3237
285 Ga0105242_10102158 3300009176 Bacteria 2431
286 Ga0105242_10134109 3300009176 Bacteria 2141
287 Ga0105242_10336272 3300009176 Bacteria 1390
288 Ga0105242_10515400 3300009176 Bacteria 1140
289 Ga0105242_10522285 3300009176 Bacteria 1133
290 Ga0105242_10634254 3300009176 Bacteria 1037
291 Ga0105242_10815531 3300009176 Bacteria 925
292 Ga0105242_10912916 3300009176 Bacteria 879
293 Ga0105242_11229804 3300009176 Bacteria 769
294 Ga0105242_11444208 3300009176 Bacteria 717
295 Ga0105248_10052937 3300009177 Bacteria 4555
296 Ga0105237_10018987 3300009545 Bacteria 7105
297 Ga0105237_10342700 3300009545 Bacteria 1499
298 Ga0105237_12443590 3300009545 Unclassified 533
299 Ga0105238_11080276 3300009551 Unclassified 825
300 Ga0105238_11200524 3300009551 Bacteria 783
301 Ga0105238_11941973 3300009551 Bacteria 622
302 Ga0105249_10000806 3300009553 Bacteria 28220
303 Ga0105249_10025715 3300009553 Bacteria 5302
304 Ga0105249_10053538 3300009553 Bacteria 3689
305 Ga0105249_10075766 3300009553 Bacteria 3116
306 Ga0105249_10077951 3300009553 Bacteria 3074
307 Ga0105249_10308059 3300009553 Bacteria 1591
308 Ga0105249_10500048 3300009553 Bacteria 1261
309 Ga0105249_11267198 3300009553 Unclassified 809
310 Ga0105249_11603973 3300009553 Bacteria 723
311 Ga0105249_11961295 3300009553 Bacteria 658
312 Ga0105249_12224878 3300009553 Bacteria 621
313 Ga0105239_10188341 3300010375 Bacteria 2310
314 Ga0105239_10444888 3300010375 Bacteria 1470
315 Ga0105239_12305401 3300010375 Bacteria 626
316 Ga0105246_10290685 3300011119 Bacteria 1315
317 Ga0105246_11464053 3300011119 Bacteria 640
318 Ga0105246_12047322 3300011119 Bacteria 553
319 Ga0157373_10041402 3300013100 Bacteria 3295
320 Ga0157373_10175037 3300013100 Bacteria 1510
321 Ga0157371_10036963 3300013102 Bacteria 3497
322 Ga0157371_10043957 3300013102 Bacteria 3182
323 Ga0157370_10011345 3300013104 Bacteria 9332
324 Ga0157370_10017050 3300013104 Bacteria 7340
325 Ga0157370_10022725 3300013104 Bacteria 6240
326 Ga0157370_10146677 3300013104 Bacteria 2197
327 Ga0157370_10565943 3300013104 Unclassified 1041
328 Ga0157369_10063647 3300013105 Bacteria 3973
329 Ga0157369_10100758 3300013105 Bacteria 3079
330 Ga0157369_10548844 3300013105 Bacteria 1194
331 Ga0157369_12193327 3300013105 Bacteria 560
332 Ga0157374_10000001 3300013296 Bacteria 1077351
333 Ga0157374_10418497 3300013296 Bacteria 1338
334 Ga0157374_11124223 3300013296 Bacteria 806
335 Ga0157374_11268781 3300013296 Bacteria 758
336 Ga0157374_11708945 3300013296 Bacteria 654
337 Ga0157378_10012000 3300013297 Bacteria 7586
338 Ga0157378_10025313 3300013297 Bacteria 5226
339 Ga0157378_10079785 3300013297 Bacteria 2955
340 Ga0157378_10292781 3300013297 Unclassified 1573
341 Ga0157378_10538693 3300013297 Bacteria 1171
342 Ga0157378_10580476 3300013297 Bacteria 1130
343 Ga0157378_11227888 3300013297 Bacteria 789
344 Ga0157378_12243419 3300013297 Bacteria 597
345 Ga0163162_10022373 3300013306 Bacteria 6230
346 Ga0163162_10024199 3300013306 Bacteria 5993
347 Ga0163162_10299937 3300013306 Bacteria 1739
348 Ga0163162_10350615 3300013306 Bacteria 1609
349 Ga0163162_12140365 3300013306 Bacteria 642
350 Ga0157372_10016644 3300013307 Bacteria 7892
351 Ga0157372_10051126 3300013307 Bacteria 4598
352 Ga0157372_10219265 3300013307 Bacteria 2205
353 Ga0157372_10999635 3300013307 Bacteria 969
354 Ga0157372_11106207 3300013307 Bacteria 917
355 Ga0157372_12765166 3300013307 Bacteria 563
356 Ga0157375_10001463 3300013308 Bacteria 20315
357 Ga0157375_10005027 3300013308 Bacteria 11484
358 Ga0157375_10159900 3300013308 Bacteria 2394
359 Ga0157375_10645367 3300013308 Bacteria 1215
360 Ga0157375_11820428 3300013308 Bacteria 722
361 Ga0157375_13347282 3300013308 Bacteria 534
362 Ga0163163_10036393 3300014325 Bacteria 4781
363 Ga0163163_10300122 3300014325 Bacteria 1659
364 Ga0163163_10382911 3300014325 Unclassified 1464
365 Ga0163163_10393167 3300014325 Unclassified 1444
366 Ga0163163_10451802 3300014325 Bacteria 1345
367 Ga0163163_12045409 3300014325 Bacteria 632
368 Ga0163163_12402330 3300014325 Bacteria 585
369 Ga0157380_11073201 3300014326 Bacteria 843
370 Ga0157380_11914737 3300014326 Unclassified 654
371 Ga0157380_12414872 3300014326 Bacteria 591
372 Ga0157380_13015544 3300014326 Bacteria 536
373 Ga0157377_10059401 3300014745 Bacteria 2179
374 Ga0157377_10157358 3300014745 Bacteria 1410
375 Ga0157377_10596912 3300014745 Bacteria 787
376 Ga0157379_10294026 3300014968 Bacteria 1480
377 Ga0157379_10433737 3300014968 Bacteria 1211
378 Ga0157379_10472215 3300014968 Bacteria 1160
379 Ga0157379_10581884 3300014968 Bacteria 1044
380 Ga0157379_11029031 3300014968 Bacteria 786
381 Ga0157379_11058351 3300014968 Bacteria 776
382 Ga0157379_11924823 3300014968 Bacteria 583
383 Ga0157379_11942415 3300014968 Bacteria 581
384 Ga0157376_10008523 3300014969 Bacteria 7404
385 Ga0157376_10022078 3300014969 Bacteria 4953
386 Ga0157376_10110820 3300014969 Bacteria 2415
387 Ga0157376_10135197 3300014969 Bacteria 2205
388 Ga0157376_10205661 3300014969 Bacteria 1814
389 Ga0157376_11314513 3300014969 Bacteria 753
390 Ga0163161_10001357 3300017792 Bacteria 18206
391 Ga0163161_10015767 3300017792 Bacteria 5269
392 Ga0163161_10052210 3300017792 Bacteria 2963
393 Ga0163161_10380022 3300017792 Unclassified 1129
394 Ga0206356_11242059 3300020070 Bacteria 2349
395 Ga0206352_10807008 3300020078 Unclassified 964
396 Ga0206352_10905181 3300020078 Bacteria 1339
397 Ga0154015_1594150 3300020610 Unclassified 514
398 Ga0207666_1058299 3300025271 Bacteria 616
399 Ga0207697_10169011 3300025315 Bacteria 956
400 Ga0207697_10239158 3300025315 Bacteria 802
401 Ga0207656_10013408 3300025321 Bacteria 3133
402 Ga0207656_10177343 3300025321 Bacteria 1021
403 Ga0207682_10003346 3300025893 Bacteria 6992
404 Ga0207642_10027020 3300025899 Bacteria 2344
405 Ga0207642_10742750 3300025899 Bacteria 621
406 Ga0207642_11103263 3300025899 Bacteria 513
407 Ga0207710_10002332 3300025900 Bacteria 8872
408 Ga0207688_10158876 3300025901 Bacteria 1339
409 Ga0207680_10055057 3300025903 Bacteria 2396
410 Ga0207680_10148616 3300025903 Bacteria 1560
411 Ga0207680_11316308 3300025903 Bacteria 514
412 Ga0207647_10020448 3300025904 Bacteria 4439
413 Ga0207685_10187861 3300025905 Bacteria 962
414 Ga0207685_10381598 3300025905 Bacteria 718
415 Ga0207645_10025677 3300025907 Bacteria 3811
416 Ga0207645_10058686 3300025907 Bacteria 2457
417 Ga0207645_10158170 3300025907 Bacteria 1481
418 Ga0207645_10373454 3300025907 Bacteria 956
419 Ga0207645_10844175 3300025907 Bacteria 623
420 Ga0207705_10732079 3300025909 Bacteria 768
421 Ga0207705_11503884 3300025909 Bacteria 510
422 Ga0207684_10515844 3300025910 Bacteria 1024
423 Ga0207654_10036156 3300025911 Bacteria 2757
424 Ga0207654_10616040 3300025911 Bacteria 775
425 Ga0207654_11289273 3300025911 Bacteria 532
426 Ga0207695_10000076 3300025913 Bacteria 307969
427 Ga0207695_10000090 3300025913 Bacteria 272143
428 Ga0207695_10015473 3300025913 Bacteria 8978
429 Ga0207695_10350323 3300025913 Bacteria 1364
430 Ga0207695_10946680 3300025913 Bacteria 741
431 Ga0207695_11129584 3300025913 Unclassified 663
432 Ga0207671_10037137 3300025914 Bacteria 3613
433 Ga0207671_10040157 3300025914 Bacteria 3463
434 Ga0207662_10027651 3300025918 Bacteria 3274
435 Ga0207657_10699411 3300025919 Bacteria 787
436 Ga0207649_10277452 3300025920 Bacteria 1217
437 Ga0207649_10444890 3300025920 Bacteria 977
438 Ga0207649_11145177 3300025920 Bacteria 614
439 Ga0207681_10201509 3300025923 Bacteria 1528
440 Ga0207681_10272524 3300025923 Bacteria 1329
441 Ga0207681_10382313 3300025923 Bacteria 1133
442 Ga0207681_10786939 3300025923 Bacteria 794
443 Ga0207681_11069873 3300025923 Bacteria 677
444 Ga0207650_10074493 3300025925 Bacteria 2559
445 Ga0207650_10959364 3300025925 Bacteria 727
446 Ga0207687_10195190 3300025927 Bacteria 1578
447 Ga0207644_10059737 3300025931 Bacteria 2758
448 Ga0207644_10072425 3300025931 Bacteria 2523
449 Ga0207644_10129993 3300025931 Bacteria 1927
450 Ga0207690_10024446 3300025932 Bacteria 3784
451 Ga0207706_10006478 3300025933 Bacteria 10869
452 Ga0207706_10163522 3300025933 Bacteria 1956
453 Ga0207706_10205207 3300025933 Bacteria 1728
454 Ga0207706_10675849 3300025933 Bacteria 883
455 Ga0207686_10127335 3300025934 Bacteria 1742
456 Ga0207686_10744788 3300025934 Bacteria 782
457 Ga0207686_10981767 3300025934 Bacteria 685
458 Ga0207686_11247268 3300025934 Bacteria 609
459 Ga0207709_10209441 3300025935 Bacteria 1398
460 Ga0207709_10375537 3300025935 Unclassified 1080
461 Ga0207670_10014554 3300025936 Bacteria 4674
462 Ga0207669_10053018 3300025937 Bacteria 2441
463 Ga0207669_10828706 3300025937 Bacteria 769
464 Ga0207704_10130848 3300025938 Bacteria 1737
465 Ga0207704_10160734 3300025938 Bacteria 1598
466 Ga0207704_10308805 3300025938 Bacteria 1215
467 Ga0207704_10354971 3300025938 Bacteria 1143
468 Ga0207704_10573488 3300025938 Bacteria 920
469 Ga0207704_10592339 3300025938 Bacteria 907
470 Ga0207704_10754359 3300025938 Bacteria 810
471 Ga0207691_10049197 3300025940 Bacteria 3863
472 Ga0207691_10596608 3300025940 Bacteria 935
473 Ga0207691_10601825 3300025940 Bacteria 930
474 Ga0207711_10092009 3300025941 Bacteria 2669
475 Ga0207711_10182599 3300025941 Bacteria 1908
476 Ga0207689_10010127 3300025942 Bacteria 8127
477 Ga0207689_10014249 3300025942 Bacteria 6765
478 Ga0207689_10045231 3300025942 Bacteria 3641
479 Ga0207689_10075403 3300025942 Bacteria 2772
480 Ga0207689_10167478 3300025942 Bacteria 1810
481 Ga0207689_10182503 3300025942 Bacteria 1730
482 Ga0207689_10388301 3300025942 Bacteria 1163
483 Ga0207689_11138320 3300025942 Bacteria 657
484 Ga0207661_10019703 3300025944 Bacteria 5035
485 Ga0207661_10134049 3300025944 Bacteria 2125
486 Ga0207679_10067722 3300025945 Bacteria 2679
487 Ga0207679_11540553 3300025945 Bacteria 609
488 Ga0207679_11893687 3300025945 Bacteria 544
489 Ga0207667_10000453 3300025949 Bacteria 54929
490 Ga0207667_10003602 3300025949 Bacteria 19111
491 Ga0207667_10848084 3300025949 Bacteria 908
492 Ga0207651_10568917 3300025960 Bacteria 987
493 Ga0207651_10845061 3300025960 Bacteria 813
494 Ga0207651_11274784 3300025960 Bacteria 660
495 Ga0207651_11459083 3300025960 Bacteria 616
496 Ga0207651_11486572 3300025960 Bacteria 610
497 Ga0207651_11550697 3300025960 Unclassified 597
498 Ga0207712_10016968 3300025961 Bacteria 4723
499 Ga0207712_10082309 3300025961 Bacteria 2346
500 Ga0207712_10082897 3300025961 Bacteria 2339
501 Ga0207712_10318884 3300025961 Bacteria 1282
502 Ga0207712_10407934 3300025961 Bacteria 1144
503 Ga0207712_10441535 3300025961 Bacteria 1102
504 Ga0207668_10074158 3300025972 Bacteria 2442
505 Ga0207668_10149486 3300025972 Bacteria 1806
506 Ga0207668_10161771 3300025972 Bacteria 1745
507 Ga0207668_10788732 3300025972 Bacteria 840
508 Ga0207640_10016977 3300025981 Bacteria 4249
509 Ga0207640_10020295 3300025981 Bacteria 3944
510 Ga0207640_10766513 3300025981 Bacteria 833
511 Ga0207640_11296657 3300025981 Bacteria 650
512 Ga0207658_10051578 3300025986 Bacteria 3032
513 Ga0207658_10348489 3300025986 Bacteria 1289
514 Ga0207658_10646178 3300025986 Unclassified 953
515 Ga0207658_10752020 3300025986 Bacteria 883
516 Ga0207658_10982032 3300025986 Bacteria 770
517 Ga0207658_11852353 3300025986 Bacteria 550
518 Ga0207677_10192753 3300026023 Unclassified 1613
519 Ga0207677_11416784 3300026023 Bacteria 640
520 Ga0207677_11726196 3300026023 Bacteria 581
521 Ga0207677_12206673 3300026023 Bacteria 512
522 Ga0207703_10835435 3300026035 Bacteria 880
523 Ga0207703_11346948 3300026035 Unclassified 686
524 Ga0207639_10003633 3300026041 Bacteria 10364
525 Ga0207639_10022533 3300026041 Bacteria 4538
526 Ga0207639_10268603 3300026041 Bacteria 1495
527 Ga0207639_10822112 3300026041 Unclassified 866
528 Ga0207639_11005787 3300026041 Bacteria 781
529 Ga0207639_11159955 3300026041 Bacteria 725
530 Ga0207639_11951241 3300026041 Unclassified 548
531 Ga0207639_12158344 3300026041 Bacteria 518
532 Ga0207678_11086737 3300026067 Bacteria 708
533 Ga0207708_10887412 3300026075 Bacteria 771
534 Ga0207641_10025754 3300026088 Bacteria 4850
535 Ga0207641_10043824 3300026088 Bacteria 3760
536 Ga0207641_10091863 3300026088 Bacteria 2657
537 Ga0207641_10138043 3300026088 Bacteria 2196
538 Ga0207641_10393151 3300026088 Bacteria 1330
539 Ga0207641_10545068 3300026088 Unclassified 1131
540 Ga0207641_10841836 3300026088 Unclassified 909
541 Ga0207641_11232996 3300026088 Bacteria 748
542 Ga0207648_10009109 3300026089 Bacteria 9541
543 Ga0207648_10028462 3300026089 Bacteria 4954
544 Ga0207648_10176788 3300026089 Bacteria 1888
545 Ga0207648_10232893 3300026089 Bacteria 1639
546 Ga0207648_10242935 3300026089 Bacteria 1603
547 Ga0207648_10247850 3300026089 Bacteria 1587
548 Ga0207648_10967696 3300026089 Bacteria 796
549 Ga0207648_11127784 3300026089 Bacteria 736
550 Ga0207676_10067110 3300026095 Bacteria 2864
551 Ga0207676_10083440 3300026095 Bacteria 2602
552 Ga0207676_10363238 3300026095 Unclassified 1342
553 Ga0207676_10529410 3300026095 Bacteria 1123
554 Ga0207676_10680396 3300026095 Bacteria 995
555 Ga0207674_10009949 3300026116 Bacteria 10820
556 Ga0207674_10022667 3300026116 Bacteria 6740
557 Ga0207674_10025546 3300026116 Bacteria 6296
558 Ga0207674_10147351 3300026116 Bacteria 2312
559 Ga0207674_10169071 3300026116 Bacteria 2140
560 Ga0207674_10171366 3300026116 Bacteria 2124
561 Ga0207675_100049685 3300026118 Bacteria 3913
562 Ga0207675_100068632 3300026118 Bacteria 3313
563 Ga0207675_100119254 3300026118 Bacteria 2495
564 Ga0207675_100303650 3300026118 Bacteria 1555
565 Ga0207675_100605687 3300026118 Bacteria 1099
566 Ga0207675_102223409 3300026118 Bacteria 563
567 Ga0207683_10024454 3300026121 Bacteria 5203
568 Ga0207683_10097053 3300026121 Bacteria 2628
569 Ga0207683_10236552 3300026121 Bacteria 1666
570 Ga0207683_10315533 3300026121 Bacteria 1431
571 Ga0207683_10583777 3300026121 Bacteria 1034
572 Ga0207698_10013166 3300026142 Bacteria 5446
573 Ga0207698_10136904 3300026142 Bacteria 2103
574 Ga0207698_10142388 3300026142 Unclassified 2068
575 Ga0207698_10232664 3300026142 Bacteria 1674
576 Ga0207698_10795200 3300026142 Unclassified 948
577 Ga0207698_10935954 3300026142 Unclassified 875
578 Ga0207698_11010308 3300026142 Bacteria 843
579 Ga0207698_11320253 3300026142 Bacteria 736
580 Ga0207428_10733645 3300027907 Bacteria 705
581 Ga0268266_11387499 3300028379 Bacteria 678
582 Ga0268266_11635247 3300028379 Bacteria 620
583 Ga0268265_10154569 3300028380 Bacteria 1940
584 Ga0268265_11076656 3300028380 Unclassified 797
585 Ga0268265_11280978 3300028380 Bacteria 732
586 Ga0268265_11286890 3300028380 Bacteria 731
587 Ga0268265_11542435 3300028380 Bacteria 668
588 Ga0268265_12395546 3300028380 Bacteria 534
589 Ga0268264_10015090 3300028381 Bacteria 6337
590 Ga0268264_10061228 3300028381 Bacteria 3157
591 Ga0268264_10061558 3300028381 Bacteria 3149
592 Ga0268264_10274759 3300028381 Bacteria 1575
593 Ga0268264_10356042 3300028381 Bacteria 1395
594 Ga0268264_10378729 3300028381 Bacteria 1354
595 Ga0268264_10905782 3300028381 Bacteria 885
596 Ga0268264_11184690 3300028381 Bacteria 773
597 Ga0307515_10000001 3300028794 Bacteria 4259510
598 Ga0265327_10000244 3300031251 Bacteria 108867
599 Ga0307513_10184519 3300031456 Bacteria 1945
600 Ga0307516_10677783 3300031730 Bacteria 687
601 Ga0307410_10133130 3300031852 Bacteria 1829
602 Ga0307410_10259089 3300031852 Bacteria 1356
603 Ga0307406_11795591 3300031901 Bacteria 545
604 Ga0307406_12063053 3300031901 Bacteria 510
605 Ga0307407_10489098 3300031903 Unclassified 900
606 Ga0307412_11035174 3300031911 Bacteria 727
607 Ga0307412_12087980 3300031911 Bacteria 526
608 Ga0307409_102113213 3300031995 Bacteria 593
609 Ga0307416_103535673 3300032002 Unclassified 523
610 Ga0307415_100359048 3300032126 Bacteria 1230
611 Ga0307510_10000380 3300033180 Bacteria 42243
612 Ga0373934_0362481 3300035086 Bacteria 604
613 Ga0373944_0058556 3300035089 Bacteria 1231
614 Ga0373952_0052040 3300035092 Bacteria 979
615 Ga0373923_0362113 3300035111 Bacteria 694
616 Ga0373936_0177866 3300035113 Bacteria 932
617 Ga0373956_0041135 3300035119 Bacteria 2052
618 Ga0373943_0248315 3300035170 Bacteria 999
619 Ga0373943_0913604 3300035170 Bacteria 525
620 Ga0373946_0183334 3300035171 Bacteria 995
621 Ga0373955_0466007 3300035172 Bacteria 770
622 Ga0373955_0929755 3300035172 Bacteria 535
623 Ga0373924_0042226 3300035410 Bacteria 1870
624 Ga0373931_0337062 3300035691 Bacteria 941
625 Ga0373935_0121189 3300035692 Bacteria 1748
626 Ga0373935_1323371 3300035692 Bacteria 538
627 Ga0373933_0073414 3300035724 Bacteria 2084
628 Ga0373947_0572452 3300035725 Bacteria 769
629 Ga0373947_0957318 3300035725 Unclassified 584
630 Ga0373937_0002462 3300036401 Bacteria 15390
631 Ga0373925_0228924 3300037068 Bacteria 1486
632 Ga0395900_0017444 3300037418 Bacteria 7328
633 Ga0395898_0002718 3300037466 Bacteria 20408
634 Ga0395901_0158362 3300038443 Bacteria 2378
635 Ga0436361_1211924 3300039447 Bacteria 2151
636 Ga0439436_0186659 3300041404 Bacteria 591
637 Ga0439439_0031503 3300041406 Bacteria 1352
638 Ga0439466_0112609 3300041411 Bacteria 843
639 Ga0451790_27755 3300041444 Bacteria 696
640 Ga0451790_40603 3300041444 Bacteria 575
641 Ga0451790_41286 3300041444 Bacteria 1130
642 Ga0451791_1111960 3300041451 Bacteria 534
643 Ga0451791_1436515 3300041451 Bacteria 1339
644 Ga0451793_0068821 3300041452 Bacteria 806
645 Ga0451797_0340668 3300041453 Bacteria 793
646 Ga0451798_0476184 3300041458 Bacteria 541
647 Ga0451798_0824705 3300041458 Bacteria 586
648 Ga0451798_1169930 3300041458 Unclassified 645
649 Ga0451800_0032641 3300041459 Bacteria 679
650 Ga0451800_1619468 3300041459 Bacteria 834
651 Ga0451802_0502259 3300041460 Bacteria 612
652 Ga0451802_2117121 3300041460 Bacteria 916
653 Ga0451807_0407082 3300041486 Bacteria 883
654 Ga0451807_2654774 3300041486 Bacteria 1064
655 Ga0451833_0686487 3300041491 Bacteria 803
656 Ga0451839_0104913 3300041496 Bacteria 1387
657 Ga0451843_1604042 3300041509 Bacteria 1309
658 Ga0451843_1614837 3300041509 Bacteria 751
659 Ga0439431_0132096 3300041997 Bacteria 701
660 Ga0439441_008819 3300042001 Bacteria 1657
661 Ga0439443_037532 3300042003 Bacteria 818
662 Ga0439448_0216964 3300042005 Bacteria 672
663 Ga0439432_123592 3300042006 Bacteria 766
664 Ga0439449_0078529 3300042007 Bacteria 1217
665 Ga0439452_025585 3300042010 Bacteria 1497
666 Ga0439457_062867 3300042014 Bacteria 842
667 Ga0439462_0015306 3300042015 Bacteria 1977
668 Ga0450920_054549 3300042122 Unclassified 804
669 Ga0450923_013606 3300042125 Bacteria 1497
670 Ga0450894_006068 3300042131 Bacteria 1563
671 Ga0450898_004710 3300042134 Bacteria 2031
672 Ga0450906_059401 3300042145 Bacteria 679
673 Ga0439434_0002227 3300042435 Bacteria 5629
674 Ga0439444_0116582 3300042437 Bacteria 619
675 Ga0450918_061096 3300042531 Bacteria 696
676 Ga0453683_0417783 3300044673 Bacteria 865
677 Ga0466965_0097561 3300044683 Bacteria 1500
678 Ga0466964_0333770 3300044706 Bacteria 774
679 Ga0453684_0435002 3300044712 Bacteria 1463
680 Ga0466968_0672124 3300044735 Unclassified 527
681 Ga0466970_0802014 3300044765 Unclassified 551
682 Ga0466959_1068377 3300045049 Bacteria 537
683 Ga0495592_0058314 3300046454 Bacteria 2848
684 Ga0495603_0256095 3300046455 Bacteria 1008
685 Ga0495638_0083919 3300046460 Bacteria 1929
686 Ga0495638_0223917 3300046460 Bacteria 1050
687 Ga0495651_0964554 3300046462 Bacteria 519
688 Ga0495653_0072724 3300046463 Bacteria 2567
689 Ga0495650_0024366 3300046471 Bacteria 2859
690 Ga0495580_0262447 3300046472 Bacteria 1181
691 Ga0495580_0766867 3300046472 Bacteria 627
692 Ga0495582_0388122 3300046473 Bacteria 805
693 Ga0495594_0471937 3300046499 Bacteria 713
694 Ga0495606_0006493 3300046507 Bacteria 10759
695 Ga0495608_0012072 3300046511 Bacteria 6005
696 Ga0495618_0020169 3300046514 Bacteria 4104
697 Ga0495628_0008937 3300046516 Bacteria 8568
698 Ga0495630_0017830 3300046517 Bacteria 5207
699 Ga0495630_1173261 3300046517 Bacteria 581
700 Ga0495652_0566666 3300046529 Bacteria 779
701 Ga0495640_0024578 3300046533 Bacteria 4382
702 Ga0495587_0115395 3300046536 Bacteria 1541
703 Ga0495598_0047315 3300046537 Bacteria 1282
704 Ga0495598_0412749 3300046537 Bacteria 529
705 Ga0495667_0041562 3300046559 Bacteria 3049
706 Ga0495668_0000191 3300046616 Bacteria 90923
707 Ga0495634_0023809 3300046642 Bacteria 4302
708 Ga0495625_0344288 3300046660 Bacteria 944
709 Ga0495635_0033509 3300046663 Bacteria 3563
710 Ga0495657_0324594 3300046675 Bacteria 914
711 Ga0495647_0408132 3300046681 Bacteria 625
712 Ga0495613_0151946 3300046689 Bacteria 1651
713 Ga0495613_0316598 3300046689 Bacteria 1078
714 Ga0495670_0031502 3300046691 Bacteria 2636
715 Ga0495649_0332965 3300046694 Unclassified 769
716 Ga0495649_0606467 3300046694 Bacteria 540
717 Ga0495600_0257975 3300046809 Bacteria 1108
718 Ga0495604_0070404 3300047317 Bacteria 2649
719 Ga0495636_0174575 3300047318 Bacteria 973
720 Ga0495674_0303326 3300047319 Bacteria 1304
721 Ga0495676_0504416 3300047321 Bacteria 794
722 Ga0495680_0035982 3300047322 Bacteria 3981
723 Ga0495686_0231403 3300047472 Bacteria 1046
724 Ga0496100_0763862 3300048903 Unclassified 756
725 Ga0496101_0111499 3300048904 Bacteria 2059
726 Ga0496104_0731446 3300048907 Bacteria 897
727 Ga0496105_0930522 3300048908 Bacteria 654
728 Ga0496109_0900193 3300048912 Bacteria 823
729 Ga0496111_0747131 3300048914 Bacteria 710
730 Ga0496114_0294487 3300048917 Bacteria 1432
731 Ga0496126_1006528 3300048929 Bacteria 625
732 Ga0501306_007578 3300049127 Bacteria 1303
733 Ga0501345_07567 3300049134 Bacteria 526
734 Ga0501311_072167 3300049527 Unclassified 575
735 Ga0501313_022447 3300049529 Unclassified 787
736 Ga0501315_079438 3300049531 Bacteria 555
737 Ga0501316_046441 3300049532 Unclassified 616
738 Ga0501320_012948 3300049536 Bacteria 885
739 Ga0501321_018570 3300049537 Bacteria 845
740 Ga0501336_003998 3300049552 Bacteria 1020
741 Ga0501031_0005772 3300049568 Bacteria 8068
742 Ga0501033_0114330 3300049570 Bacteria 1962
743 Ga0501034_0038226 3300049571 Bacteria 4860
744 Ga0501036_0009955 3300049572 Bacteria 7829
745 Ga0501037_0032648 3300049573 Bacteria 3845
746 Ga0501038_0005905 3300049574 Bacteria 11315
747 Ga0501039_0013024 3300049575 Bacteria 6357
748 Ga0501043_0009337 3300049579 Bacteria 7705
749 Ga0501046_0052113 3300049580 Bacteria 3226
750 Ga0501047_0443886 3300049581 Unclassified 1127
751 Ga0501047_0864956 3300049581 Bacteria 718
752 Ga0501072_0348421 3300049588 Unclassified 1176
753 Ga0501073_0069872 3300049589 Bacteria 2447
754 Ga0501080_0032906 3300049742 Bacteria 4838
755 Ga0501274_038594 3300049771 Bacteria 566
756 Ga0501035_0050477 3300049822 Bacteria 3728
757 Ga0501044_0004248 3300049823 Bacteria 16071
758 Ga0501044_0037946 3300049823 Bacteria 5034
759 Ga0501044_0123100 3300049823 Unclassified 2593
760 nmdc:mga0k408_399816_c1 3300050493 Bacteria 818
761 nmdc:mga0k408_62578_c1 3300050493 Bacteria 2164
762 nmdc:mga07m45_379224_c1 3300050496 Bacteria 821
763 nmdc:mga07m45_69219_c1 3300050496 Bacteria 2006
764 nmdc:mga07m45_735907_c1 3300050496 Bacteria 566
765 nmdc:mga09592_471205_c1 3300050508 Bacteria 1083
766 nmdc:mga09592_656665_c1 3300050508 Bacteria 895
767 nmdc:mga09592_70262_c1 3300050508 Bacteria 2971
768 nmdc:mga09592_926671_c1 3300050508 Bacteria 731
769 nmdc:mga0qj67_1010971_c1 3300050509 Bacteria 652
770 nmdc:mga0qj67_85711_c1 3300050509 Bacteria 2527
771 nmdc:mga06r32_145795_c1 3300050510 Bacteria 2345
772 nmdc:mga0n895_1080853_c1 3300050512 Bacteria 780
773 nmdc:mga0n895_485544_c1 3300050512 Unclassified 1245
774 nmdc:mga0a205_797619_c1 3300050515 Bacteria 792
775 Ga0495619_0017003 3300053085 Bacteria 4610
776 Ga0500562_013235 3300053108 Bacteria 2105
777 Ga0500593_103971 3300053117 Bacteria 1180
778 Ga0500559_0530160 3300053136 Bacteria 539
779 Ga0500588_0236510 3300053146 Bacteria 684
780 Ga0500616_0139029 3300053153 Bacteria 1138
781 Ga0500622_0391746 3300053156 Unclassified 566
782 Ga0500611_000032 3300053727 Bacteria 83927
783 Ga0500645_051002 3300053730 Bacteria 1207
784 Ga0587091_224114 3300059511 Bacteria 516
785 Ga0587109_059983 3300059624 Unclassified 799
786 Ga0587128_118650 3300059630 Bacteria 574
787 Ga0587067_084412 3300059640 Bacteria 709

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10358180 Ga0065704_103581801 98
2 3300041444 Ga0451790_40603 Ga0451790_40603_34_330 98
3 3300041486 Ga0451807_2654774 Ga0451807_2654774_474_770 98
4 3300046616 Ga0495668_0000191 Ga0495668_0000191_42422_42718 98
5 3300048929 Ga0496126_1006528 Ga0496126_1006528_240_536 98
6 3300053136 Ga0500559_0530160 Ga0500559_0530160_119_415 98
7 3300002459 JGI24751J29686_10001390 JGI24751J29686_100013905 99
8 3300003316 rootH1_10008428 rootH1_100084282 99
9 3300003316 rootH1_10137063 rootH1_101370632 99
10 3300003320 rootH2_10022358 rootH2_100223582 99
11 3300003322 rootL2_10149151 rootL2_101491512 99
12 3300003323 rootH1_10083104 rootH1_100831044 99
13 3300004798 Ga0058859_11572014 Ga0058859_115720142 99
14 3300004801 Ga0058860_12028199 Ga0058860_120281992 99
15 3300004801 Ga0058860_12218397 Ga0058860_122183971 99
16 3300005277 Ga0065716_1019128 Ga0065716_10191282 99
17 3300005288 Ga0065714_10176271 Ga0065714_101762712 99
18 3300005288 Ga0065714_10177684 Ga0065714_101776841 99
19 3300005289 Ga0065704_10233298 Ga0065704_102332981 99
20 3300005290 Ga0065712_10010764 Ga0065712_100107642 99
21 3300005290 Ga0065712_10020318 Ga0065712_100203182 99
22 3300005290 Ga0065712_10181032 Ga0065712_101810321 99
23 3300005293 Ga0065715_10474826 Ga0065715_104748262 99
24 3300005295 Ga0065707_10333640 Ga0065707_103336401 99
25 3300005327 Ga0070658_10430094 Ga0070658_104300942 99
26 3300005327 Ga0070658_11652234 Ga0070658_116522341 99
27 3300005328 Ga0070676_10080339 Ga0070676_100803394 99
28 3300005328 Ga0070676_10152918 Ga0070676_101529182 99
29 3300005328 Ga0070676_10983853 Ga0070676_109838532 99
30 3300005328 Ga0070676_11173912 Ga0070676_111739121 99
31 3300005329 Ga0070683_100012473 Ga0070683_10001247313 99
32 3300005329 Ga0070683_100013707 Ga0070683_1000137075 99
33 3300005330 Ga0070690_100012030 Ga0070690_1000120305 99
34 3300005330 Ga0070690_100241897 Ga0070690_1002418972 99
35 3300005330 Ga0070690_100271982 Ga0070690_1002719822 99
36 3300005330 Ga0070690_100608450 Ga0070690_1006084502 99
37 3300005331 Ga0070670_100158102 Ga0070670_1001581022 99
38 3300005331 Ga0070670_100296962 Ga0070670_1002969622 99
39 3300005331 Ga0070670_100405561 Ga0070670_1004055612 99
40 3300005333 Ga0070677_10044332 Ga0070677_100443323 99
41 3300005333 Ga0070677_10295001 Ga0070677_102950012 99
42 3300005333 Ga0070677_10329637 Ga0070677_103296372 99
43 3300005334 Ga0068869_100017755 Ga0068869_1000177553 99
44 3300005334 Ga0068869_100164027 Ga0068869_1001640272 99
45 3300005334 Ga0068869_100186493 Ga0068869_1001864931 99
46 3300005334 Ga0068869_100635703 Ga0068869_1006357032 99
47 3300005334 Ga0068869_100885241 Ga0068869_1008852412 99
48 3300005334 Ga0068869_101329351 Ga0068869_1013293511 99
49 3300005335 Ga0070666_10047180 Ga0070666_100471806 99
50 3300005337 Ga0070682_100000039 Ga0070682_10000003994 99
51 3300005337 Ga0070682_100054491 Ga0070682_1000544912 99
52 3300005337 Ga0070682_100066166 Ga0070682_1000661663 99
53 3300005337 Ga0070682_100774566 Ga0070682_1007745662 99
54 3300005337 Ga0070682_101451664 Ga0070682_1014516642 99
55 3300005338 Ga0068868_100017514 Ga0068868_1000175144 99
56 3300005338 Ga0068868_100123647 Ga0068868_1001236473 99
57 3300005338 Ga0068868_100425091 Ga0068868_1004250911 99
58 3300005338 Ga0068868_100595145 Ga0068868_1005951452 99
59 3300005339 Ga0070660_100979665 Ga0070660_1009796651 99
60 3300005340 Ga0070689_101381644 Ga0070689_1013816441 99
61 3300005343 Ga0070687_100128780 Ga0070687_1001287803 99
62 3300005343 Ga0070687_101437085 Ga0070687_1014370851 99
63 3300005343 Ga0070687_101482004 Ga0070687_1014820041 99
64 3300005344 Ga0070661_100401046 Ga0070661_1004010462 99
65 3300005344 Ga0070661_101094601 Ga0070661_1010946011 99
66 3300005347 Ga0070668_100050126 Ga0070668_1000501265 99
67 3300005347 Ga0070668_100155369 Ga0070668_1001553691 99
68 3300005353 Ga0070669_100164458 Ga0070669_1001644581 99
69 3300005353 Ga0070669_100264468 Ga0070669_1002644682 99
70 3300005353 Ga0070669_100724776 Ga0070669_1007247762 99
71 3300005353 Ga0070669_100771408 Ga0070669_1007714082 99
72 3300005353 Ga0070669_100999050 Ga0070669_1009990502 99
73 3300005354 Ga0070675_100304522 Ga0070675_1003045222 99
74 3300005354 Ga0070675_100348087 Ga0070675_1003480872 99
75 3300005354 Ga0070675_101352475 Ga0070675_1013524752 99
76 3300005355 Ga0070671_100027874 Ga0070671_1000278749 99
77 3300005355 Ga0070671_100059066 Ga0070671_1000590664 99
78 3300005355 Ga0070671_100524570 Ga0070671_1005245702 99
79 3300005355 Ga0070671_100739459 Ga0070671_1007394592 99
80 3300005355 Ga0070671_101113529 Ga0070671_1011135291 99
81 3300005356 Ga0070674_100816159 Ga0070674_1008161591 99
82 3300005364 Ga0070673_100030215 Ga0070673_1000302157 99
83 3300005364 Ga0070673_100373624 Ga0070673_1003736242 99
84 3300005364 Ga0070673_100782635 Ga0070673_1007826352 99
85 3300005364 Ga0070673_100908377 Ga0070673_1009083772 99
86 3300005364 Ga0070673_101586386 Ga0070673_1015863862 99
87 3300005364 Ga0070673_102274756 Ga0070673_1022747561 99
88 3300005365 Ga0070688_100496873 Ga0070688_1004968732 99
89 3300005366 Ga0070659_100010418 Ga0070659_1000104183 99
90 3300005366 Ga0070659_100293641 Ga0070659_1002936412 99
91 3300005367 Ga0070667_100162213 Ga0070667_1001622133 99
92 3300005367 Ga0070667_100187787 Ga0070667_1001877873 99
93 3300005367 Ga0070667_100367061 Ga0070667_1003670612 99
94 3300005367 Ga0070667_100446979 Ga0070667_1004469792 99
95 3300005367 Ga0070667_100497691 Ga0070667_1004976912 99
96 3300005367 Ga0070667_101994815 Ga0070667_1019948152 99
97 3300005367 Ga0070667_102150443 Ga0070667_1021504431 99
98 3300005367 Ga0070667_102341496 Ga0070667_1023414961 99
99 3300005438 Ga0070701_10030686 Ga0070701_100306865 99
100 3300005441 Ga0070700_100400731 Ga0070700_1004007312 99
101 3300005441 Ga0070700_101288740 Ga0070700_1012887401 99
102 3300005444 Ga0070694_100152300 Ga0070694_1001523003 99
103 3300005455 Ga0070663_100824540 Ga0070663_1008245402 99
104 3300005456 Ga0070678_100124839 Ga0070678_1001248391 99
105 3300005456 Ga0070678_100197824 Ga0070678_1001978242 99
106 3300005456 Ga0070678_100310570 Ga0070678_1003105702 99
107 3300005456 Ga0070678_100397012 Ga0070678_1003970122 99
108 3300005456 Ga0070678_101138746 Ga0070678_1011387462 99
109 3300005456 Ga0070678_101813579 Ga0070678_1018135791 99
110 3300005457 Ga0070662_100044485 Ga0070662_1000444853 99
111 3300005459 Ga0068867_100011408 Ga0068867_1000114085 99
112 3300005459 Ga0068867_100031243 Ga0068867_1000312432 99
113 3300005459 Ga0068867_100218385 Ga0068867_1002183853 99
114 3300005459 Ga0068867_100461505 Ga0068867_1004615052 99
115 3300005459 Ga0068867_100843120 Ga0068867_1008431202 99
116 3300005459 Ga0068867_101068658 Ga0068867_1010686582 99
117 3300005459 Ga0068867_101090094 Ga0068867_1010900942 99
118 3300005466 Ga0070685_10075150 Ga0070685_100751502 99
119 3300005466 Ga0070685_10108040 Ga0070685_101080403 99
120 3300005471 Ga0070698_100002339 Ga0070698_10000233919 99
121 3300005471 Ga0070698_100002802 Ga0070698_10000280225 99
122 3300005471 Ga0070698_100021125 Ga0070698_1000211253 99
123 3300005471 Ga0070698_100241874 Ga0070698_1002418742 99
124 3300005535 Ga0070684_100050088 Ga0070684_1000500886 99
125 3300005535 Ga0070684_100069741 Ga0070684_1000697412 99
126 3300005535 Ga0070684_101742365 Ga0070684_1017423651 99
127 3300005539 Ga0068853_100013022 Ga0068853_1000130222 99
128 3300005539 Ga0068853_100021938 Ga0068853_10002193810 99
129 3300005539 Ga0068853_100053834 Ga0068853_1000538345 99
130 3300005539 Ga0068853_100177645 Ga0068853_1001776451 99
131 3300005539 Ga0068853_100187386 Ga0068853_1001873862 99
132 3300005539 Ga0068853_100672055 Ga0068853_1006720551 99
133 3300005539 Ga0068853_101262350 Ga0068853_1012623502 99
134 3300005539 Ga0068853_101423282 Ga0068853_1014232822 99
135 3300005543 Ga0070672_100140535 Ga0070672_1001405354 99
136 3300005543 Ga0070672_100268088 Ga0070672_1002680882 99
137 3300005543 Ga0070672_101033833 Ga0070672_1010338332 99
138 3300005543 Ga0070672_101073298 Ga0070672_1010732982 99
139 3300005543 Ga0070672_101368455 Ga0070672_1013684551 99
140 3300005544 Ga0070686_100131761 Ga0070686_1001317612 99
141 3300005544 Ga0070686_100339360 Ga0070686_1003393602 99
142 3300005545 Ga0070695_100328010 Ga0070695_1003280102 99
143 3300005548 Ga0070665_101230939 Ga0070665_1012309391 99
144 3300005548 Ga0070665_101676357 Ga0070665_1016763572 99
145 3300005548 Ga0070665_102105013 Ga0070665_1021050132 99
146 3300005549 Ga0070704_100100614 Ga0070704_1001006142 99
147 3300005563 Ga0068855_100000133 Ga0068855_1000001335 99
148 3300005563 Ga0068855_100161856 Ga0068855_1001618562 99
149 3300005563 Ga0068855_101205999 Ga0068855_1012059992 99
150 3300005563 Ga0068855_101297998 Ga0068855_1012979982 99
151 3300005564 Ga0070664_100041775 Ga0070664_1000417752 99
152 3300005564 Ga0070664_101314925 Ga0070664_1013149252 99
153 3300005577 Ga0068857_100018409 Ga0068857_1000184096 99
154 3300005577 Ga0068857_100049652 Ga0068857_1000496525 99
155 3300005577 Ga0068857_100085136 Ga0068857_1000851363 99
156 3300005577 Ga0068857_100200825 Ga0068857_1002008251 99
157 3300005577 Ga0068857_100410529 Ga0068857_1004105293 99
158 3300005577 Ga0068857_101296490 Ga0068857_1012964901 99
159 3300005578 Ga0068854_100142005 Ga0068854_1001420052 99
160 3300005578 Ga0068854_100203791 Ga0068854_1002037911 99
161 3300005578 Ga0068854_100261616 Ga0068854_1002616162 99
162 3300005578 Ga0068854_101028985 Ga0068854_1010289851 99
163 3300005614 Ga0068856_100324230 Ga0068856_1003242302 99
164 3300005614 Ga0068856_102538049 Ga0068856_1025380492 99
165 3300005615 Ga0070702_100049731 Ga0070702_1000497312 99
166 3300005615 Ga0070702_101226973 Ga0070702_1012269732 99
167 3300005616 Ga0068852_100001842 Ga0068852_1000018428 99
168 3300005616 Ga0068852_100054084 Ga0068852_1000540845 99
169 3300005616 Ga0068852_100399528 Ga0068852_1003995282 99
170 3300005616 Ga0068852_100541074 Ga0068852_1005410742 99
171 3300005616 Ga0068852_100548083 Ga0068852_1005480832 99
172 3300005616 Ga0068852_100770817 Ga0068852_1007708172 99
173 3300005617 Ga0068859_100000536 Ga0068859_10000053616 99
174 3300005617 Ga0068859_100224760 Ga0068859_1002247603 99
175 3300005617 Ga0068859_100378987 Ga0068859_1003789872 99
176 3300005617 Ga0068859_101038780 Ga0068859_1010387802 99
177 3300005617 Ga0068859_101113972 Ga0068859_1011139722 99
178 3300005617 Ga0068859_101363145 Ga0068859_1013631452 99
179 3300005617 Ga0068859_102320201 Ga0068859_1023202012 99
180 3300005618 Ga0068864_100078002 Ga0068864_1000780024 99
181 3300005618 Ga0068864_100107079 Ga0068864_1001070792 99
182 3300005618 Ga0068864_100700002 Ga0068864_1007000021 99
183 3300005618 Ga0068864_100774454 Ga0068864_1007744542 99
184 3300005618 Ga0068864_101231108 Ga0068864_1012311082 99
185 3300005618 Ga0068864_101277046 Ga0068864_1012770462 99
186 3300005618 Ga0068864_101578938 Ga0068864_1015789382 99
187 3300005718 Ga0068866_10167116 Ga0068866_101671163 99
188 3300005718 Ga0068866_10244880 Ga0068866_102448802 99
189 3300005718 Ga0068866_10804666 Ga0068866_108046662 99
190 3300005719 Ga0068861_100134738 Ga0068861_1001347382 99
191 3300005719 Ga0068861_100209084 Ga0068861_1002090842 99
192 3300005719 Ga0068861_100261089 Ga0068861_1002610892 99
193 3300005719 Ga0068861_100272552 Ga0068861_1002725523 99
194 3300005719 Ga0068861_100297679 Ga0068861_1002976792 99
195 3300005719 Ga0068861_100609875 Ga0068861_1006098752 99
196 3300005719 Ga0068861_101741185 Ga0068861_1017411851 99
197 3300005719 Ga0068861_102418491 Ga0068861_1024184911 99
198 3300005834 Ga0068851_10309859 Ga0068851_103098592 99
199 3300005834 Ga0068851_11042207 Ga0068851_110422071 99
200 3300005840 Ga0068870_10172613 Ga0068870_101726132 99
201 3300005840 Ga0068870_10681471 Ga0068870_106814713 99
202 3300005841 Ga0068863_100098427 Ga0068863_1000984272 99
203 3300005841 Ga0068863_100114726 Ga0068863_1001147262 99
204 3300005841 Ga0068863_100410048 Ga0068863_1004100482 99
205 3300005841 Ga0068863_101278366 Ga0068863_1012783662 99
206 3300005841 Ga0068863_102614408 Ga0068863_1026144082 99
207 3300005842 Ga0068858_100109140 Ga0068858_1001091404 99
208 3300005842 Ga0068858_101055247 Ga0068858_1010552471 99
209 3300005842 Ga0068858_101414979 Ga0068858_1014149791 99
210 3300005843 Ga0068860_100010482 Ga0068860_1000104826 99
211 3300005843 Ga0068860_100173927 Ga0068860_1001739273 99
212 3300005843 Ga0068860_100280646 Ga0068860_1002806462 99
213 3300005843 Ga0068860_100788115 Ga0068860_1007881152 99
214 3300005843 Ga0068860_100793324 Ga0068860_1007933242 99
215 3300005843 Ga0068860_100916554 Ga0068860_1009165542 99
216 3300005843 Ga0068860_102626909 Ga0068860_1026269091 99
217 3300005843 Ga0068860_102799295 Ga0068860_1027992951 99
218 3300005844 Ga0068862_100032080 Ga0068862_1000320807 99
219 3300005844 Ga0068862_100714805 Ga0068862_1007148052 99
220 3300005844 Ga0068862_101540653 Ga0068862_1015406532 99
221 3300006058 Ga0075432_10114297 Ga0075432_101142972 99
222 3300006163 Ga0070715_10041724 Ga0070715_100417242 99
223 3300006163 Ga0070715_10073647 Ga0070715_100736472 99
224 3300006163 Ga0070715_10127624 Ga0070715_101276242 99
225 3300006195 Ga0075366_10082945 Ga0075366_100829452 99
226 3300006195 Ga0075366_10508980 Ga0075366_105089802 99
227 3300006237 Ga0097621_100003401 Ga0097621_1000034013 99
228 3300006237 Ga0097621_100036790 Ga0097621_1000367903 99
229 3300006237 Ga0097621_100050215 Ga0097621_1000502152 99
230 3300006237 Ga0097621_100410740 Ga0097621_1004107401 99
231 3300006237 Ga0097621_100422407 Ga0097621_1004224072 99
232 3300006237 Ga0097621_100537595 Ga0097621_1005375952 99
233 3300006237 Ga0097621_100680226 Ga0097621_1006802262 99
234 3300006353 Ga0075370_10173219 Ga0075370_101732193 99
235 3300006353 Ga0075370_10537878 Ga0075370_105378781 99
236 3300006353 Ga0075370_10824576 Ga0075370_108245762 99
237 3300006358 Ga0068871_100000955 Ga0068871_10000095519 99
238 3300006358 Ga0068871_100108578 Ga0068871_1001085783 99
239 3300006358 Ga0068871_100134279 Ga0068871_1001342792 99
240 3300006358 Ga0068871_101138415 Ga0068871_1011384151 99
241 3300006358 Ga0068871_101638411 Ga0068871_1016384112 99
242 3300006358 Ga0068871_101751436 Ga0068871_1017514361 99
243 3300006844 Ga0075428_100029189 Ga0075428_1000291894 99
244 3300006844 Ga0075428_100044984 Ga0075428_1000449846 99
245 3300006844 Ga0075428_100527725 Ga0075428_1005277252 99
246 3300006844 Ga0075428_101374511 Ga0075428_1013745111 99
247 3300006847 Ga0075431_100019798 Ga0075431_1000197982 99
248 3300006847 Ga0075431_101149999 Ga0075431_1011499992 99
249 3300006871 Ga0075434_100562446 Ga0075434_1005624462 99
250 3300006871 Ga0075434_101019333 Ga0075434_1010193331 99
251 3300006880 Ga0075429_100003790 Ga0075429_10000379012 99
252 3300006880 Ga0075429_100060787 Ga0075429_1000607874 99
253 3300006880 Ga0075429_100874597 Ga0075429_1008745972 99
254 3300006880 Ga0075429_100912786 Ga0075429_1009127862 99
255 3300006881 Ga0068865_100093466 Ga0068865_1000934663 99
256 3300006881 Ga0068865_100114198 Ga0068865_1001141983 99
257 3300006881 Ga0068865_100507273 Ga0068865_1005072732 99
258 3300006881 Ga0068865_100704319 Ga0068865_1007043192 99
259 3300006881 Ga0068865_100729034 Ga0068865_1007290341 99
260 3300006881 Ga0068865_100782855 Ga0068865_1007828552 99
261 3300006931 Ga0097620_100000536 Ga0097620_10000053616 99
262 3300006931 Ga0097620_100224745 Ga0097620_1002247453 99
263 3300006931 Ga0097620_100379009 Ga0097620_1003790092 99
264 3300006931 Ga0097620_101038841 Ga0097620_1010388412 99
265 3300006931 Ga0097620_101113995 Ga0097620_1011139952 99
266 3300006931 Ga0097620_101363753 Ga0097620_1013637532 99
267 3300006931 Ga0097620_102320234 Ga0097620_1023202342 99
268 3300009093 Ga0105240_10000398 Ga0105240_1000039864 99
269 3300009093 Ga0105240_10173346 Ga0105240_101733465 99
270 3300009093 Ga0105240_10283628 Ga0105240_102836281 99
271 3300009093 Ga0105240_10350445 Ga0105240_103504452 99
272 3300009093 Ga0105240_10386714 Ga0105240_103867142 99
273 3300009094 Ga0111539_10667745 Ga0111539_106677452 99
274 3300009094 Ga0111539_10990779 Ga0111539_109907792 99
275 3300009098 Ga0105245_10068029 Ga0105245_100680293 99
276 3300009098 Ga0105245_10901803 Ga0105245_109018032 99
277 3300009101 Ga0105247_10002304 Ga0105247_100023048 99
278 3300009101 Ga0105247_10204681 Ga0105247_102046812 99
279 3300009101 Ga0105247_11197407 Ga0105247_111974072 99
280 3300009101 Ga0105247_11490134 Ga0105247_114901341 99
281 3300009147 Ga0114129_10303837 Ga0114129_103038372 99
282 3300009148 Ga0105243_10711600 Ga0105243_107116002 99
283 3300009148 Ga0105243_11307499 Ga0105243_113074991 99
284 3300009148 Ga0105243_11603262 Ga0105243_116032622 99
285 3300009148 Ga0105243_12456353 Ga0105243_124563532 99
286 3300009174 Ga0105241_10409198 Ga0105241_104091982 99
287 3300009174 Ga0105241_10443550 Ga0105241_104435502 99
288 3300009176 Ga0105242_10055628 Ga0105242_100556282 99
289 3300009176 Ga0105242_10102158 Ga0105242_101021582 99
290 3300009176 Ga0105242_10134109 Ga0105242_101341095 99
291 3300009176 Ga0105242_10336272 Ga0105242_103362722 99
292 3300009176 Ga0105242_10515400 Ga0105242_105154002 99
293 3300009176 Ga0105242_10522285 Ga0105242_105222852 99
294 3300009176 Ga0105242_10634254 Ga0105242_106342542 99
295 3300009176 Ga0105242_10815531 Ga0105242_108155312 99
296 3300009176 Ga0105242_10912916 Ga0105242_109129162 99
297 3300009176 Ga0105242_11229804 Ga0105242_112298042 99
298 3300009176 Ga0105242_11444208 Ga0105242_114442082 99
299 3300009177 Ga0105248_10052937 Ga0105248_100529375 99
300 3300009545 Ga0105237_10018987 Ga0105237_100189872 99
301 3300009545 Ga0105237_10342700 Ga0105237_103427002 99
302 3300009545 Ga0105237_12443590 Ga0105237_124435901 99
303 3300009551 Ga0105238_11080276 Ga0105238_110802762 99
304 3300009551 Ga0105238_11200524 Ga0105238_112005242 99
305 3300009551 Ga0105238_11941973 Ga0105238_119419731 99
306 3300009553 Ga0105249_10000806 Ga0105249_1000080611 99
307 3300009553 Ga0105249_10025715 Ga0105249_100257156 99
308 3300009553 Ga0105249_10053538 Ga0105249_100535385 99
309 3300009553 Ga0105249_10075766 Ga0105249_100757665 99
310 3300009553 Ga0105249_10077951 Ga0105249_100779514 99
311 3300009553 Ga0105249_10308059 Ga0105249_103080593 99
312 3300009553 Ga0105249_10500048 Ga0105249_105000482 99
313 3300009553 Ga0105249_11267198 Ga0105249_112671982 99
314 3300009553 Ga0105249_11603973 Ga0105249_116039732 99
315 3300009553 Ga0105249_11961295 Ga0105249_119612952 99
316 3300009553 Ga0105249_12224878 Ga0105249_122248782 99
317 3300010375 Ga0105239_10188341 Ga0105239_101883414 99
318 3300010375 Ga0105239_10444888 Ga0105239_104448882 99
319 3300010375 Ga0105239_12305401 Ga0105239_123054012 99
320 3300011119 Ga0105246_10290685 Ga0105246_102906852 99
321 3300011119 Ga0105246_11464053 Ga0105246_114640531 99
322 3300011119 Ga0105246_12047322 Ga0105246_120473222 99
323 3300013100 Ga0157373_10041402 Ga0157373_100414023 99
324 3300013100 Ga0157373_10175037 Ga0157373_101750371 99
325 3300013102 Ga0157371_10036963 Ga0157371_100369634 99
326 3300013102 Ga0157371_10043957 Ga0157371_100439573 99
327 3300013104 Ga0157370_10011345 Ga0157370_100113458 99
328 3300013104 Ga0157370_10017050 Ga0157370_100170504 99
329 3300013104 Ga0157370_10022725 Ga0157370_100227255 99
330 3300013104 Ga0157370_10146677 Ga0157370_101466773 99
331 3300013104 Ga0157370_10565943 Ga0157370_105659432 99
332 3300013105 Ga0157369_10063647 Ga0157369_100636473 99
333 3300013105 Ga0157369_10100758 Ga0157369_101007582 99
334 3300013105 Ga0157369_10548844 Ga0157369_105488442 99
335 3300013105 Ga0157369_12193327 Ga0157369_121933272 99
336 3300013296 Ga0157374_10000001 Ga0157374_10000001389 99
337 3300013296 Ga0157374_10418497 Ga0157374_104184972 99
338 3300013296 Ga0157374_11124223 Ga0157374_111242232 99
339 3300013296 Ga0157374_11268781 Ga0157374_112687812 99
340 3300013296 Ga0157374_11708945 Ga0157374_117089452 99
341 3300013297 Ga0157378_10012000 Ga0157378_100120005 99
342 3300013297 Ga0157378_10025313 Ga0157378_100253135 99
343 3300013297 Ga0157378_10079785 Ga0157378_100797852 99
344 3300013297 Ga0157378_10292781 Ga0157378_102927813 99
345 3300013297 Ga0157378_10538693 Ga0157378_105386932 99
346 3300013297 Ga0157378_10580476 Ga0157378_105804762 99
347 3300013297 Ga0157378_11227888 Ga0157378_112278882 99
348 3300013297 Ga0157378_12243419 Ga0157378_122434192 99
349 3300013306 Ga0163162_10022373 Ga0163162_100223732 99
350 3300013306 Ga0163162_10024199 Ga0163162_100241992 99
351 3300013306 Ga0163162_10299937 Ga0163162_102999373 99
352 3300013306 Ga0163162_10350615 Ga0163162_103506152 99
353 3300013306 Ga0163162_12140365 Ga0163162_121403651 99
354 3300013307 Ga0157372_10016644 Ga0157372_100166447 99
355 3300013307 Ga0157372_10051126 Ga0157372_100511265 99
356 3300013307 Ga0157372_10219265 Ga0157372_102192653 99
357 3300013307 Ga0157372_10999635 Ga0157372_109996352 99
358 3300013307 Ga0157372_11106207 Ga0157372_111062072 99
359 3300013307 Ga0157372_12765166 Ga0157372_127651662 99
360 3300013308 Ga0157375_10001463 Ga0157375_1000146325 99
361 3300013308 Ga0157375_10005027 Ga0157375_100050275 99
362 3300013308 Ga0157375_10159900 Ga0157375_101599004 99
363 3300013308 Ga0157375_10645367 Ga0157375_106453672 99
364 3300013308 Ga0157375_11820428 Ga0157375_118204282 99
365 3300013308 Ga0157375_13347282 Ga0157375_133472821 99
366 3300014325 Ga0163163_10036393 Ga0163163_100363935 99
367 3300014325 Ga0163163_10300122 Ga0163163_103001222 99
368 3300014325 Ga0163163_10382911 Ga0163163_103829112 99
369 3300014325 Ga0163163_10393167 Ga0163163_103931672 99
370 3300014325 Ga0163163_10451802 Ga0163163_104518022 99
371 3300014325 Ga0163163_12045409 Ga0163163_120454092 99
372 3300014325 Ga0163163_12402330 Ga0163163_124023301 99
373 3300014326 Ga0157380_11073201 Ga0157380_110732011 99
374 3300014326 Ga0157380_11914737 Ga0157380_119147372 99
375 3300014326 Ga0157380_12414872 Ga0157380_124148722 99
376 3300014326 Ga0157380_13015544 Ga0157380_130155441 99
377 3300014745 Ga0157377_10059401 Ga0157377_100594013 99
378 3300014745 Ga0157377_10157358 Ga0157377_101573582 99
379 3300014745 Ga0157377_10596912 Ga0157377_105969121 99
380 3300014968 Ga0157379_10294026 Ga0157379_102940263 99
381 3300014968 Ga0157379_10433737 Ga0157379_104337372 99
382 3300014968 Ga0157379_10472215 Ga0157379_104722152 99
383 3300014968 Ga0157379_10581884 Ga0157379_105818841 99
384 3300014968 Ga0157379_11029031 Ga0157379_110290311 99
385 3300014968 Ga0157379_11058351 Ga0157379_110583512 99
386 3300014968 Ga0157379_11924823 Ga0157379_119248232 99
387 3300014968 Ga0157379_11942415 Ga0157379_119424152 99
388 3300014969 Ga0157376_10008523 Ga0157376_100085232 99
389 3300014969 Ga0157376_10022078 Ga0157376_100220784 99
390 3300014969 Ga0157376_10110820 Ga0157376_101108203 99
391 3300014969 Ga0157376_10135197 Ga0157376_101351973 99
392 3300014969 Ga0157376_10205661 Ga0157376_102056613 99
393 3300014969 Ga0157376_11314513 Ga0157376_113145132 99
394 3300017792 Ga0163161_10001357 Ga0163161_1000135714 99
395 3300017792 Ga0163161_10015767 Ga0163161_100157675 99
396 3300017792 Ga0163161_10052210 Ga0163161_100522105 99
397 3300017792 Ga0163161_10380022 Ga0163161_103800222 99
398 3300020070 Ga0206356_11242059 Ga0206356_112420594 99
399 3300020078 Ga0206352_10807008 Ga0206352_108070082 99
400 3300020078 Ga0206352_10905181 Ga0206352_109051812 99
401 3300020610 Ga0154015_1594150 Ga0154015_15941502 99
402 3300025271 Ga0207666_1058299 Ga0207666_10582992 99
403 3300025315 Ga0207697_10169011 Ga0207697_101690112 99
404 3300025315 Ga0207697_10239158 Ga0207697_102391582 99
405 3300025321 Ga0207656_10013408 Ga0207656_100134085 99
406 3300025321 Ga0207656_10177343 Ga0207656_101773432 99
407 3300025893 Ga0207682_10003346 Ga0207682_100033462 99
408 3300025899 Ga0207642_10027020 Ga0207642_100270202 99
409 3300025899 Ga0207642_10742750 Ga0207642_107427502 99
410 3300025899 Ga0207642_11103263 Ga0207642_111032632 99
411 3300025900 Ga0207710_10002332 Ga0207710_100023326 99
412 3300025901 Ga0207688_10158876 Ga0207688_101588763 99
413 3300025903 Ga0207680_10055057 Ga0207680_100550572 99
414 3300025903 Ga0207680_10148616 Ga0207680_101486162 99
415 3300025903 Ga0207680_11316308 Ga0207680_113163082 99
416 3300025904 Ga0207647_10020448 Ga0207647_100204485 99
417 3300025905 Ga0207685_10187861 Ga0207685_101878612 99
418 3300025905 Ga0207685_10381598 Ga0207685_103815982 99
419 3300025907 Ga0207645_10025677 Ga0207645_100256772 99
420 3300025907 Ga0207645_10058686 Ga0207645_100586862 99
421 3300025907 Ga0207645_10158170 Ga0207645_101581701 99
422 3300025907 Ga0207645_10373454 Ga0207645_103734542 99
423 3300025907 Ga0207645_10844175 Ga0207645_108441751 99
424 3300025909 Ga0207705_10732079 Ga0207705_107320792 99
425 3300025909 Ga0207705_11503884 Ga0207705_115038841 99
426 3300025910 Ga0207684_10515844 Ga0207684_105158442 99
427 3300025911 Ga0207654_10036156 Ga0207654_100361563 99
428 3300025911 Ga0207654_10616040 Ga0207654_106160402 99
429 3300025911 Ga0207654_11289273 Ga0207654_112892731 99
430 3300025913 Ga0207695_10000076 Ga0207695_1000007642 99
431 3300025913 Ga0207695_10000090 Ga0207695_1000009042 99
432 3300025913 Ga0207695_10015473 Ga0207695_100154734 99
433 3300025913 Ga0207695_10350323 Ga0207695_103503232 99
434 3300025913 Ga0207695_10946680 Ga0207695_109466802 99
435 3300025913 Ga0207695_11129584 Ga0207695_111295841 99
436 3300025914 Ga0207671_10037137 Ga0207671_100371372 99
437 3300025914 Ga0207671_10040157 Ga0207671_100401574 99
438 3300025918 Ga0207662_10027651 Ga0207662_100276514 99
439 3300025919 Ga0207657_10699411 Ga0207657_106994112 99
440 3300025920 Ga0207649_10277452 Ga0207649_102774521 99
441 3300025920 Ga0207649_10444890 Ga0207649_104448901 99
442 3300025920 Ga0207649_11145177 Ga0207649_111451772 99
443 3300025923 Ga0207681_10201509 Ga0207681_102015092 99
444 3300025923 Ga0207681_10272524 Ga0207681_102725243 99
445 3300025923 Ga0207681_10382313 Ga0207681_103823131 99
446 3300025923 Ga0207681_10786939 Ga0207681_107869391 99
447 3300025923 Ga0207681_11069873 Ga0207681_110698732 99
448 3300025925 Ga0207650_10074493 Ga0207650_100744932 99
449 3300025925 Ga0207650_10959364 Ga0207650_109593642 99
450 3300025927 Ga0207687_10195190 Ga0207687_101951902 99
451 3300025931 Ga0207644_10059737 Ga0207644_100597373 99
452 3300025931 Ga0207644_10072425 Ga0207644_100724254 99
453 3300025931 Ga0207644_10129993 Ga0207644_101299933 99
454 3300025932 Ga0207690_10024446 Ga0207690_100244464 99
455 3300025933 Ga0207706_10006478 Ga0207706_100064783 99
456 3300025933 Ga0207706_10163522 Ga0207706_101635223 99
457 3300025933 Ga0207706_10205207 Ga0207706_102052072 99
458 3300025933 Ga0207706_10675849 Ga0207706_106758492 99
459 3300025934 Ga0207686_10127335 Ga0207686_101273352 99
460 3300025934 Ga0207686_10744788 Ga0207686_107447882 99
461 3300025934 Ga0207686_10981767 Ga0207686_109817672 99
462 3300025934 Ga0207686_11247268 Ga0207686_112472682 99
463 3300025935 Ga0207709_10209441 Ga0207709_102094412 99
464 3300025935 Ga0207709_10375537 Ga0207709_103755372 99
465 3300025936 Ga0207670_10014554 Ga0207670_100145544 99
466 3300025937 Ga0207669_10053018 Ga0207669_100530184 99
467 3300025937 Ga0207669_10828706 Ga0207669_108287062 99
468 3300025938 Ga0207704_10130848 Ga0207704_101308482 99
469 3300025938 Ga0207704_10160734 Ga0207704_101607342 99
470 3300025938 Ga0207704_10308805 Ga0207704_103088052 99
471 3300025938 Ga0207704_10354971 Ga0207704_103549712 99
472 3300025938 Ga0207704_10573488 Ga0207704_105734882 99
473 3300025938 Ga0207704_10592339 Ga0207704_105923391 99
474 3300025938 Ga0207704_10754359 Ga0207704_107543592 99
475 3300025940 Ga0207691_10049197 Ga0207691_100491972 99
476 3300025940 Ga0207691_10596608 Ga0207691_105966082 99
477 3300025940 Ga0207691_10601825 Ga0207691_106018252 99
478 3300025941 Ga0207711_10092009 Ga0207711_100920092 99
479 3300025941 Ga0207711_10182599 Ga0207711_101825992 99
480 3300025942 Ga0207689_10010127 Ga0207689_100101276 99
481 3300025942 Ga0207689_10014249 Ga0207689_100142496 99
482 3300025942 Ga0207689_10045231 Ga0207689_100452315 99
483 3300025942 Ga0207689_10075403 Ga0207689_100754033 99
484 3300025942 Ga0207689_10167478 Ga0207689_101674783 99
485 3300025942 Ga0207689_10182503 Ga0207689_101825033 99
486 3300025942 Ga0207689_10388301 Ga0207689_103883012 99
487 3300025942 Ga0207689_11138320 Ga0207689_111383202 99
488 3300025944 Ga0207661_10019703 Ga0207661_100197035 99
489 3300025944 Ga0207661_10134049 Ga0207661_101340492 99
490 3300025945 Ga0207679_10067722 Ga0207679_100677224 99
491 3300025945 Ga0207679_11540553 Ga0207679_115405532 99
492 3300025945 Ga0207679_11893687 Ga0207679_118936872 99
493 3300025949 Ga0207667_10000453 Ga0207667_1000045351 99
494 3300025949 Ga0207667_10003602 Ga0207667_100036028 99
495 3300025949 Ga0207667_10848084 Ga0207667_108480842 99
496 3300025960 Ga0207651_10568917 Ga0207651_105689171 99
497 3300025960 Ga0207651_10845061 Ga0207651_108450612 99
498 3300025960 Ga0207651_11274784 Ga0207651_112747842 99
499 3300025960 Ga0207651_11459083 Ga0207651_114590832 99
500 3300025960 Ga0207651_11486572 Ga0207651_114865722 99
501 3300025960 Ga0207651_11550697 Ga0207651_115506972 99
502 3300025961 Ga0207712_10016968 Ga0207712_100169682 99
503 3300025961 Ga0207712_10082309 Ga0207712_100823093 99
504 3300025961 Ga0207712_10082897 Ga0207712_100828971 99
505 3300025961 Ga0207712_10318884 Ga0207712_103188842 99
506 3300025961 Ga0207712_10407934 Ga0207712_104079342 99
507 3300025961 Ga0207712_10441535 Ga0207712_104415352 99
508 3300025972 Ga0207668_10074158 Ga0207668_100741582 99
509 3300025972 Ga0207668_10149486 Ga0207668_101494864 99
510 3300025972 Ga0207668_10161771 Ga0207668_101617712 99
511 3300025972 Ga0207668_10788732 Ga0207668_107887322 99
512 3300025981 Ga0207640_10016977 Ga0207640_100169779 99
513 3300025981 Ga0207640_10020295 Ga0207640_100202953 99
514 3300025981 Ga0207640_10766513 Ga0207640_107665132 99
515 3300025981 Ga0207640_11296657 Ga0207640_112966571 99
516 3300025986 Ga0207658_10051578 Ga0207658_100515782 99
517 3300025986 Ga0207658_10348489 Ga0207658_103484892 99
518 3300025986 Ga0207658_10646178 Ga0207658_106461782 99
519 3300025986 Ga0207658_10752020 Ga0207658_107520202 99
520 3300025986 Ga0207658_10982032 Ga0207658_109820321 99
521 3300025986 Ga0207658_11852353 Ga0207658_118523531 99
522 3300026023 Ga0207677_10192753 Ga0207677_101927532 99
523 3300026023 Ga0207677_11416784 Ga0207677_114167841 99
524 3300026023 Ga0207677_11726196 Ga0207677_117261962 99
525 3300026023 Ga0207677_12206673 Ga0207677_122066731 99
526 3300026035 Ga0207703_10835435 Ga0207703_108354352 99
527 3300026035 Ga0207703_11346948 Ga0207703_113469482 99
528 3300026041 Ga0207639_10003633 Ga0207639_1000363319 99
529 3300026041 Ga0207639_10022533 Ga0207639_100225333 99
530 3300026041 Ga0207639_10268603 Ga0207639_102686031 99
531 3300026041 Ga0207639_10822112 Ga0207639_108221122 99
532 3300026041 Ga0207639_11005787 Ga0207639_110057872 99
533 3300026041 Ga0207639_11159955 Ga0207639_111599552 99
534 3300026041 Ga0207639_11951241 Ga0207639_119512411 99
535 3300026041 Ga0207639_12158344 Ga0207639_121583441 99
536 3300026067 Ga0207678_11086737 Ga0207678_110867372 99
537 3300026075 Ga0207708_10887412 Ga0207708_108874122 99
538 3300026088 Ga0207641_10025754 Ga0207641_100257546 99
539 3300026088 Ga0207641_10043824 Ga0207641_100438243 99
540 3300026088 Ga0207641_10091863 Ga0207641_100918633 99
541 3300026088 Ga0207641_10138043 Ga0207641_101380434 99
542 3300026088 Ga0207641_10393151 Ga0207641_103931512 99
543 3300026088 Ga0207641_10545068 Ga0207641_105450682 99
544 3300026088 Ga0207641_10841836 Ga0207641_108418362 99
545 3300026088 Ga0207641_11232996 Ga0207641_112329962 99
546 3300026089 Ga0207648_10009109 Ga0207648_100091095 99
547 3300026089 Ga0207648_10028462 Ga0207648_100284623 99
548 3300026089 Ga0207648_10176788 Ga0207648_101767882 99
549 3300026089 Ga0207648_10232893 Ga0207648_102328932 99
550 3300026089 Ga0207648_10242935 Ga0207648_102429353 99
551 3300026089 Ga0207648_10247850 Ga0207648_102478502 99
552 3300026089 Ga0207648_10967696 Ga0207648_109676962 99
553 3300026089 Ga0207648_11127784 Ga0207648_111277842 99
554 3300026095 Ga0207676_10067110 Ga0207676_100671104 99
555 3300026095 Ga0207676_10083440 Ga0207676_100834402 99
556 3300026095 Ga0207676_10363238 Ga0207676_103632382 99
557 3300026095 Ga0207676_10529410 Ga0207676_105294102 99
558 3300026095 Ga0207676_10680396 Ga0207676_106803961 99
559 3300026116 Ga0207674_10009949 Ga0207674_100099497 99
560 3300026116 Ga0207674_10022667 Ga0207674_100226676 99
561 3300026116 Ga0207674_10025546 Ga0207674_100255463 99
562 3300026116 Ga0207674_10147351 Ga0207674_101473511 99
563 3300026116 Ga0207674_10169071 Ga0207674_101690712 99
564 3300026116 Ga0207674_10171366 Ga0207674_101713663 99
565 3300026118 Ga0207675_100049685 Ga0207675_1000496854 99
566 3300026118 Ga0207675_100068632 Ga0207675_1000686323 99
567 3300026118 Ga0207675_100119254 Ga0207675_1001192542 99
568 3300026118 Ga0207675_100303650 Ga0207675_1003036502 99
569 3300026118 Ga0207675_100605687 Ga0207675_1006056872 99
570 3300026118 Ga0207675_102223409 Ga0207675_1022234092 99
571 3300026121 Ga0207683_10024454 Ga0207683_100244542 99
572 3300026121 Ga0207683_10097053 Ga0207683_100970535 99
573 3300026121 Ga0207683_10236552 Ga0207683_102365523 99
574 3300026121 Ga0207683_10315533 Ga0207683_103155332 99
575 3300026121 Ga0207683_10583777 Ga0207683_105837772 99
576 3300026142 Ga0207698_10013166 Ga0207698_100131663 99
577 3300026142 Ga0207698_10136904 Ga0207698_101369043 99
578 3300026142 Ga0207698_10142388 Ga0207698_101423882 99
579 3300026142 Ga0207698_10232664 Ga0207698_102326642 99
580 3300026142 Ga0207698_10795200 Ga0207698_107952002 99
581 3300026142 Ga0207698_10935954 Ga0207698_109359541 99
582 3300026142 Ga0207698_11010308 Ga0207698_110103081 99
583 3300026142 Ga0207698_11320253 Ga0207698_113202532 99
584 3300027907 Ga0207428_10733645 Ga0207428_107336452 99
585 3300028379 Ga0268266_11387499 Ga0268266_113874992 99
586 3300028379 Ga0268266_11635247 Ga0268266_116352472 99
587 3300028380 Ga0268265_10154569 Ga0268265_101545693 99
588 3300028380 Ga0268265_11076656 Ga0268265_110766561 99
589 3300028380 Ga0268265_11280978 Ga0268265_112809782 99
590 3300028380 Ga0268265_11286890 Ga0268265_112868901 99
591 3300028380 Ga0268265_11542435 Ga0268265_115424352 99
592 3300028380 Ga0268265_12395546 Ga0268265_123955461 99
593 3300028381 Ga0268264_10015090 Ga0268264_100150905 99
594 3300028381 Ga0268264_10061228 Ga0268264_100612282 99
595 3300028381 Ga0268264_10061558 Ga0268264_100615581 99
596 3300028381 Ga0268264_10274759 Ga0268264_102747592 99
597 3300028381 Ga0268264_10356042 Ga0268264_103560422 99
598 3300028381 Ga0268264_10378729 Ga0268264_103787291 99
599 3300028381 Ga0268264_10905782 Ga0268264_109057822 99
600 3300028381 Ga0268264_11184690 Ga0268264_111846901 99
601 3300028794 Ga0307515_10000001 Ga0307515_100000011747 99
602 3300031251 Ga0265327_10000244 Ga0265327_10000244104 99
603 3300031456 Ga0307513_10184519 Ga0307513_101845192 99
604 3300031730 Ga0307516_10677783 Ga0307516_106777832 99
605 3300031852 Ga0307410_10133130 Ga0307410_101331302 99
606 3300031852 Ga0307410_10259089 Ga0307410_102590892 99
607 3300031901 Ga0307406_11795591 Ga0307406_117955911 99
608 3300031901 Ga0307406_12063053 Ga0307406_120630531 99
609 3300031903 Ga0307407_10489098 Ga0307407_104890982 99
610 3300031911 Ga0307412_11035174 Ga0307412_110351741 99
611 3300031911 Ga0307412_12087980 Ga0307412_120879801 99
612 3300031995 Ga0307409_102113213 Ga0307409_1021132131 99
613 3300032002 Ga0307416_103535673 Ga0307416_1035356731 99
614 3300032126 Ga0307415_100359048 Ga0307415_1003590482 99
615 3300033180 Ga0307510_10000380 Ga0307510_1000038029 99
616 3300035086 Ga0373934_0362481 Ga0373934_0362481_289_588 99
617 3300035089 Ga0373944_0058556 Ga0373944_0058556_792_1091 99
618 3300035092 Ga0373952_0052040 Ga0373952_0052040_660_959 99
619 3300035111 Ga0373923_0362113 Ga0373923_0362113_47_346 99
620 3300035113 Ga0373936_0177866 Ga0373936_0177866_162_461 99
621 3300035119 Ga0373956_0041135 Ga0373956_0041135_1687_1986 99
622 3300035170 Ga0373943_0248315 Ga0373943_0248315_131_430 99
623 3300035170 Ga0373943_0913604 Ga0373943_0913604_55_354 99
624 3300035171 Ga0373946_0183334 Ga0373946_0183334_467_766 99
625 3300035172 Ga0373955_0466007 Ga0373955_0466007_300_599 99
626 3300035172 Ga0373955_0929755 Ga0373955_0929755_54_353 99
627 3300035410 Ga0373924_0042226 Ga0373924_0042226_442_741 99
628 3300035691 Ga0373931_0337062 Ga0373931_0337062_606_905 99
629 3300035692 Ga0373935_0121189 Ga0373935_0121189_1107_1406 99
630 3300035692 Ga0373935_1323371 Ga0373935_1323371_223_522 99
631 3300035724 Ga0373933_0073414 Ga0373933_0073414_964_1263 99
632 3300035725 Ga0373947_0572452 Ga0373947_0572452_321_620 99
633 3300035725 Ga0373947_0957318 Ga0373947_0957318_227_526 99
634 3300036401 Ga0373937_0002462 Ga0373937_0002462_5584_5883 99
635 3300037068 Ga0373925_0228924 Ga0373925_0228924_375_674 99
636 3300037418 Ga0395900_0017444 Ga0395900_0017444_5869_6168 99
637 3300037466 Ga0395898_0002718 Ga0395898_0002718_18569_18868 99
638 3300038443 Ga0395901_0158362 Ga0395901_0158362_727_1026 99
639 3300039447 Ga0436361_1211924 Ga0436361_1211924_1506_1805 99
640 3300041404 Ga0439436_0186659 Ga0439436_0186659_75_374 99
641 3300041406 Ga0439439_0031503 Ga0439439_0031503_305_604 99
642 3300041411 Ga0439466_0112609 Ga0439466_0112609_432_731 99
643 3300041444 Ga0451790_27755 Ga0451790_27755_259_561 99
644 3300041444 Ga0451790_41286 Ga0451790_41286_98_400 99
645 3300041451 Ga0451791_1111960 Ga0451791_1111960_129_428 99
646 3300041451 Ga0451791_1436515 Ga0451791_1436515_824_1123 99
647 3300041452 Ga0451793_0068821 Ga0451793_0068821_186_485 99
648 3300041453 Ga0451797_0340668 Ga0451797_0340668_368_667 99
649 3300041458 Ga0451798_0476184 Ga0451798_0476184_56_355 99
650 3300041458 Ga0451798_0824705 Ga0451798_0824705_37_339 99
651 3300041458 Ga0451798_1169930 Ga0451798_1169930_300_602 99
652 3300041459 Ga0451800_0032641 Ga0451800_0032641_349_651 99
653 3300041459 Ga0451800_1619468 Ga0451800_1619468_382_681 99
654 3300041460 Ga0451802_0502259 Ga0451802_0502259_217_516 99
655 3300041460 Ga0451802_2117121 Ga0451802_2117121_190_489 99
656 3300041486 Ga0451807_0407082 Ga0451807_0407082_323_622 99
657 3300041491 Ga0451833_0686487 Ga0451833_0686487_338_637 99
658 3300041496 Ga0451839_0104913 Ga0451839_0104913_27_326 99
659 3300041509 Ga0451843_1604042 Ga0451843_1604042_815_1114 99
660 3300041509 Ga0451843_1614837 Ga0451843_1614837_50_349 99
661 3300041997 Ga0439431_0132096 Ga0439431_0132096_360_659 99
662 3300042001 Ga0439441_008819 Ga0439441_008819_618_917 99
663 3300042003 Ga0439443_037532 Ga0439443_037532_455_754 99
664 3300042005 Ga0439448_0216964 Ga0439448_0216964_77_376 99
665 3300042006 Ga0439432_123592 Ga0439432_123592_259_558 99
666 3300042007 Ga0439449_0078529 Ga0439449_0078529_799_1098 99
667 3300042010 Ga0439452_025585 Ga0439452_025585_540_839 99
668 3300042014 Ga0439457_062867 Ga0439457_062867_300_599 99
669 3300042015 Ga0439462_0015306 Ga0439462_0015306_1637_1936 99
670 3300042122 Ga0450920_054549 Ga0450920_054549_32_331 99
671 3300042125 Ga0450923_013606 Ga0450923_013606_229_528 99
672 3300042131 Ga0450894_006068 Ga0450894_006068_970_1269 99
673 3300042134 Ga0450898_004710 Ga0450898_004710_844_1143 99
674 3300042145 Ga0450906_059401 Ga0450906_059401_190_489 99
675 3300042435 Ga0439434_0002227 Ga0439434_0002227_637_936 99
676 3300042437 Ga0439444_0116582 Ga0439444_0116582_59_358 99
677 3300042531 Ga0450918_061096 Ga0450918_061096_60_359 99
678 3300044673 Ga0453683_0417783 Ga0453683_0417783_281_580 99
679 3300044683 Ga0466965_0097561 Ga0466965_0097561_482_781 99
680 3300044706 Ga0466964_0333770 Ga0466964_0333770_267_566 99
681 3300044712 Ga0453684_0435002 Ga0453684_0435002_1039_1449 99
682 3300044735 Ga0466968_0672124 Ga0466968_0672124_20_319 99
683 3300044765 Ga0466970_0802014 Ga0466970_0802014_62_361 99
684 3300045049 Ga0466959_1068377 Ga0466959_1068377_157_456 99
685 3300046454 Ga0495592_0058314 Ga0495592_0058314_2150_2449 99
686 3300046455 Ga0495603_0256095 Ga0495603_0256095_117_416 99
687 3300046460 Ga0495638_0083919 Ga0495638_0083919_44_343 99
688 3300046460 Ga0495638_0223917 Ga0495638_0223917_23_322 99
689 3300046462 Ga0495651_0964554 Ga0495651_0964554_82_381 99
690 3300046463 Ga0495653_0072724 Ga0495653_0072724_2116_2415 99
691 3300046471 Ga0495650_0024366 Ga0495650_0024366_2056_2355 99
692 3300046472 Ga0495580_0262447 Ga0495580_0262447_554_853 99
693 3300046472 Ga0495580_0766867 Ga0495580_0766867_11_310 99
694 3300046473 Ga0495582_0388122 Ga0495582_0388122_324_623 99
695 3300046499 Ga0495594_0471937 Ga0495594_0471937_114_413 99
696 3300046507 Ga0495606_0006493 Ga0495606_0006493_2946_3245 99
697 3300046511 Ga0495608_0012072 Ga0495608_0012072_3080_3379 99
698 3300046514 Ga0495618_0020169 Ga0495618_0020169_1741_2040 99
699 3300046516 Ga0495628_0008937 Ga0495628_0008937_7769_8068 99
700 3300046517 Ga0495630_0017830 Ga0495630_0017830_4535_4834 99
701 3300046517 Ga0495630_1173261 Ga0495630_1173261_48_347 99
702 3300046529 Ga0495652_0566666 Ga0495652_0566666_172_471 99
703 3300046533 Ga0495640_0024578 Ga0495640_0024578_2336_2635 99
704 3300046536 Ga0495587_0115395 Ga0495587_0115395_1015_1314 99
705 3300046537 Ga0495598_0047315 Ga0495598_0047315_62_364 99
706 3300046537 Ga0495598_0412749 Ga0495598_0412749_11_310 99
707 3300046559 Ga0495667_0041562 Ga0495667_0041562_309_608 99
708 3300046642 Ga0495634_0023809 Ga0495634_0023809_41_340 99
709 3300046660 Ga0495625_0344288 Ga0495625_0344288_262_561 99
710 3300046663 Ga0495635_0033509 Ga0495635_0033509_588_887 99
711 3300046675 Ga0495657_0324594 Ga0495657_0324594_524_823 99
712 3300046681 Ga0495647_0408132 Ga0495647_0408132_200_499 99
713 3300046689 Ga0495613_0151946 Ga0495613_0151946_10_309 99
714 3300046689 Ga0495613_0316598 Ga0495613_0316598_531_830 99
715 3300046691 Ga0495670_0031502 Ga0495670_0031502_965_1264 99
716 3300046694 Ga0495649_0332965 Ga0495649_0332965_190_489 99
717 3300046694 Ga0495649_0606467 Ga0495649_0606467_161_460 99
718 3300046809 Ga0495600_0257975 Ga0495600_0257975_711_1010 99
719 3300047317 Ga0495604_0070404 Ga0495604_0070404_1554_1853 99
720 3300047318 Ga0495636_0174575 Ga0495636_0174575_659_958 99
721 3300047319 Ga0495674_0303326 Ga0495674_0303326_12_311 99
722 3300047321 Ga0495676_0504416 Ga0495676_0504416_323_622 99
723 3300047322 Ga0495680_0035982 Ga0495680_0035982_2042_2341 99
724 3300047472 Ga0495686_0231403 Ga0495686_0231403_60_359 99
725 3300048903 Ga0496100_0763862 Ga0496100_0763862_280_579 99
726 3300048904 Ga0496101_0111499 Ga0496101_0111499_1577_1876 99
727 3300048907 Ga0496104_0731446 Ga0496104_0731446_210_509 99
728 3300048908 Ga0496105_0930522 Ga0496105_0930522_333_632 99
729 3300048912 Ga0496109_0900193 Ga0496109_0900193_452_751 99
730 3300048914 Ga0496111_0747131 Ga0496111_0747131_52_351 99
731 3300048917 Ga0496114_0294487 Ga0496114_0294487_416_715 99
732 3300049127 Ga0501306_007578 Ga0501306_007578_372_671 99
733 3300049134 Ga0501345_07567 Ga0501345_07567_86_385 99
734 3300049527 Ga0501311_072167 Ga0501311_072167_191_490 99
735 3300049529 Ga0501313_022447 Ga0501313_022447_127_426 99
736 3300049531 Ga0501315_079438 Ga0501315_079438_180_479 99
737 3300049532 Ga0501316_046441 Ga0501316_046441_149_448 99
738 3300049536 Ga0501320_012948 Ga0501320_012948_446_745 99
739 3300049537 Ga0501321_018570 Ga0501321_018570_396_695 99
740 3300049552 Ga0501336_003998 Ga0501336_003998_489_788 99
741 3300049568 Ga0501031_0005772 Ga0501031_0005772_5319_5618 99
742 3300049570 Ga0501033_0114330 Ga0501033_0114330_815_1114 99
743 3300049571 Ga0501034_0038226 Ga0501034_0038226_463_762 99
744 3300049572 Ga0501036_0009955 Ga0501036_0009955_2784_3083 99
745 3300049573 Ga0501037_0032648 Ga0501037_0032648_1677_1976 99
746 3300049574 Ga0501038_0005905 Ga0501038_0005905_2937_3236 99
747 3300049575 Ga0501039_0013024 Ga0501039_0013024_2855_3154 99
748 3300049579 Ga0501043_0009337 Ga0501043_0009337_5294_5593 99
749 3300049580 Ga0501046_0052113 Ga0501046_0052113_347_646 99
750 3300049581 Ga0501047_0443886 Ga0501047_0443886_194_493 99
751 3300049581 Ga0501047_0864956 Ga0501047_0864956_78_377 99
752 3300049588 Ga0501072_0348421 Ga0501072_0348421_673_972 99
753 3300049589 Ga0501073_0069872 Ga0501073_0069872_1900_2199 99
754 3300049742 Ga0501080_0032906 Ga0501080_0032906_2536_2835 99
755 3300049771 Ga0501274_038594 Ga0501274_038594_143_442 99
756 3300049822 Ga0501035_0050477 Ga0501035_0050477_709_1008 99
757 3300049823 Ga0501044_0004248 Ga0501044_0004248_6273_6572 99
758 3300049823 Ga0501044_0037946 Ga0501044_0037946_2244_2543 99
759 3300049823 Ga0501044_0123100 Ga0501044_0123100_748_1047 99
760 3300050493 nmdc:mga0k408_399816_c1 nmdc:mga0k408_399816_c1_462_761 99
761 3300050493 nmdc:mga0k408_62578_c1 nmdc:mga0k408_62578_c1_1288_1587 99
762 3300050496 nmdc:mga07m45_379224_c1 nmdc:mga07m45_379224_c1_320_619 99
763 3300050496 nmdc:mga07m45_69219_c1 nmdc:mga07m45_69219_c1_1019_1318 99
764 3300050496 nmdc:mga07m45_735907_c1 nmdc:mga07m45_735907_c1_74_373 99
765 3300050508 nmdc:mga09592_471205_c1 nmdc:mga09592_471205_c1_757_1056 99
766 3300050508 nmdc:mga09592_656665_c1 nmdc:mga09592_656665_c1_112_411 99
767 3300050508 nmdc:mga09592_70262_c1 nmdc:mga09592_70262_c1_2525_2824 99
768 3300050508 nmdc:mga09592_926671_c1 nmdc:mga09592_926671_c1_342_641 99
769 3300050509 nmdc:mga0qj67_1010971_c1 nmdc:mga0qj67_1010971_c1_186_485 99
770 3300050509 nmdc:mga0qj67_85711_c1 nmdc:mga0qj67_85711_c1_314_613 99
771 3300050510 nmdc:mga06r32_145795_c1 nmdc:mga06r32_145795_c1_742_1041 99
772 3300050512 nmdc:mga0n895_1080853_c1 nmdc:mga0n895_1080853_c1_63_362 99
773 3300050512 nmdc:mga0n895_485544_c1 nmdc:mga0n895_485544_c1_716_1015 99
774 3300050515 nmdc:mga0a205_797619_c1 nmdc:mga0a205_797619_c1_353_652 99
775 3300053085 Ga0495619_0017003 Ga0495619_0017003_474_773 99
776 3300053108 Ga0500562_013235 Ga0500562_013235_353_652 99
777 3300053117 Ga0500593_103971 Ga0500593_103971_457_756 99
778 3300053146 Ga0500588_0236510 Ga0500588_0236510_194_493 99
779 3300053153 Ga0500616_0139029 Ga0500616_0139029_313_612 99
780 3300053156 Ga0500622_0391746 Ga0500622_0391746_20_319 99
781 3300053727 Ga0500611_000032 Ga0500611_000032_81392_81691 99
782 3300053730 Ga0500645_051002 Ga0500645_051002_467_766 99
783 3300059511 Ga0587091_224114 Ga0587091_224114_87_386 99
784 3300059624 Ga0587109_059983 Ga0587109_059983_108_407 99
785 3300059630 Ga0587128_118650 Ga0587128_118650_33_332 99
786 3300059640 Ga0587067_084412 Ga0587067_084412_373_672 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

27

117

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zj3-assembly1.cif.gz_Lk cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis 0.9334 3 92
7zq6-assembly1.cif.gz_t 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9237 3 93
6fu8-assembly1.cif.gz_C ul23 beta hairpin loop deletion of e.coli ribosome 0.9142 2 93
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.9113 6 94
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9113 3 88
ID Description Score Start End Superfamily
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9142 2 93 3.30.70.330
5x8tU01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8959 6 92 3.30.70.330
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8904 1 91 3.30.70.330
1w2bR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8767 5 92 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8725 2 93 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A3M1YTJ9-F1-model_v4 50S ribosomal protein L23 0.956 25 99 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A5C7MNT9-F1-model_v4 Large ribosomal subunit protein uL23 0.9551 1 96 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-B4U746-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9502 1 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A388KAW6-F1-model_v4 Ribosomal protein L23/L25 N-terminal domain-containing protein 0.9456 3 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A433WCS1-F1-model_v4 Large ribosomal subunit protein uL23 0.9357 1 99 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
91.75 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map