F480728

General Info

Members Datasets Scaffolds Average Seq Length
785 411 743 335

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100023491|Ga0070663_1000234911
Length 339
Sequence MKVAIIGAGAIGGYVGVKLALAGEDVTFIVRGANLTAIRQRGMKLIMADGSEHVARNVRATNDYAEAGPQDVVILAMKAHQVEAVARDVPKLFGPDTAVVTMQNGIPYWYFHKHGGPGREGTRVNSVDPTGIVGECIPAERVIGCVVYPASELIAPGVVKHIEGERFPVGELDGSASERVNRISAVFTNAGFKAPVLDNIRAEIWLKLWGNLTFNPISSLTHSTLVDICQYPLTRELAAAMMREAQAVANKLGIEFRIPLDKRIAGAEKVGKHKTSMLQDIEAGRAPEIDALVGTVVELGRLTDTPTPHIDTVYALVKLLGKNIDEQRGQVRLLELAAA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221664 Massilia sp. Root418 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2738541280 Massilia sp. GV090 Isolate Unclassified
13 2738541300 Massilia sp. GV016 Isolate Unclassified
14 2738543013 Variovorax sp. BT01 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543030 Massilia sp. GV097 Isolate Unclassified
17 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
18 2818991436 Collimonas arenae 515 Isolate Unclassified
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
22 2842677519 Variovorax sp. R-72495 Isolate Unclassified
23 2842711865 Duganella sp. R-73148 Isolate Unclassified
24 2857558681 Duganella sp. R-74565 Isolate Unclassified
25 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
26 2885198086 Variovorax sp. 679 Isolate Unclassified
27 2885211737 Variovorax sp. 553 Isolate Unclassified
28 2899924645 Variovorax sp. 369 Isolate Unclassified
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2928037797 Variovorax sp. 1126 Isolate Unclassified
32 2928044640 Variovorax sp. 1128 Isolate Unclassified
33 2928051484 Variovorax sp. 1133 Isolate Unclassified
34 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
35 2928070936 Variovorax gossypii 1167 Isolate Unclassified
36 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
37 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
38 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
39 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
40 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
41 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
42 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
45 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
53 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
54 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
62 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
63 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
64 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
65 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
66 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
67 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
68 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
71 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
72 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
73 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
74 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
75 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
76 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
77 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
114 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
115 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
116 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
117 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
118 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
119 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
157 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
162 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
227 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
228 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
229 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
230 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
231 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
232 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
233 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
252 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
253 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
262 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
263 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
264 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
265 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
266 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
267 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
268 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
269 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
270 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
271 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
272 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
273 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
274 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
280 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
281 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
284 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
285 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
288 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
289 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
292 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
300 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
301 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
304 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
305 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
306 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
312 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
321 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
322 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
326 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
337 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
338 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
344 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
345 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
346 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
347 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
348 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
349 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
370 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
383 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
388 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
389 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
390 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
391 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
392 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
393 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
394 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
395 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
396 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
397 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
403 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
404 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
405 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
406 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
407 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
408 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
409 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
410 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
411 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.14
Metatranscriptomes 0.51
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.06
Nodule 0.25
Rhizoplane 2.04
Rhizosphere 64.71
Stem 0
Stem Tuber 0
Unclassified 9.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10032351 3300001979 Bacteria 1673
2 JGI25158J39367_1006071 3300002739 Bacteria 1747
3 JGI25152J39213_1002250 3300002773 Bacteria 7463
4 JGI25152J39213_1004246 3300002773 Bacteria 4584
5 JGI25159J45721_1002244 3300002987 Bacteria 7463
6 JGI25151J46595_10001379 3300003187 Bacteria 16767
7 JGI25151J46595_10004400 3300003187 Bacteria 7463
8 JGI25151J46595_10010447 3300003187 Bacteria 4315
9 JGI25153J46596_10004540 3300003215 Bacteria 7463
10 rootL2_10012652 3300003322 Bacteria 5153
11 JGI25160J50197_1002233 3300003354 Bacteria 9095
12 JGI25161J50226_1005453 3300003374 Bacteria 2460
13 Ga0007410J51695_1034327 3300003574 Bacteria 1215
14 Ga0007429J51699_1050987 3300003579 Bacteria 1424
15 Ga0032354_1019303 3300003693 Bacteria 1513
16 Ga0055535_1000378 3300003761 Bacteria 42270
17 Ga0055542_1000036 3300003762 Bacteria 227346
18 Ga0055526_1005065 3300003771 Bacteria 7693
19 Ga0055526_1005307 3300003771 Bacteria 7463
20 Ga0055537_1000541 3300003773 Bacteria 21788
21 Ga0055537_1001916 3300003773 Bacteria 7463
22 Ga0055537_1003257 3300003773 Bacteria 5055
23 Ga0055524_1003426 3300003775 Bacteria 7699
24 Ga0055524_1003604 3300003775 Bacteria 7463
25 Ga0055536_1001912 3300003781 Bacteria 12075
26 Ga0055536_1007703 3300003781 Bacteria 4769
27 Ga0055536_1008036 3300003781 Bacteria 4611
28 Ga0055534_1000491 3300003784 Bacteria 21788
29 Ga0055534_1001989 3300003784 Bacteria 7463
30 Ga0055534_1012575 3300003784 Bacteria 1666
31 Ga0055528_1000927 3300003790 Bacteria 19592
32 Ga0055528_1003783 3300003790 Bacteria 7463
33 Ga0055528_1006976 3300003790 Bacteria 5055
34 Ga0055530_10001000 3300003791 Bacteria 22575
35 Ga0055530_10005427 3300003791 Bacteria 6067
36 Ga0055540_1002459 3300003792 Bacteria 9752
37 Ga0055540_1004132 3300003792 Bacteria 6709
38 Ga0055540_1004268 3300003792 Bacteria 6539
39 Ga0055540_1019857 3300003792 Bacteria 1797
40 Ga0055531_10001511 3300003794 Bacteria 17074
41 Ga0055531_10001971 3300003794 Bacteria 14315
42 Ga0055531_10004950 3300003794 Bacteria 7915
43 Ga0055531_10005440 3300003794 Bacteria 7455
44 Ga0055543_1000596 3300004625 Bacteria 19728
45 Ga0055543_1006181 3300004625 Bacteria 2935
46 Ga0065165_1003176 3300005262 Bacteria 12037
47 Ga0065707_10083176 3300005295 Bacteria 10109
48 Ga0070658_10060413 3300005327 Bacteria 3087
49 Ga0070676_10004778 3300005328 Bacteria 7162
50 Ga0070676_10044472 3300005328 Bacteria 2584
51 Ga0070676_10062637 3300005328 Bacteria 2214
52 Ga0070690_100011917 3300005330 Bacteria 5104
53 Ga0070670_100016983 3300005331 Bacteria 6249
54 Ga0070670_100088047 3300005331 Bacteria 2669
55 Ga0070670_100095830 3300005331 Bacteria 2552
56 Ga0070670_100319766 3300005331 Bacteria 1359
57 Ga0070677_10006815 3300005333 Bacteria 3796
58 Ga0068869_100173081 3300005334 Bacteria 1688
59 Ga0070666_10001802 3300005335 Bacteria 13044
60 Ga0070666_10023526 3300005335 Bacteria 4011
61 Ga0070666_10041292 3300005335 Bacteria 3082
62 Ga0070666_10148399 3300005335 Bacteria 1635
63 Ga0068868_100000766 3300005338 Bacteria 21697
64 Ga0068868_100060809 3300005338 Bacteria 2992
65 Ga0068868_100106082 3300005338 Bacteria 2279
66 Ga0068868_100234213 3300005338 Bacteria 1541
67 Ga0070689_100005140 3300005340 Bacteria 8899
68 Ga0070668_100003200 3300005347 Bacteria 12063
69 Ga0070668_100005640 3300005347 Bacteria 9280
70 Ga0070668_100041642 3300005347 Bacteria 3519
71 Ga0070668_100319710 3300005347 Bacteria 1306
72 Ga0070675_100000445 3300005354 Bacteria 28157
73 Ga0070675_100001023 3300005354 Bacteria 20128
74 Ga0070675_100015016 3300005354 Bacteria 6116
75 Ga0070675_100044798 3300005354 Bacteria 3618
76 Ga0070675_100261225 3300005354 Bacteria 1517
77 Ga0070671_100000187 3300005355 Bacteria 41664
78 Ga0070671_100009551 3300005355 Bacteria 7792
79 Ga0070671_100048597 3300005355 Bacteria 3528
80 Ga0070674_100146204 3300005356 Bacteria 1779
81 Ga0070674_100174012 3300005356 Bacteria 1644
82 Ga0070673_100001644 3300005364 Bacteria 13244
83 Ga0070673_100127277 3300005364 Bacteria 2133
84 Ga0070673_100137682 3300005364 Bacteria 2057
85 Ga0070673_100160896 3300005364 Bacteria 1909
86 Ga0070688_100025652 3300005365 Bacteria 3492
87 Ga0070667_100001048 3300005367 Bacteria 25219
88 Ga0070667_100002039 3300005367 Bacteria 17908
89 Ga0070667_100043191 3300005367 Bacteria 3783
90 Ga0070667_100087323 3300005367 Bacteria 2677
91 Ga0070667_100095454 3300005367 Bacteria 2564
92 Ga0070667_100100367 3300005367 Bacteria 2500
93 Ga0070708_100009421 3300005445 Bacteria 7874
94 Ga0070663_100003597 3300005455 Bacteria 8952
95 Ga0070663_100023491 3300005455 Bacteria 4134
96 Ga0070663_100063435 3300005455 Bacteria 2668
97 Ga0070678_100000859 3300005456 Bacteria 15492
98 Ga0070678_100001085 3300005456 Bacteria 14246
99 Ga0070678_100044459 3300005456 Bacteria 3172
100 Ga0070678_100057815 3300005456 Bacteria 2843
101 Ga0070662_100005652 3300005457 Bacteria 7999
102 Ga0070662_100303388 3300005457 Bacteria 1298
103 Ga0070662_100346747 3300005457 Bacteria 1216
104 Ga0070681_10014476 3300005458 Bacteria 7849
105 Ga0070681_10363987 3300005458 Bacteria 1356
106 Ga0068867_100001358 3300005459 Bacteria 16910
107 Ga0068867_100138994 3300005459 Bacteria 1897
108 Ga0070685_10075129 3300005466 Bacteria 2012
109 Ga0070706_100142410 3300005467 Bacteria 2238
110 Ga0070707_100002457 3300005468 Bacteria 17652
111 Ga0070698_100127696 3300005471 Bacteria 2499
112 Ga0070699_100017017 3300005518 Bacteria 6243
113 Ga0070679_100077751 3300005530 Bacteria 3308
114 Ga0068853_100018520 3300005539 Bacteria 5765
115 Ga0068853_100037871 3300005539 Bacteria 4106
116 Ga0068853_100073389 3300005539 Bacteria 2983
117 Ga0070672_100003076 3300005543 Bacteria 10761
118 Ga0070672_100011595 3300005543 Bacteria 6150
119 Ga0070672_100021295 3300005543 Bacteria 4742
120 Ga0070672_100067320 3300005543 Bacteria 2838
121 Ga0070665_100007846 3300005548 Bacteria 10827
122 Ga0070665_100050614 3300005548 Bacteria 4168
123 Ga0070665_100070637 3300005548 Bacteria 3498
124 Ga0070665_100252815 3300005548 Bacteria 1763
125 Ga0070664_100007153 3300005564 Bacteria 8997
126 Ga0068857_100032041 3300005577 Bacteria 4646
127 Ga0068857_100195744 3300005577 Bacteria 1842
128 Ga0068854_100187108 3300005578 Bacteria 1621
129 Ga0068852_100124830 3300005616 Bacteria 2362
130 Ga0068852_100126387 3300005616 Bacteria 2349
131 Ga0068859_100001853 3300005617 Bacteria 21493
132 Ga0068864_100000330 3300005618 Bacteria 41727
133 Ga0068864_100029596 3300005618 Bacteria 4639
134 Ga0068866_10132879 3300005718 Bacteria 1418
135 Ga0068861_100002134 3300005719 Bacteria 12795
136 Ga0068851_10019323 3300005834 Bacteria 3292
137 Ga0068851_10022194 3300005834 Bacteria 3088
138 Ga0068851_10039796 3300005834 Bacteria 2361
139 Ga0068863_100000715 3300005841 Bacteria 33387
140 Ga0068863_100013924 3300005841 Bacteria 7754
141 Ga0068863_100111901 3300005841 Bacteria 2600
142 Ga0068858_100000900 3300005842 Bacteria 30822
143 Ga0068860_100018974 3300005843 Bacteria 6680
144 Ga0068860_100019618 3300005843 Bacteria 6557
145 Ga0068860_100151032 3300005843 Bacteria 2237
146 Ga0068860_100175711 3300005843 Bacteria 2070
147 Ga0068862_100044774 3300005844 Bacteria 3775
148 Ga0068862_100201760 3300005844 Bacteria 1794
149 Ga0070717_10258504 3300006028 Bacteria 1540
150 Ga0075365_10006589 3300006038 Bacteria 6407
151 Ga0075368_10037677 3300006042 Bacteria 1892
152 Ga0075363_100012444 3300006048 Bacteria 4102
153 Ga0075363_100017985 3300006048 Bacteria 3514
154 Ga0075364_10032617 3300006051 Bacteria 3349
155 Ga0075364_10216939 3300006051 Bacteria 1298
156 Ga0075362_10007235 3300006177 Bacteria 4189
157 Ga0075362_10045271 3300006177 Bacteria 1954
158 Ga0075367_10003595 3300006178 Bacteria 7424
159 Ga0075369_10042042 3300006186 Bacteria 1958
160 Ga0075369_10055625 3300006186 Bacteria 1719
161 Ga0075366_10001162 3300006195 Bacteria 13025
162 Ga0075366_10025893 3300006195 Bacteria 3431
163 Ga0075366_10037194 3300006195 Bacteria 2872
164 Ga0075366_10042135 3300006195 Bacteria 2702
165 Ga0075366_10107728 3300006195 Bacteria 1675
166 Ga0075366_10127915 3300006195 Bacteria 1532
167 Ga0075366_10147607 3300006195 Bacteria 1423
168 Ga0097621_100157134 3300006237 Bacteria 1952
169 Ga0075370_10000374 3300006353 Bacteria 16453
170 Ga0075370_10001858 3300006353 Bacteria 9458
171 Ga0075370_10001917 3300006353 Bacteria 9366
172 Ga0075370_10011949 3300006353 Bacteria 4575
173 Ga0075370_10016711 3300006353 Bacteria 3951
174 Ga0075370_10039180 3300006353 Bacteria 2669
175 Ga0075370_10124972 3300006353 Bacteria 1499
176 Ga0068871_100008254 3300006358 Bacteria 7487
177 Ga0068871_100128775 3300006358 Bacteria 2144
178 Ga0075429_100002916 3300006880 Bacteria 14508
179 Ga0068865_100004245 3300006881 Bacteria 8643
180 Ga0068865_100159390 3300006881 Bacteria 1720
181 Ga0097620_100001853 3300006931 Bacteria 21493
182 Ga0099826_10001740 3300006948 Bacteria 13438
183 Ga0105240_10009145 3300009093 Bacteria 14061
184 Ga0105240_10012540 3300009093 Bacteria 11693
185 Ga0105240_10039983 3300009093 Bacteria 6004
186 Ga0111539_10467961 3300009094 Bacteria 1468
187 Ga0105245_10194377 3300009098 Bacteria 1945
188 Ga0114129_10071266 3300009147 Bacteria 4846
189 Ga0105243_10061249 3300009148 Bacteria 3009
190 Ga0105243_10072545 3300009148 Bacteria 2787
191 Ga0105243_10122564 3300009148 Bacteria 2194
192 Ga0105243_10149034 3300009148 Bacteria 2005
193 Ga0105241_10035684 3300009174 Bacteria 3740
194 Ga0105242_10219050 3300009176 Bacteria 1700
195 Ga0105242_10226583 3300009176 Bacteria 1673
196 Ga0105242_10228964 3300009176 Bacteria 1665
197 Ga0105248_10004935 3300009177 Bacteria 14737
198 Ga0105248_10797089 3300009177 Bacteria 1066
199 Ga0105237_10000407 3300009545 Bacteria 61234
200 Ga0105237_10009701 3300009545 Bacteria 10299
201 Ga0105237_10155780 3300009545 Bacteria 2281
202 Ga0105238_10005854 3300009551 Bacteria 12178
203 Ga0105249_10075911 3300009553 Bacteria 3113
204 Ga0105249_10581861 3300009553 Bacteria 1173
205 Ga0105239_10000335 3300010375 Bacteria 68810
206 Ga0105239_10043224 3300010375 Bacteria 4938
207 Ga0105239_10446611 3300010375 Bacteria 1467
208 Ga0105246_10071797 3300011119 Bacteria 2438
209 Ga0157373_10026668 3300013100 Bacteria 4171
210 Ga0157370_10001435 3300013104 Bacteria 29541
211 Ga0157370_10009310 3300013104 Bacteria 10518
212 Ga0157370_10293098 3300013104 Bacteria 1503
213 Ga0157374_10006819 3300013296 Bacteria 9715
214 Ga0157374_10167418 3300013296 Bacteria 2143
215 Ga0157378_10012819 3300013297 Bacteria 7337
216 Ga0163162_10004795 3300013306 Bacteria 13049
217 Ga0163162_10256948 3300013306 Bacteria 1879
218 Ga0157372_10038299 3300013307 Bacteria 5291
219 Ga0157375_10005097 3300013308 Bacteria 11399
220 Ga0157375_10005292 3300013308 Bacteria 11206
221 Ga0157375_10094435 3300013308 Bacteria 3060
222 Ga0157375_10126822 3300013308 Bacteria 2668
223 Ga0157375_10221040 3300013308 Bacteria 2052
224 Ga0163163_10000980 3300014325 Bacteria 24230
225 Ga0163163_10104763 3300014325 Bacteria 2854
226 Ga0163163_10187418 3300014325 Bacteria 2116
227 Ga0157380_10065616 3300014326 Bacteria 2918
228 Ga0157380_10109763 3300014326 Bacteria 2315
229 Ga0157380_10187607 3300014326 Bacteria 1822
230 Ga0182008_10003813 3300014497 Bacteria 8960
231 Ga0182008_10035285 3300014497 Bacteria 2506
232 Ga0157377_10209602 3300014745 Bacteria 1242
233 Ga0157379_10006787 3300014968 Bacteria 9896
234 Ga0157376_10038215 3300014969 Bacteria 3904
235 Ga0157376_10069577 3300014969 Bacteria 2984
236 Ga0157376_10213687 3300014969 Bacteria 1782
237 Ga0157376_10612282 3300014969 Bacteria 1085
238 Ga0182006_1002649 3300015261 Bacteria 9641
239 Ga0182007_10003708 3300015262 Bacteria 7142
240 Ga0182007_10006550 3300015262 Bacteria 4991
241 Ga0182005_1000279 3300015265 Bacteria 32226
242 Ga0163161_10003484 3300017792 Bacteria 11032
243 Ga0163161_10015558 3300017792 Bacteria 5305
244 Ga0163161_10066436 3300017792 Bacteria 2633
245 Ga0163161_10091611 3300017792 Bacteria 2250
246 Ga0213872_10008485 3300021361 Bacteria 4972
247 Ga0213875_10002672 3300021388 Bacteria 10520
248 Ga0209436_102895 3300025208 Bacteria 4839
249 Ga0209672_101649 3300025228 Bacteria 7301
250 Ga0209147_100472 3300025229 Bacteria 24613
251 Ga0209258_100091 3300025242 Bacteria 227454
252 Ga0207425_1000190 3300025245 Bacteria 49963
253 Ga0207425_1002381 3300025245 Bacteria 6667
254 Ga0209148_1000033 3300025254 Bacteria 555508
255 Ga0209129_1000091 3300025258 Bacteria 175716
256 Ga0209129_1002201 3300025258 Bacteria 9795
257 Ga0209129_1007264 3300025258 Bacteria 3340
258 Ga0209565_1000020 3300025263 Bacteria 432627
259 Ga0209565_1000335 3300025263 Bacteria 41834
260 Ga0209565_1001505 3300025263 Bacteria 10158
261 Ga0209673_1000154 3300025273 Bacteria 146394
262 Ga0209673_1000350 3300025273 Bacteria 84527
263 Ga0209673_1002703 3300025273 Bacteria 11764
264 Ga0209130_1000140 3300025284 Bacteria 115434
265 Ga0209130_1000782 3300025284 Bacteria 27407
266 Ga0209675_1000014 3300025291 Bacteria 421902
267 Ga0209675_1000659 3300025291 Bacteria 24288
268 Ga0209675_1010718 3300025291 Bacteria 3104
269 Ga0209676_1000048 3300025292 Bacteria 403716
270 Ga0209676_1000433 3300025292 Bacteria 72480
271 Ga0209025_1000207 3300025294 Bacteria 140774
272 Ga0209025_1000286 3300025294 Bacteria 114096
273 Ga0209025_1000356 3300025294 Bacteria 98547
274 Ga0209025_1012640 3300025294 Bacteria 5391
275 Ga0209564_1000103 3300025295 Bacteria 221166
276 Ga0209564_1000597 3300025295 Bacteria 56580
277 Ga0209758_1000092 3300025297 Bacteria 241910
278 Ga0209050_1000012 3300025298 Bacteria 813717
279 Ga0209050_1000511 3300025298 Bacteria 65746
280 Ga0209256_1000094 3300025299 Bacteria 208177
281 Ga0209256_1000650 3300025299 Bacteria 47330
282 Ga0207426_1000084 3300025302 Bacteria 298123
283 Ga0207426_1000161 3300025302 Bacteria 172765
284 Ga0209051_1000025 3300025303 Bacteria 415397
285 Ga0209051_1000273 3300025303 Bacteria 84847
286 Ga0209051_1000326 3300025303 Bacteria 71572
287 Ga0209257_1000039 3300025304 Bacteria 591694
288 Ga0209257_1000249 3300025304 Bacteria 124522
289 Ga0209257_1002775 3300025304 Bacteria 16544
290 Ga0209257_1005208 3300025304 Bacteria 9327
291 Ga0207656_10014325 3300025321 Bacteria 3052
292 Ga0207655_1007062 3300025728 Bacteria 7347
293 Ga0207682_10002412 3300025893 Bacteria 8416
294 Ga0207680_10000940 3300025903 Bacteria 13755
295 Ga0207680_10017960 3300025903 Bacteria 3747
296 Ga0207680_10033768 3300025903 Bacteria 2922
297 Ga0207645_10000912 3300025907 Bacteria 24531
298 Ga0207645_10034688 3300025907 Bacteria 3241
299 Ga0207707_10018330 3300025912 Bacteria 6101
300 Ga0207695_10007295 3300025913 Bacteria 14117
301 Ga0207695_10111304 3300025913 Bacteria 2717
302 Ga0207671_10008666 3300025914 Bacteria 8587
303 Ga0207671_10183100 3300025914 Bacteria 1631
304 Ga0207671_10218062 3300025914 Bacteria 1494
305 Ga0207652_10049635 3300025921 Bacteria 3593
306 Ga0207646_10000722 3300025922 Bacteria 42791
307 Ga0207681_10054037 3300025923 Bacteria 2729
308 Ga0207681_10118906 3300025923 Bacteria 1935
309 Ga0207694_10063832 3300025924 Bacteria 2869
310 Ga0207650_10033963 3300025925 Bacteria 3698
311 Ga0207650_10200291 3300025925 Bacteria 1599
312 Ga0207659_10000484 3300025926 Bacteria 23967
313 Ga0207659_10024192 3300025926 Bacteria 4066
314 Ga0207659_10098242 3300025926 Bacteria 2201
315 Ga0207687_10090908 3300025927 Bacteria 2225
316 Ga0207644_10000525 3300025931 Bacteria 24823
317 Ga0207644_10029391 3300025931 Bacteria 3813
318 Ga0207706_10057340 3300025933 Bacteria 3431
319 Ga0207706_10322990 3300025933 Bacteria 1343
320 Ga0207706_10333136 3300025933 Bacteria 1320
321 Ga0207709_10001312 3300025935 Bacteria 17674
322 Ga0207709_10013032 3300025935 Bacteria 4584
323 Ga0207709_10072135 3300025935 Bacteria 2195
324 Ga0207709_10144105 3300025935 Bacteria 1641
325 Ga0207670_10015558 3300025936 Bacteria 4549
326 Ga0207669_10109283 3300025937 Bacteria 1849
327 Ga0207704_10010234 3300025938 Bacteria 4564
328 Ga0207704_10063942 3300025938 Bacteria 2296
329 Ga0207704_10099163 3300025938 Bacteria 1937
330 Ga0207704_10198283 3300025938 Bacteria 1467
331 Ga0207691_10000342 3300025940 Bacteria 46924
332 Ga0207691_10009883 3300025940 Bacteria 9160
333 Ga0207691_10046682 3300025940 Bacteria 3978
334 Ga0207691_10051006 3300025940 Bacteria 3785
335 Ga0207691_10086083 3300025940 Bacteria 2820
336 Ga0207711_10001399 3300025941 Bacteria 22639
337 Ga0207711_10077529 3300025941 Bacteria 2897
338 Ga0207689_10103093 3300025942 Bacteria 2344
339 Ga0207689_10165773 3300025942 Bacteria 1820
340 Ga0207679_10006620 3300025945 Bacteria 7332
341 Ga0207651_10082645 3300025960 Bacteria 2319
342 Ga0207651_10181019 3300025960 Bacteria 1672
343 Ga0207651_10341546 3300025960 Bacteria 1258
344 Ga0207712_10295692 3300025961 Bacteria 1327
345 Ga0207668_10002518 3300025972 Bacteria 10693
346 Ga0207668_10266532 3300025972 Bacteria 1398
347 Ga0207658_10000553 3300025986 Bacteria 33951
348 Ga0207658_10015677 3300025986 Bacteria 5201
349 Ga0207658_10055114 3300025986 Bacteria 2944
350 Ga0207658_10134358 3300025986 Bacteria 1992
351 Ga0207677_10000623 3300026023 Bacteria 21544
352 Ga0207677_10038687 3300026023 Bacteria 3130
353 Ga0207703_10000773 3300026035 Bacteria 31458
354 Ga0207639_10025987 3300026041 Bacteria 4251
355 Ga0207639_10072426 3300026041 Bacteria 2698
356 Ga0207678_10004759 3300026067 Bacteria 12190
357 Ga0207678_10020565 3300026067 Bacteria 5787
358 Ga0207678_10105682 3300026067 Bacteria 2402
359 Ga0207702_10462684 3300026078 Bacteria 1232
360 Ga0207641_10001102 3300026088 Bacteria 27131
361 Ga0207641_10059118 3300026088 Bacteria 3263
362 Ga0207641_10280663 3300026088 Bacteria 1567
363 Ga0207648_10080841 3300026089 Bacteria 2835
364 Ga0207648_10128690 3300026089 Bacteria 2228
365 Ga0207648_10129440 3300026089 Bacteria 2221
366 Ga0207648_10203958 3300026089 Bacteria 1754
367 Ga0207648_10221002 3300026089 Bacteria 1684
368 Ga0207676_10000742 3300026095 Bacteria 25556
369 Ga0207676_10226541 3300026095 Bacteria 1668
370 Ga0207676_10245620 3300026095 Bacteria 1608
371 Ga0207674_10016615 3300026116 Bacteria 8047
372 Ga0207674_10053553 3300026116 Bacteria 4112
373 Ga0207674_10090185 3300026116 Bacteria 3057
374 Ga0207675_100001409 3300026118 Bacteria 24039
375 Ga0207675_100067256 3300026118 Bacteria 3349
376 Ga0207675_100273380 3300026118 Bacteria 1640
377 Ga0207683_10000020 3300026121 Bacteria 118805
378 Ga0207683_10003309 3300026121 Bacteria 14048
379 Ga0207683_10026998 3300026121 Bacteria 4962
380 Ga0207683_10160635 3300026121 Bacteria 2031
381 Ga0207683_10173876 3300026121 Bacteria 1951
382 Ga0207683_10288444 3300026121 Bacteria 1500
383 Ga0207698_10011424 3300026142 Bacteria 5758
384 Ga0207698_10032804 3300026142 Bacteria 3767
385 Ga0207698_10098874 3300026142 Bacteria 2412
386 Ga0209813_10028074 3300027866 Bacteria 1638
387 Ga0268266_10034410 3300028379 Bacteria 4309
388 Ga0268266_10160688 3300028379 Bacteria 2032
389 Ga0268265_10020503 3300028380 Bacteria 4613
390 Ga0268265_10088567 3300028380 Bacteria 2466
391 Ga0268265_10193399 3300028380 Bacteria 1759
392 Ga0268264_10008521 3300028381 Bacteria 8522
393 Ga0268264_10018269 3300028381 Bacteria 5735
394 Ga0268264_10021238 3300028381 Bacteria 5304
395 Ga0268264_10179100 3300028381 Bacteria 1924
396 Ga0268264_10277364 3300028381 Bacteria 1568
397 Ga0307517_10009612 3300028786 Bacteria 13684
398 Ga0307517_10162746 3300028786 Bacteria 1492
399 Ga0307515_10000034 3300028794 Bacteria 344640
400 Ga0307515_10000179 3300028794 Bacteria 156716
401 Ga0307515_10000367 3300028794 Bacteria 111166
402 Ga0307515_10000586 3300028794 Bacteria 85517
403 Ga0307515_10005841 3300028794 Bacteria 24838
404 Ga0307515_10006221 3300028794 Bacteria 23979
405 Ga0307515_10071598 3300028794 Bacteria 4696
406 Ga0307515_10089497 3300028794 Bacteria 3875
407 Ga0307515_10146266 3300028794 Bacteria 2501
408 Ga0307511_10001889 3300030521 Bacteria 21986
409 Ga0307512_10145404 3300030522 Bacteria 1436
410 Ga0316183_1046813 3300030742 Bacteria 3201
411 Ga0316182_1100821 3300030745 Bacteria 2718
412 Ga0265328_10004417 3300031239 Bacteria 6107
413 Ga0265340_10053131 3300031247 Bacteria 1957
414 Ga0265316_10116782 3300031344 Bacteria 2017
415 Ga0307513_10000012 3300031456 Bacteria 328865
416 Ga0307513_10000514 3300031456 Bacteria 55608
417 Ga0307513_10008606 3300031456 Bacteria 13021
418 Ga0307513_10012803 3300031456 Bacteria 10329
419 Ga0307513_10014348 3300031456 Bacteria 9676
420 Ga0307513_10116491 3300031456 Bacteria 2651
421 Ga0307513_10174139 3300031456 Bacteria 2025
422 Ga0307513_10211504 3300031456 Bacteria 1770
423 Ga0307513_10318978 3300031456 Bacteria 1313
424 Ga0307509_10001193 3300031507 Bacteria 44217
425 Ga0307509_10011999 3300031507 Bacteria 10407
426 Ga0307408_100101016 3300031548 Bacteria 2198
427 Ga0307408_100300404 3300031548 Bacteria 1344
428 Ga0307508_10000041 3300031616 Bacteria 147868
429 Ga0307508_10010688 3300031616 Bacteria 8390
430 Ga0307508_10021258 3300031616 Bacteria 5899
431 Ga0307514_10004105 3300031649 Bacteria 13508
432 Ga0307514_10006116 3300031649 Bacteria 10568
433 Ga0307514_10036313 3300031649 Bacteria 3917
434 Ga0307514_10053099 3300031649 Bacteria 3129
435 Ga0307516_10001570 3300031730 Bacteria 31465
436 Ga0307516_10006191 3300031730 Bacteria 14085
437 Ga0307405_10013201 3300031731 Bacteria 4401
438 Ga0307410_10135230 3300031852 Bacteria 1816
439 Ga0307406_10033190 3300031901 Bacteria 3157
440 Ga0307407_10267635 3300031903 Bacteria 1178
441 Ga0307412_10055103 3300031911 Bacteria 2642
442 Ga0307412_10079068 3300031911 Bacteria 2267
443 Ga0307416_100425603 3300032002 Bacteria 1373
444 Ga0307414_10127449 3300032004 Bacteria 1969
445 Ga0307414_10325684 3300032004 Bacteria 1309
446 Ga0307411_10012599 3300032005 Bacteria 4623
447 Ga0307507_10085860 3300033179 Bacteria 2734
448 Ga0307510_10015773 3300033180 Bacteria 8933
449 Ga0307510_10026010 3300033180 Bacteria 6737
450 Ga0307510_10031266 3300033180 Bacteria 6018
451 Ga0307510_10086046 3300033180 Bacteria 3017
452 Ga0373926_0095122 3300035083 Bacteria 1110
453 Ga0373944_0015207 3300035089 Bacteria 2157
454 Ga0373932_0021658 3300035112 Bacteria 1699
455 Ga0373945_0024980 3300035116 Bacteria 2073
456 Ga0373937_0243658 3300036401 Bacteria 1694
457 Ga0395905_0000279 3300037471 Bacteria 75846
458 Ga0395905_0009110 3300037471 Bacteria 9724
459 Ga0395905_0025964 3300037471 Bacteria 5522
460 Ga0395905_0090613 3300037471 Bacteria 2867
461 Ga0395905_0094788 3300037471 Bacteria 2800
462 Ga0436364_0783083 3300037853 Bacteria 1061
463 Ga0436364_1478496 3300037853 Bacteria 16430
464 Ga0436360_0355167 3300039438 Bacteria 1216
465 Ga0436360_0677787 3300039438 Bacteria 1422
466 Ga0436361_0360094 3300039447 Bacteria 10024
467 Ga0436363_0546706 3300039450 Bacteria 9166
468 Ga0436362_1020986 3300039453 Bacteria 1441
469 Ga0439436_0001703 3300041404 Bacteria 6430
470 Ga0439436_0002775 3300041404 Bacteria 5296
471 Ga0439439_0000253 3300041406 Bacteria 8385
472 Ga0439447_011358 3300041407 Bacteria 2603
473 Ga0439466_0005209 3300041411 Bacteria 4976
474 Ga0439433_0010564 3300041999 Bacteria 2016
475 Ga0439433_0017026 3300041999 Bacteria 1612
476 Ga0439432_005346 3300042006 Bacteria 4633
477 Ga0439449_0000172 3300042007 Bacteria 22425
478 Ga0439449_0000803 3300042007 Bacteria 12106
479 Ga0439449_0006219 3300042007 Bacteria 4562
480 Ga0439449_0043583 3300042007 Bacteria 1665
481 Ga0439452_026084 3300042010 Bacteria 1478
482 Ga0439462_0001382 3300042015 Bacteria 5369
483 Ga0450921_000615 3300042123 Bacteria 1780
484 Ga0450903_017470 3300042138 Bacteria 1121
485 Ga0450910_010046 3300042147 Bacteria 1344
486 Ga0439446_0003954 3300042156 Bacteria 3727
487 Ga0450908_000944 3300042184 Bacteria 5601
488 Ga0450908_002422 3300042184 Bacteria 3652
489 Ga0439434_0003820 3300042435 Bacteria 4401
490 Ga0439434_0005330 3300042435 Bacteria 3764
491 Ga0439434_0016772 3300042435 Bacteria 2189
492 Ga0439464_0013717 3300042439 Bacteria 2173
493 Ga0450918_005030 3300042531 Bacteria 2380
494 Ga0450893_0003041 3300042532 Bacteria 2642
495 Ga0453683_0002485 3300044673 Bacteria 14250
496 Ga0466965_0013943 3300044683 Bacteria 3800
497 Ga0466964_0019594 3300044706 Bacteria 2601
498 Ga0453684_0045386 3300044712 Bacteria 5863
499 Ga0453684_0466244 3300044712 Bacteria 1403
500 Ga0466957_0017998 3300044842 Bacteria 4144
501 Ga0466960_0039465 3300044901 Bacteria 2227
502 Ga0451576_0005927 3300045051 Bacteria 15139
503 Ga0451576_0030112 3300045051 Bacteria 5804
504 Ga0495617_001092 3300046452 Bacteria 12333
505 Ga0495627_001688 3300046453 Bacteria 12141
506 Ga0495592_0000727 3300046454 Bacteria 23029
507 Ga0495592_0046542 3300046454 Bacteria 3233
508 Ga0495590_0000010 3300046457 Bacteria 317890
509 Ga0495590_0046063 3300046457 Bacteria 1521
510 Ga0495638_0000157 3300046460 Bacteria 107187
511 Ga0495638_0025109 3300046460 Bacteria 3877
512 Ga0495638_0078466 3300046460 Bacteria 2009
513 Ga0495651_0082369 3300046462 Bacteria 2427
514 Ga0495653_0010798 3300046463 Bacteria 7474
515 Ga0495650_0000011 3300046471 Bacteria 615329
516 Ga0495584_0009010 3300046491 Bacteria 5155
517 Ga0495584_0064163 3300046491 Bacteria 1846
518 Ga0495584_0085626 3300046491 Bacteria 1588
519 Ga0495585_0001878 3300046492 Bacteria 15827
520 Ga0495596_0003413 3300046500 Bacteria 8055
521 Ga0495607_0006282 3300046501 Bacteria 8377
522 Ga0495607_0010905 3300046501 Bacteria 6082
523 Ga0495583_0000006 3300046506 Bacteria 436893
524 Ga0495583_0000549 3300046506 Bacteria 52554
525 Ga0495583_0006755 3300046506 Bacteria 7416
526 Ga0495583_0042590 3300046506 Bacteria 2119
527 Ga0495606_0000059 3300046507 Bacteria 186886
528 Ga0495606_0000987 3300046507 Bacteria 41467
529 Ga0495606_0002140 3300046507 Bacteria 23813
530 Ga0495606_0011359 3300046507 Bacteria 7272
531 Ga0495606_0014404 3300046507 Bacteria 6175
532 Ga0495606_0017482 3300046507 Bacteria 5419
533 Ga0495608_0003574 3300046511 Bacteria 11143
534 Ga0495608_0005234 3300046511 Bacteria 9269
535 Ga0495610_0007809 3300046512 Bacteria 7048
536 Ga0495610_0040205 3300046512 Bacteria 2359
537 Ga0495610_0060887 3300046512 Bacteria 1796
538 Ga0495610_0091284 3300046512 Bacteria 1380
539 Ga0495616_0001816 3300046513 Bacteria 14461
540 Ga0495618_0028426 3300046514 Bacteria 3484
541 Ga0495620_0047852 3300046515 Bacteria 1838
542 Ga0495628_0001674 3300046516 Bacteria 20237
543 Ga0495628_0004299 3300046516 Bacteria 12663
544 Ga0495631_0000752 3300046518 Bacteria 20761
545 Ga0495631_0000901 3300046518 Bacteria 18559
546 Ga0495632_0037620 3300046519 Bacteria 2454
547 Ga0495632_0083193 3300046519 Bacteria 1524
548 Ga0495637_0001059 3300046520 Bacteria 17182
549 Ga0495637_0010571 3300046520 Bacteria 4458
550 Ga0495643_0000099 3300046522 Bacteria 145425
551 Ga0495643_0000299 3300046522 Bacteria 69119
552 Ga0495643_0007767 3300046522 Bacteria 6865
553 Ga0495643_0057541 3300046522 Bacteria 2071
554 Ga0495648_0002672 3300046524 Bacteria 16122
555 Ga0495648_0006023 3300046524 Bacteria 9959
556 Ga0495648_0019308 3300046524 Bacteria 4797
557 Ga0495648_0071236 3300046524 Bacteria 2016
558 Ga0495648_0072704 3300046524 Bacteria 1989
559 Ga0495642_0003934 3300046528 Bacteria 5811
560 Ga0495642_0006222 3300046528 Bacteria 4581
561 Ga0495642_0030467 3300046528 Bacteria 2158
562 Ga0495652_0015010 3300046529 Bacteria 6938
563 Ga0495652_0015350 3300046529 Bacteria 6856
564 Ga0495652_0066383 3300046529 Bacteria 3028
565 Ga0495654_0014744 3300046530 Bacteria 4155
566 Ga0495654_0025658 3300046530 Bacteria 3035
567 Ga0495609_0000054 3300046538 Bacteria 147369
568 Ga0495609_0021033 3300046538 Bacteria 3010
569 Ga0495621_0003864 3300046539 Bacteria 4162
570 Ga0495621_0018294 3300046539 Bacteria 2274
571 Ga0495621_0032765 3300046539 Bacteria 1788
572 Ga0495621_0034720 3300046539 Bacteria 1743
573 Ga0495597_0000159 3300046542 Bacteria 59699
574 Ga0495597_0000690 3300046542 Bacteria 27246
575 Ga0495597_0042820 3300046542 Bacteria 2017
576 Ga0495645_0011320 3300046543 Bacteria 6273
577 Ga0495622_0000048 3300046557 Bacteria 108955
578 Ga0495633_0000063 3300046558 Bacteria 141657
579 Ga0495633_0001033 3300046558 Bacteria 22774
580 Ga0495633_0002572 3300046558 Bacteria 12716
581 Ga0495633_0009801 3300046558 Bacteria 5265
582 Ga0495656_0000383 3300046615 Bacteria 14729
583 Ga0495668_0000458 3300046616 Bacteria 52227
584 Ga0495668_0000609 3300046616 Bacteria 43205
585 Ga0495668_0014948 3300046616 Bacteria 4541
586 Ga0495668_0020313 3300046616 Bacteria 3821
587 Ga0495668_0069952 3300046616 Bacteria 1929
588 Ga0495668_0093881 3300046616 Bacteria 1643
589 Ga0495611_0004982 3300046648 Bacteria 5687
590 Ga0495625_0000241 3300046660 Bacteria 85835
591 Ga0495625_0001565 3300046660 Bacteria 27230
592 Ga0495625_0001836 3300046660 Bacteria 24291
593 Ga0495625_0002578 3300046660 Bacteria 19468
594 Ga0495625_0007495 3300046660 Bacteria 9484
595 Ga0495659_0000068 3300046664 Bacteria 46175
596 Ga0495661_0000603 3300046665 Bacteria 36732
597 Ga0495657_0065344 3300046675 Bacteria 2393
598 Ga0495599_0003655 3300046678 Bacteria 9020
599 Ga0495623_0050337 3300046679 Bacteria 2638
600 Ga0495646_0002050 3300046680 Bacteria 12216
601 Ga0495646_0003855 3300046680 Bacteria 9373
602 Ga0495658_0109821 3300046683 Bacteria 1657
603 Ga0495669_0010367 3300046684 Bacteria 3937
604 Ga0495624_0018658 3300046690 Bacteria 4638
605 Ga0495670_0000525 3300046691 Bacteria 18162
606 Ga0495671_0000628 3300046692 Bacteria 25878
607 Ga0495671_0001980 3300046692 Bacteria 13161
608 Ga0495671_0093306 3300046692 Bacteria 1473
609 Ga0495649_0001093 3300046694 Bacteria 21156
610 Ga0495649_0005158 3300046694 Bacteria 8376
611 Ga0495649_0012427 3300046694 Bacteria 4950
612 Ga0495649_0099234 3300046694 Bacteria 1549
613 Ga0495649_0145276 3300046694 Bacteria 1247
614 Ga0495600_0001607 3300046809 Bacteria 12592
615 Ga0495660_0005348 3300046810 Bacteria 7687
616 Ga0495660_0056800 3300046810 Bacteria 2114
617 Ga0495660_0117245 3300046810 Bacteria 1351
618 Ga0495604_0008167 3300047317 Bacteria 8284
619 Ga0495636_0007366 3300047318 Bacteria 4329
620 Ga0495672_0000169 3300047320 Bacteria 94803
621 Ga0495672_0000277 3300047320 Bacteria 71082
622 Ga0495676_0049869 3300047321 Bacteria 3362
623 Ga0495676_0094516 3300047321 Bacteria 2226
624 Ga0495687_000272 3300047443 Bacteria 68390
625 Ga0495687_010508 3300047443 Bacteria 5073
626 Ga0495687_021798 3300047443 Bacteria 3088
627 Ga0495677_0005597 3300047445 Bacteria 4760
628 Ga0495677_0007304 3300047445 Bacteria 4132
629 Ga0495679_023319 3300047446 Bacteria 2100
630 Ga0495685_022587 3300047447 Bacteria 2165
631 Ga0495673_0000059 3300047469 Bacteria 233234
632 Ga0495681_0001920 3300047470 Bacteria 15243
633 Ga0495681_0009981 3300047470 Bacteria 5784
634 Ga0495686_0000456 3300047472 Bacteria 61394
635 Ga0495686_0004521 3300047472 Bacteria 11397
636 Ga0495686_0031119 3300047472 Bacteria 3462
637 Ga0495593_0057061 3300047673 Bacteria 2051
638 Ga0495602_0023857 3300048088 Bacteria 5948
639 Ga0495626_0032593 3300048091 Bacteria 2501
640 Ga0496101_0261704 3300048904 Bacteria 1349
641 Ga0496102_0005899 3300048905 Bacteria 10429
642 Ga0496102_0031313 3300048905 Bacteria 4771
643 Ga0496102_0094810 3300048905 Bacteria 2765
644 Ga0496102_0116504 3300048905 Bacteria 2493
645 Ga0496103_0252587 3300048906 Bacteria 1135
646 Ga0496104_0063560 3300048907 Bacteria 3501
647 Ga0496105_0314927 3300048908 Bacteria 1255
648 Ga0496106_0073572 3300048909 Bacteria 2614
649 Ga0496107_0050803 3300048910 Bacteria 2990
650 Ga0496109_0043436 3300048912 Bacteria 4074
651 Ga0496110_0409257 3300048913 Bacteria 1236
652 Ga0496114_0090600 3300048917 Bacteria 2596
653 Ga0496117_0007943 3300048920 Bacteria 10194
654 Ga0496118_0035594 3300048921 Bacteria 4039
655 Ga0496121_0027380 3300048924 Bacteria 5335
656 Ga0496123_0066840 3300048926 Bacteria 2275
657 Ga0496124_0034024 3300048927 Bacteria 4478
658 Ga0496124_0043133 3300048927 Bacteria 3879
659 Ga0496124_0260797 3300048927 Bacteria 1275
660 Ga0496125_0002222 3300048928 Bacteria 25860
661 Ga0496125_0076280 3300048928 Bacteria 2589
662 Ga0496125_0084519 3300048928 Bacteria 2409
663 Ga0496125_0147665 3300048928 Bacteria 1622
664 Ga0495678_003519 3300049459 Bacteria 9629
665 Ga0495678_003851 3300049459 Bacteria 9016
666 Ga0495678_020480 3300049459 Bacteria 2927
667 Ga0495678_028332 3300049459 Bacteria 2364
668 Ga0501321_001463 3300049537 Bacteria 1885
669 Ga0501072_0278487 3300049588 Bacteria 1331
670 Ga0501262_001309 3300049759 Bacteria 2787
671 nmdc:mga03683_7666_c1 3300050489 Bacteria 3759
672 nmdc:mga03683_8154_c1 3300050489 Bacteria 3670
673 nmdc:mga03n38_117884_c1 3300050490 Bacteria 1301
674 nmdc:mga03n38_23386_c1 3300050490 Bacteria 2513
675 nmdc:mga03n38_9776_c1 3300050490 Bacteria 3501
676 nmdc:mga0yw44_11476_c1 3300050492 Bacteria 4577
677 nmdc:mga0k408_121504_c1 3300050493 Bacteria 1547
678 nmdc:mga0k408_2239_c1 3300050493 Bacteria 10340
679 nmdc:mga0k408_25213_c1 3300050493 Bacteria 3367
680 nmdc:mga0k408_26694_c1 3300050493 Bacteria 3276
681 nmdc:mga0k408_3111_c1 3300050493 Bacteria 8793
682 nmdc:mga0k408_43050_c1 3300050493 Bacteria 2601
683 nmdc:mga0k408_51645_c1 3300050493 Bacteria 2382
684 nmdc:mga0k408_5413_c1 3300050493 Bacteria 6792
685 nmdc:mga0k408_62551_c1 3300050493 Bacteria 2165
686 nmdc:mga0k408_98158_c1 3300050493 Bacteria 1726
687 nmdc:mga06z11_165112_c1 3300050494 Bacteria 1268
688 nmdc:mga06z11_82589_c1 3300050494 Bacteria 1727
689 nmdc:mga07m45_16459_c1 3300050496 Bacteria 3959
690 nmdc:mga07m45_17988_c1 3300050496 Bacteria 3806
691 nmdc:mga07m45_252_c1 3300050496 Bacteria 21862
692 nmdc:mga07m45_3121_c1 3300050496 Bacteria 7935
693 nmdc:mga07m45_31634_c1 3300050496 Bacteria 2933
694 nmdc:mga07m45_4497_c1 3300050496 Bacteria 6826
695 nmdc:mga07m45_67744_c1 3300050496 Bacteria 2029
696 nmdc:mga05p37_112973_c1 3300050507 Bacteria 3340
697 nmdc:mga09592_1120_c1 3300050508 Bacteria 21354
698 nmdc:mga08y16_165364_c1 3300050511 Bacteria 2298
699 Ga0500610_0005747 3300053079 Bacteria 5124
700 Ga0500644_0001249 3300053088 Bacteria 6970
701 Ga0500644_0015193 3300053088 Bacteria 2189
702 Ga0500644_0026181 3300053088 Bacteria 1802
703 Ga0500583_0066586 3300053092 Bacteria 1714
704 Ga0500651_0000082 3300053093 Bacteria 60329
705 Ga0500641_0052029 3300053096 Bacteria 1687
706 Ga0500571_000152 3300053110 Bacteria 23934
707 Ga0500592_006756 3300053116 Bacteria 1827
708 Ga0500593_000229 3300053117 Bacteria 23119
709 Ga0500593_000664 3300053117 Bacteria 13093
710 Ga0500594_0000381 3300053118 Bacteria 9925
711 Ga0500594_0001035 3300053118 Bacteria 5952
712 Ga0500594_0001930 3300053118 Bacteria 4489
713 Ga0500595_002534 3300053119 Bacteria 8971
714 Ga0500597_053624 3300053120 Bacteria 1722
715 Ga0500607_000049 3300053121 Bacteria 80941
716 Ga0500608_001834 3300053122 Bacteria 7561
717 Ga0500618_000085 3300053125 Bacteria 75760
718 Ga0500652_062342 3300053131 Bacteria 1537
719 Ga0500655_001890 3300053133 Bacteria 3896
720 Ga0500655_004040 3300053133 Bacteria 2644
721 Ga0500658_0001380 3300053134 Bacteria 9814
722 Ga0500658_0001412 3300053134 Bacteria 9674
723 Ga0500658_0002901 3300053134 Bacteria 6583
724 Ga0500559_0000021 3300053136 Bacteria 129980
725 Ga0500564_012785 3300053138 Bacteria 3740
726 Ga0500564_048639 3300053138 Bacteria 1943
727 Ga0500568_0002320 3300053139 Bacteria 11291
728 Ga0500568_0026589 3300053139 Bacteria 2427
729 Ga0500574_000300 3300053141 Bacteria 6074
730 Ga0500574_001994 3300053141 Bacteria 3229
731 Ga0500586_000148 3300053145 Bacteria 12803
732 Ga0500604_0007985 3300053151 Bacteria 2807
733 Ga0500622_0001453 3300053156 Bacteria 18934
734 Ga0500627_0035571 3300053158 Bacteria 2116
735 Ga0500634_0038870 3300053161 Bacteria 2586
736 Ga0500634_0051321 3300053161 Bacteria 2219
737 Ga0500638_000234 3300053162 Bacteria 11917
738 Ga0500636_0030537 3300053177 Bacteria 3187
739 Ga0500636_0042897 3300053177 Bacteria 2673
740 Ga0500645_000228 3300053730 Bacteria 42875
741 Ga0500645_003067 3300053730 Bacteria 7017
742 Ga0500645_005034 3300053730 Bacteria 4947
743 Ga0500587_000179 3300053739 Bacteria 6384

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0243658 Ga0373937_0243658_10_882 290
2 3300050496 nmdc:mga07m45_31634_c1 nmdc:mga07m45_31634_c1_1812_2708 292
3 3300046501 Ga0495607_0006282 Ga0495607_0006282_3671_4630 301
4 3300009177 Ga0105248_10797089 Ga0105248_107970891 304
5 3300049459 Ga0495678_020480 Ga0495678_020480_22_948 308
6 3300035116 Ga0373945_0024980 Ga0373945_0024980_18_956 312
7 3300005844 Ga0068862_100044774 Ga0068862_1000447742 315
8 3300009148 Ga0105243_10122564 Ga0105243_101225642 315
9 3300025935 Ga0207709_10144105 Ga0207709_101441051 315
10 3300028380 Ga0268265_10193399 Ga0268265_101933992 315
11 3300003792 Ga0055540_1004132 Ga0055540_10041322 316
12 3300006353 Ga0075370_10001858 Ga0075370_100018581 316
13 3300025303 Ga0209051_1000025 Ga0209051_1000025368 316
14 3300025304 Ga0209257_1000039 Ga0209257_1000039240 316
15 3300039453 Ga0436362_1020986 Ga0436362_1020986_142_1146 316
16 3300044673 Ga0453683_0002485 Ga0453683_0002485_11559_12566 316
17 3300045051 Ga0451576_0030112 Ga0451576_0030112_1021_2028 316
18 3300050496 nmdc:mga07m45_4497_c1 nmdc:mga07m45_4497_c1_4568_5587 316
19 3300053088 Ga0500644_0015193 Ga0500644_0015193_50_1015 317
20 3300009176 Ga0105242_10219050 Ga0105242_102190501 318
21 3300037853 Ga0436364_0783083 Ga0436364_0783083_32_997 319
22 3300046452 Ga0495617_001092 Ga0495617_001092_150_1109 319
23 3300046457 Ga0495590_0000010 Ga0495590_0000010_118881_119840 319
24 3300046460 Ga0495638_0000157 Ga0495638_0000157_93700_94659 319
25 3300046506 Ga0495583_0000006 Ga0495583_0000006_120701_121660 319
26 3300046507 Ga0495606_0000059 Ga0495606_0000059_97822_98781 319
27 3300046507 Ga0495606_0000987 Ga0495606_0000987_9202_10161 319
28 3300046507 Ga0495606_0014404 Ga0495606_0014404_1645_2604 319
29 3300046512 Ga0495610_0007809 Ga0495610_0007809_4682_5641 319
30 3300046520 Ga0495637_0010571 Ga0495637_0010571_591_1550 319
31 3300046522 Ga0495643_0000099 Ga0495643_0000099_66170_67129 319
32 3300046522 Ga0495643_0000299 Ga0495643_0000299_65585_66544 319
33 3300046524 Ga0495648_0002672 Ga0495648_0002672_2573_3532 319
34 3300046524 Ga0495648_0019308 Ga0495648_0019308_2017_2976 319
35 3300046524 Ga0495648_0071236 Ga0495648_0071236_15_974 319
36 3300046528 Ga0495642_0006222 Ga0495642_0006222_991_1950 319
37 3300046538 Ga0495609_0021033 Ga0495609_0021033_816_1775 319
38 3300046542 Ga0495597_0000159 Ga0495597_0000159_54885_55844 319
39 3300046542 Ga0495597_0000690 Ga0495597_0000690_17448_18407 319
40 3300046557 Ga0495622_0000048 Ga0495622_0000048_95880_96839 319
41 3300046558 Ga0495633_0000063 Ga0495633_0000063_62027_62986 319
42 3300046558 Ga0495633_0009801 Ga0495633_0009801_1064_2023 319
43 3300046660 Ga0495625_0000241 Ga0495625_0000241_72321_73280 319
44 3300046660 Ga0495625_0007495 Ga0495625_0007495_5660_6619 319
45 3300046694 Ga0495649_0005158 Ga0495649_0005158_3909_4868 319
46 3300046810 Ga0495660_0117245 Ga0495660_0117245_316_1275 319
47 3300047320 Ga0495672_0000277 Ga0495672_0000277_54087_55046 319
48 3300047469 Ga0495673_0000059 Ga0495673_0000059_139979_140938 319
49 3300049459 Ga0495678_003851 Ga0495678_003851_2095_3054 319
50 3300049459 Ga0495678_028332 Ga0495678_028332_1391_2350 319
51 3300053118 Ga0500594_0001930 Ga0500594_0001930_1204_2163 319
52 3300053145 Ga0500586_000148 Ga0500586_000148_7345_8304 319
53 iso_pu_bacteria 2842711865 2842715667 319
54 iso_pu_bacteria 2857558681 2857562660 319
55 3300011119 Ga0105246_10071797 Ga0105246_100717972 321
56 3300041404 Ga0439436_0001703 Ga0439436_0001703_4635_5651 321
57 3300042006 Ga0439432_005346 Ga0439432_005346_2507_3523 321
58 3300042007 Ga0439449_0000803 Ga0439449_0000803_8197_9222 321
59 3300042007 Ga0439449_0043583 Ga0439449_0043583_78_1094 321
60 3300042138 Ga0450903_017470 Ga0450903_017470_22_1056 322
61 3300046616 Ga0495668_0000609 Ga0495668_0000609_27729_28697 322
62 3300046507 Ga0495606_0011359 Ga0495606_0011359_244_1215 323
63 3300046530 Ga0495654_0025658 Ga0495654_0025658_1628_2599 323
64 3300046558 Ga0495633_0001033 Ga0495633_0001033_12747_13718 323
65 3300046660 Ga0495625_0002578 Ga0495625_0002578_14672_15643 323
66 3300046664 Ga0495659_0000068 Ga0495659_0000068_32332_33303 323
67 3300046692 Ga0495671_0000628 Ga0495671_0000628_2086_3057 323
68 3300046694 Ga0495649_0145276 Ga0495649_0145276_26_1000 323
69 3300047320 Ga0495672_0000169 Ga0495672_0000169_79065_80036 323
70 3300050489 nmdc:mga03683_8154_c1 nmdc:mga03683_8154_c1_2625_3596 323
71 3300050490 nmdc:mga03n38_117884_c1 nmdc:mga03n38_117884_c1_312_1289 323
72 3300046507 Ga0495606_0017482 Ga0495606_0017482_3526_4500 324
73 3300047472 Ga0495686_0031119 Ga0495686_0031119_2073_3047 324
74 3300005843 Ga0068860_100175711 Ga0068860_1001757112 326
75 3300035083 Ga0373926_0095122 Ga0373926_0095122_34_1014 326
76 3300035089 Ga0373944_0015207 Ga0373944_0015207_727_1707 326
77 3300005295 Ga0065707_10083176 Ga0065707_100831763 327
78 3300005347 Ga0070668_100041642 Ga0070668_1000416422 327
79 3300005367 Ga0070667_100087323 Ga0070667_1000873232 327
80 3300005455 Ga0070663_100063435 Ga0070663_1000634352 327
81 3300005459 Ga0068867_100001358 Ga0068867_1000013589 327
82 3300005719 Ga0068861_100002134 Ga0068861_10000213412 327
83 3300005844 Ga0068862_100201760 Ga0068862_1002017602 327
84 3300006881 Ga0068865_100004245 Ga0068865_1000042455 327
85 3300009148 Ga0105243_10072545 Ga0105243_100725452 327
86 3300009553 Ga0105249_10075911 Ga0105249_100759113 327
87 3300009553 Ga0105249_10581861 Ga0105249_105818611 327
88 3300013297 Ga0157378_10012819 Ga0157378_100128192 327
89 3300013308 Ga0157375_10094435 Ga0157375_100944352 327
90 3300014326 Ga0157380_10065616 Ga0157380_100656163 327
91 3300014969 Ga0157376_10612282 Ga0157376_106122821 327
92 3300017792 Ga0163161_10015558 Ga0163161_100155582 327
93 3300025935 Ga0207709_10013032 Ga0207709_100130322 327
94 3300025938 Ga0207704_10010234 Ga0207704_100102342 327
95 3300025940 Ga0207691_10046682 Ga0207691_100466823 327
96 3300025961 Ga0207712_10295692 Ga0207712_102956921 327
97 3300026067 Ga0207678_10105682 Ga0207678_101056822 327
98 3300026089 Ga0207648_10129440 Ga0207648_101294402 327
99 3300026118 Ga0207675_100001409 Ga0207675_1000014092 327
100 3300026118 Ga0207675_100273380 Ga0207675_1002733801 327
101 3300028380 Ga0268265_10020503 Ga0268265_100205033 327
102 3300028380 Ga0268265_10088567 Ga0268265_100885672 327
103 3300028381 Ga0268264_10008521 Ga0268264_100085213 327
104 3300039450 Ga0436363_0546706 Ga0436363_0546706_3082_4065 327
105 3300050493 nmdc:mga0k408_62551_c1 nmdc:mga0k408_62551_c1_1097_2080 327
106 3300002739 JGI25158J39367_1006071 JGI25158J39367_10060712 328
107 3300009176 Ga0105242_10226583 Ga0105242_102265832 328
108 3300031247 Ga0265340_10053131 Ga0265340_100531311 328
109 3300005327 Ga0070658_10060413 Ga0070658_100604133 330
110 3300005328 Ga0070676_10004778 Ga0070676_100047783 330
111 3300005331 Ga0070670_100016983 Ga0070670_1000169836 330
112 3300005347 Ga0070668_100003200 Ga0070668_10000320012 330
113 3300005354 Ga0070675_100001023 Ga0070675_10000102310 330
114 3300005355 Ga0070671_100000187 Ga0070671_10000018713 330
115 3300005364 Ga0070673_100001644 Ga0070673_10000164412 330
116 3300005367 Ga0070667_100002039 Ga0070667_10000203911 330
117 3300005455 Ga0070663_100003597 Ga0070663_1000035978 330
118 3300005456 Ga0070678_100001085 Ga0070678_1000010855 330
119 3300005539 Ga0068853_100037871 Ga0068853_1000378714 330
120 3300005543 Ga0070672_100003076 Ga0070672_1000030769 330
121 3300005548 Ga0070665_100007846 Ga0070665_1000078465 330
122 3300005834 Ga0068851_10022194 Ga0068851_100221942 330
123 3300005843 Ga0068860_100019618 Ga0068860_1000196187 330
124 3300013308 Ga0157375_10005097 Ga0157375_1000509712 330
125 3300014325 Ga0163163_10104763 Ga0163163_101047632 330
126 3300014969 Ga0157376_10213687 Ga0157376_102136872 330
127 3300021388 Ga0213875_10002672 Ga0213875_100026726 330
128 3300025907 Ga0207645_10000912 Ga0207645_1000091218 330
129 3300025925 Ga0207650_10033963 Ga0207650_100339632 330
130 3300025926 Ga0207659_10024192 Ga0207659_100241926 330
131 3300025940 Ga0207691_10000342 Ga0207691_1000034237 330
132 3300025942 Ga0207689_10103093 Ga0207689_101030933 330
133 3300025960 Ga0207651_10082645 Ga0207651_100826452 330
134 3300025972 Ga0207668_10002518 Ga0207668_100025183 330
135 3300025986 Ga0207658_10015677 Ga0207658_100156775 330
136 3300026041 Ga0207639_10072426 Ga0207639_100724262 330
137 3300026067 Ga0207678_10004759 Ga0207678_100047598 330
138 3300026095 Ga0207676_10245620 Ga0207676_102456202 330
139 3300026121 Ga0207683_10000020 Ga0207683_1000002088 330
140 3300026142 Ga0207698_10011424 Ga0207698_100114242 330
141 3300028381 Ga0268264_10018269 Ga0268264_100182694 330
142 3300037853 Ga0436364_1478496 Ga0436364_1478496_3787_4785 330
143 iso_pu_bacteria 2954767861 2954769113 330
144 3300005335 Ga0070666_10041292 Ga0070666_100412923 331
145 3300005347 Ga0070668_100005640 Ga0070668_1000056402 331
146 3300005367 Ga0070667_100043191 Ga0070667_1000431913 331
147 3300039438 Ga0436360_0355167 Ga0436360_0355167_33_1034 331
148 iso_pu_bacteria 2818991436 2819545378 331
149 3300005330 Ga0070690_100011917 Ga0070690_1000119174 332
150 3300005331 Ga0070670_100088047 Ga0070670_1000880471 332
151 3300005335 Ga0070666_10001802 Ga0070666_100018025 332
152 3300005338 Ga0068868_100000766 Ga0068868_10000076616 332
153 3300005340 Ga0070689_100005140 Ga0070689_1000051409 332
154 3300005354 Ga0070675_100000445 Ga0070675_10000044514 332
155 3300005355 Ga0070671_100009551 Ga0070671_1000095514 332
156 3300005365 Ga0070688_100025652 Ga0070688_1000256523 332
157 3300005367 Ga0070667_100095454 Ga0070667_1000954543 332
158 3300005456 Ga0070678_100000859 Ga0070678_10000085910 332
159 3300005457 Ga0070662_100303388 Ga0070662_1003033881 332
160 3300005466 Ga0070685_10075129 Ga0070685_100751292 332
161 3300005616 Ga0068852_100126387 Ga0068852_1001263873 332
162 3300005617 Ga0068859_100001853 Ga0068859_10000185319 332
163 3300005618 Ga0068864_100000330 Ga0068864_10000033022 332
164 3300005841 Ga0068863_100000715 Ga0068863_10000071521 332
165 3300005842 Ga0068858_100000900 Ga0068858_1000009009 332
166 3300006051 Ga0075364_10216939 Ga0075364_102169392 332
167 3300006358 Ga0068871_100008254 Ga0068871_1000082546 332
168 3300006931 Ga0097620_100001853 Ga0097620_1000018534 332
169 3300009093 Ga0105240_10012540 Ga0105240_100125403 332
170 3300009177 Ga0105248_10004935 Ga0105248_100049359 332
171 3300013296 Ga0157374_10006819 Ga0157374_100068196 332
172 3300013306 Ga0163162_10004795 Ga0163162_100047956 332
173 3300013306 Ga0163162_10256948 Ga0163162_102569482 332
174 3300013308 Ga0157375_10005292 Ga0157375_100052929 332
175 3300014325 Ga0163163_10000980 Ga0163163_100009803 332
176 3300014745 Ga0157377_10209602 Ga0157377_102096021 332
177 3300014968 Ga0157379_10006787 Ga0157379_100067877 332
178 3300014969 Ga0157376_10038215 Ga0157376_100382154 332
179 3300017792 Ga0163161_10091611 Ga0163161_100916112 332
180 3300025903 Ga0207680_10000940 Ga0207680_100009406 332
181 3300025925 Ga0207650_10200291 Ga0207650_102002912 332
182 3300025926 Ga0207659_10000484 Ga0207659_100004848 332
183 3300025931 Ga0207644_10000525 Ga0207644_1000052513 332
184 3300025933 Ga0207706_10333136 Ga0207706_103331361 332
185 3300025936 Ga0207670_10015558 Ga0207670_100155582 332
186 3300025940 Ga0207691_10051006 Ga0207691_100510062 332
187 3300025941 Ga0207711_10001399 Ga0207711_1000139921 332
188 3300025986 Ga0207658_10055114 Ga0207658_100551141 332
189 3300026023 Ga0207677_10000623 Ga0207677_1000062315 332
190 3300026035 Ga0207703_10000773 Ga0207703_1000077313 332
191 3300026041 Ga0207639_10025987 Ga0207639_100259874 332
192 3300026088 Ga0207641_10001102 Ga0207641_1000110213 332
193 3300026095 Ga0207676_10000742 Ga0207676_1000074213 332
194 3300026121 Ga0207683_10003309 Ga0207683_1000330910 332
195 3300026142 Ga0207698_10032804 Ga0207698_100328044 332
196 3300039438 Ga0436360_0677787 Ga0436360_0677787_20_1045 332
197 iso_pu_bacteria 2585428062 2587757729 332
198 iso_pu_bacteria 2643221658 2644328614 332
199 iso_pu_bacteria 2738543013 2739248034 332
200 iso_pu_bacteria 2831265667 2831272164 332
201 iso_pu_bacteria 2885198086 2885202935 332
202 iso_pu_bacteria 2885211737 2885216668 332
203 iso_pu_bacteria 2904541872 2904547078 332
204 iso_pu_bacteria 2929160207 2929165614 332
205 iso_pu_bacteria 2945909444 2945909711 332
206 3300021361 Ga0213872_10008485 Ga0213872_100084853 333
207 3300039447 Ga0436361_0360094 Ga0436361_0360094_1341_2345 333
208 iso_pu_bacteria 2513020051 2513229550 333
209 iso_pu_bacteria 2599185214 2599626457 333
210 iso_pu_bacteria 2599185226 2599677090 333
211 iso_pu_bacteria 2599185227 2599682158 333
212 iso_pu_bacteria 2599185229 2599695809 333
213 iso_pu_bacteria 2643221628 2644161625 333
214 iso_pu_bacteria 2643221645 2644251771 333
215 iso_pu_bacteria 2643221664 2644360432 333
216 iso_pu_bacteria 2643221672 2644399849 333
217 iso_pu_bacteria 2738541280 2738740531 333
218 iso_pu_bacteria 2738541300 2738843216 333
219 iso_pu_bacteria 2738543018 2739272147 333
220 iso_pu_bacteria 2738543030 2739341191 333
221 iso_pu_bacteria 2808606418 2809146314 333
222 iso_pu_bacteria 2818991446 2819601729 333
223 iso_pu_bacteria 2838054893 2838059328 333
224 iso_pu_bacteria 2842677519 2842680252 333
225 iso_pu_bacteria 2885192300 2885194399 333
226 iso_pu_bacteria 2899924645 2899930796 333
227 iso_pu_bacteria 2919462493 2919463698 333
228 iso_pu_bacteria 2928037797 2928040883 333
229 iso_pu_bacteria 2928044640 2928047725 333
230 iso_pu_bacteria 2928051484 2928055615 333
231 iso_pu_bacteria 2928064002 2928069712 333
232 iso_pu_bacteria 2928070936 2928075428 333
233 iso_pu_bacteria 2928084124 2928088413 333
234 iso_pu_bacteria 2945945610 2945945816 333
235 iso_pu_bacteria 2945972063 2945975446 333
236 iso_pu_bacteria 2945984333 2945988320 333
237 3300025941 Ga0207711_10077529 Ga0207711_100775292 334
238 3300030745 Ga0316182_1100821 Ga0316182_11008212 334
239 3300031239 Ga0265328_10004417 Ga0265328_100044176 334
240 3300031344 Ga0265316_10116782 Ga0265316_101167822 334
241 3300049459 Ga0495678_003519 Ga0495678_003519_5876_6880 334
242 3300003794 Ga0055531_10001511 Ga0055531_1000151118 335
243 3300005328 Ga0070676_10062637 Ga0070676_100626372 335
244 3300005331 Ga0070670_100095830 Ga0070670_1000958302 335
245 3300005331 Ga0070670_100319766 Ga0070670_1003197661 335
246 3300005333 Ga0070677_10006815 Ga0070677_100068152 335
247 3300005354 Ga0070675_100044798 Ga0070675_1000447984 335
248 3300005356 Ga0070674_100146204 Ga0070674_1001462043 335
249 3300005364 Ga0070673_100137682 Ga0070673_1001376822 335
250 3300005364 Ga0070673_100160896 Ga0070673_1001608961 335
251 3300005367 Ga0070667_100100367 Ga0070667_1001003672 335
252 3300005458 Ga0070681_10014476 Ga0070681_100144766 335
253 3300005543 Ga0070672_100067320 Ga0070672_1000673202 335
254 3300005578 Ga0068854_100187108 Ga0068854_1001871082 335
255 3300005834 Ga0068851_10039796 Ga0068851_100397964 335
256 3300006186 Ga0075369_10055625 Ga0075369_100556251 335
257 3300006358 Ga0068871_100128775 Ga0068871_1001287751 335
258 3300009094 Ga0111539_10467961 Ga0111539_104679611 335
259 3300009176 Ga0105242_10228964 Ga0105242_102289642 335
260 3300013296 Ga0157374_10167418 Ga0157374_101674182 335
261 3300013308 Ga0157375_10221040 Ga0157375_102210401 335
262 3300014325 Ga0163163_10187418 Ga0163163_101874183 335
263 3300014326 Ga0157380_10109763 Ga0157380_101097632 335
264 3300014497 Ga0182008_10035285 Ga0182008_100352852 335
265 3300015265 Ga0182005_1000279 Ga0182005_10002799 335
266 3300025893 Ga0207682_10002412 Ga0207682_100024122 335
267 3300025912 Ga0207707_10018330 Ga0207707_100183305 335
268 3300025923 Ga0207681_10054037 Ga0207681_100540372 335
269 3300025923 Ga0207681_10118906 Ga0207681_101189062 335
270 3300025940 Ga0207691_10086083 Ga0207691_100860832 335
271 3300026067 Ga0207678_10020565 Ga0207678_100205654 335
272 3300026118 Ga0207675_100067256 Ga0207675_1000672565 335
273 3300028794 Ga0307515_10071598 Ga0307515_100715985 335
274 3300030521 Ga0307511_10001889 Ga0307511_1000188918 335
275 3300031456 Ga0307513_10008606 Ga0307513_100086066 335
276 3300042439 Ga0439464_0013717 Ga0439464_0013717_505_1512 335
277 3300046454 Ga0495592_0046542 Ga0495592_0046542_1443_2450 335
278 3300046462 Ga0495651_0082369 Ga0495651_0082369_606_1613 335
279 3300046463 Ga0495653_0010798 Ga0495653_0010798_2392_3399 335
280 3300046511 Ga0495608_0003574 Ga0495608_0003574_10021_11028 335
281 3300046514 Ga0495618_0028426 Ga0495618_0028426_879_1886 335
282 3300046516 Ga0495628_0004299 Ga0495628_0004299_7474_8481 335
283 3300046529 Ga0495652_0015010 Ga0495652_0015010_4361_5368 335
284 3300046539 Ga0495621_0032765 Ga0495621_0032765_522_1532 335
285 3300046675 Ga0495657_0065344 Ga0495657_0065344_157_1164 335
286 3300046678 Ga0495599_0003655 Ga0495599_0003655_3809_4816 335
287 3300046680 Ga0495646_0003855 Ga0495646_0003855_4061_5068 335
288 3300046690 Ga0495624_0018658 Ga0495624_0018658_1969_2976 335
289 3300046809 Ga0495600_0001607 Ga0495600_0001607_4063_5070 335
290 3300047317 Ga0495604_0008167 Ga0495604_0008167_352_1359 335
291 3300048905 Ga0496102_0005899 Ga0496102_0005899_6257_7264 335
292 3300048907 Ga0496104_0063560 Ga0496104_0063560_213_1223 335
293 3300050511 nmdc:mga08y16_165364_c1 nmdc:mga08y16_165364_c1_853_1863 335
294 3300053092 Ga0500583_0066586 Ga0500583_0066586_591_1610 335
295 3300053117 Ga0500593_000229 Ga0500593_000229_20335_21342 335
296 3300053119 Ga0500595_002534 Ga0500595_002534_3484_4491 335
297 3300053133 Ga0500655_004040 Ga0500655_004040_1615_2634 335
298 3300053139 Ga0500568_0026589 Ga0500568_0026589_1078_2097 335
299 3300053141 Ga0500574_001994 Ga0500574_001994_1296_2303 335
300 3300053151 Ga0500604_0007985 Ga0500604_0007985_243_1262 335
301 3300002773 JGI25152J39213_1002250 JGI25152J39213_10022507 336
302 3300002773 JGI25152J39213_1004246 JGI25152J39213_10042463 336
303 3300002987 JGI25159J45721_1002244 JGI25159J45721_10022443 336
304 3300003187 JGI25151J46595_10001379 JGI25151J46595_1000137910 336
305 3300003187 JGI25151J46595_10004400 JGI25151J46595_100044007 336
306 3300003187 JGI25151J46595_10010447 JGI25151J46595_100104473 336
307 3300003215 JGI25153J46596_10004540 JGI25153J46596_100045407 336
308 3300003354 JGI25160J50197_1002233 JGI25160J50197_10022339 336
309 3300003374 JGI25161J50226_1005453 JGI25161J50226_10054532 336
310 3300003771 Ga0055526_1005307 Ga0055526_10053077 336
311 3300003773 Ga0055537_1001916 Ga0055537_10019167 336
312 3300003775 Ga0055524_1003604 Ga0055524_10036047 336
313 3300003784 Ga0055534_1001989 Ga0055534_10019897 336
314 3300003790 Ga0055528_1003783 Ga0055528_10037837 336
315 3300003794 Ga0055531_10005440 Ga0055531_100054407 336
316 3300004625 Ga0055543_1000596 Ga0055543_100059616 336
317 3300005262 Ga0065165_1003176 Ga0065165_10031763 336
318 3300005335 Ga0070666_10148399 Ga0070666_101483991 336
319 3300005338 Ga0068868_100106082 Ga0068868_1001060823 336
320 3300005338 Ga0068868_100234213 Ga0068868_1002342131 336
321 3300005347 Ga0070668_100319710 Ga0070668_1003197101 336
322 3300005354 Ga0070675_100261225 Ga0070675_1002612252 336
323 3300005367 Ga0070667_100001048 Ga0070667_10000104811 336
324 3300005456 Ga0070678_100044459 Ga0070678_1000444594 336
325 3300005467 Ga0070706_100142410 Ga0070706_1001424102 336
326 3300005539 Ga0068853_100073389 Ga0068853_1000733891 336
327 3300005548 Ga0070665_100252815 Ga0070665_1002528152 336
328 3300005618 Ga0068864_100029596 Ga0068864_1000295962 336
329 3300005841 Ga0068863_100013924 Ga0068863_1000139245 336
330 3300006177 Ga0075362_10045271 Ga0075362_100452712 336
331 3300006195 Ga0075366_10037194 Ga0075366_100371942 336
332 3300006195 Ga0075366_10042135 Ga0075366_100421352 336
333 3300006195 Ga0075366_10107728 Ga0075366_101077283 336
334 3300006195 Ga0075366_10127915 Ga0075366_101279152 336
335 3300006237 Ga0097621_100157134 Ga0097621_1001571341 336
336 3300006353 Ga0075370_10011949 Ga0075370_100119494 336
337 3300006353 Ga0075370_10016711 Ga0075370_100167112 336
338 3300009093 Ga0105240_10009145 Ga0105240_100091457 336
339 3300009098 Ga0105245_10194377 Ga0105245_101943772 336
340 3300009174 Ga0105241_10035684 Ga0105241_100356844 336
341 3300009545 Ga0105237_10000407 Ga0105237_1000040727 336
342 3300009551 Ga0105238_10005854 Ga0105238_100058543 336
343 3300010375 Ga0105239_10000335 Ga0105239_1000033536 336
344 3300013104 Ga0157370_10001435 Ga0157370_1000143525 336
345 3300014969 Ga0157376_10069577 Ga0157376_100695772 336
346 3300015262 Ga0182007_10006550 Ga0182007_100065503 336
347 3300017792 Ga0163161_10003484 Ga0163161_100034844 336
348 3300025208 Ga0209436_102895 Ga0209436_1028952 336
349 3300025245 Ga0207425_1000190 Ga0207425_100019028 336
350 3300025245 Ga0207425_1002381 Ga0207425_10023811 336
351 3300025258 Ga0209129_1000091 Ga0209129_100009115 336
352 3300025258 Ga0209129_1002201 Ga0209129_10022019 336
353 3300025258 Ga0209129_1007264 Ga0209129_10072643 336
354 3300025263 Ga0209565_1000335 Ga0209565_100033523 336
355 3300025273 Ga0209673_1002703 Ga0209673_10027033 336
356 3300025284 Ga0209130_1000140 Ga0209130_1000140103 336
357 3300025291 Ga0209675_1000659 Ga0209675_10006593 336
358 3300025294 Ga0209025_1000207 Ga0209025_1000207119 336
359 3300025294 Ga0209025_1000286 Ga0209025_100028678 336
360 3300025294 Ga0209025_1000356 Ga0209025_100035678 336
361 3300025295 Ga0209564_1000597 Ga0209564_100059723 336
362 3300025297 Ga0209758_1000092 Ga0209758_1000092133 336
363 3300025299 Ga0209256_1000094 Ga0209256_1000094103 336
364 3300025302 Ga0207426_1000084 Ga0207426_1000084100 336
365 3300025304 Ga0209257_1005208 Ga0209257_10052083 336
366 3300025321 Ga0207656_10014325 Ga0207656_100143253 336
367 3300025903 Ga0207680_10017960 Ga0207680_100179605 336
368 3300025913 Ga0207695_10007295 Ga0207695_100072959 336
369 3300025924 Ga0207694_10063832 Ga0207694_100638324 336
370 3300025927 Ga0207687_10090908 Ga0207687_100909082 336
371 3300025935 Ga0207709_10072135 Ga0207709_100721352 336
372 3300025938 Ga0207704_10063942 Ga0207704_100639422 336
373 3300025972 Ga0207668_10266532 Ga0207668_102665321 336
374 3300025986 Ga0207658_10000553 Ga0207658_1000055324 336
375 3300025986 Ga0207658_10134358 Ga0207658_101343582 336
376 3300026078 Ga0207702_10462684 Ga0207702_104626842 336
377 3300026088 Ga0207641_10059118 Ga0207641_100591185 336
378 3300026095 Ga0207676_10226541 Ga0207676_102265412 336
379 3300026121 Ga0207683_10026998 Ga0207683_100269984 336
380 3300026121 Ga0207683_10160635 Ga0207683_101606352 336
381 3300028379 Ga0268266_10160688 Ga0268266_101606882 336
382 3300028381 Ga0268264_10179100 Ga0268264_101791001 336
383 3300028794 Ga0307515_10000034 Ga0307515_10000034249 336
384 3300028794 Ga0307515_10000179 Ga0307515_1000017915 336
385 3300028794 Ga0307515_10000586 Ga0307515_1000058611 336
386 3300028794 Ga0307515_10005841 Ga0307515_1000584110 336
387 3300030522 Ga0307512_10145404 Ga0307512_101454042 336
388 3300031456 Ga0307513_10000012 Ga0307513_10000012234 336
389 3300031456 Ga0307513_10000514 Ga0307513_100005143 336
390 3300031456 Ga0307513_10012803 Ga0307513_100128037 336
391 3300031456 Ga0307513_10014348 Ga0307513_100143484 336
392 3300031456 Ga0307513_10116491 Ga0307513_101164913 336
393 3300031456 Ga0307513_10211504 Ga0307513_102115041 336
394 3300031456 Ga0307513_10318978 Ga0307513_103189782 336
395 3300031507 Ga0307509_10001193 Ga0307509_100011937 336
396 3300031507 Ga0307509_10011999 Ga0307509_1001199910 336
397 3300031616 Ga0307508_10021258 Ga0307508_100212582 336
398 3300031649 Ga0307514_10004105 Ga0307514_100041058 336
399 3300031649 Ga0307514_10053099 Ga0307514_100530992 336
400 3300031730 Ga0307516_10001570 Ga0307516_100015706 336
401 3300031730 Ga0307516_10006191 Ga0307516_100061916 336
402 3300031731 Ga0307405_10013201 Ga0307405_100132012 336
403 3300033179 Ga0307507_10085860 Ga0307507_100858603 336
404 3300033180 Ga0307510_10026010 Ga0307510_100260106 336
405 3300033180 Ga0307510_10031266 Ga0307510_100312666 336
406 3300037471 Ga0395905_0009110 Ga0395905_0009110_1693_2703 336
407 3300037471 Ga0395905_0090613 Ga0395905_0090613_537_1547 336
408 3300041404 Ga0439436_0002775 Ga0439436_0002775_1367_2377 336
409 3300041406 Ga0439439_0000253 Ga0439439_0000253_1011_2021 336
410 3300041407 Ga0439447_011358 Ga0439447_011358_1016_2026 336
411 3300041999 Ga0439433_0010564 Ga0439433_0010564_153_1163 336
412 3300042007 Ga0439449_0006219 Ga0439449_0006219_827_1837 336
413 3300042010 Ga0439452_026084 Ga0439452_026084_128_1138 336
414 3300042015 Ga0439462_0001382 Ga0439462_0001382_2164_3174 336
415 3300042147 Ga0450910_010046 Ga0450910_010046_36_1046 336
416 3300042156 Ga0439446_0003954 Ga0439446_0003954_468_1478 336
417 3300042184 Ga0450908_002422 Ga0450908_002422_1875_2885 336
418 3300042435 Ga0439434_0016772 Ga0439434_0016772_738_1748 336
419 3300042532 Ga0450893_0003041 Ga0450893_0003041_1021_2031 336
420 3300044683 Ga0466965_0013943 Ga0466965_0013943_2727_3737 336
421 3300044706 Ga0466964_0019594 Ga0466964_0019594_706_1737 336
422 3300044712 Ga0453684_0045386 Ga0453684_0045386_2454_3464 336
423 3300044842 Ga0466957_0017998 Ga0466957_0017998_2076_3086 336
424 3300044901 Ga0466960_0039465 Ga0466960_0039465_1138_2148 336
425 3300046453 Ga0495627_001688 Ga0495627_001688_2910_3920 336
426 3300046454 Ga0495592_0000727 Ga0495592_0000727_16983_17993 336
427 3300046491 Ga0495584_0085626 Ga0495584_0085626_58_1068 336
428 3300046500 Ga0495596_0003413 Ga0495596_0003413_1847_2860 336
429 3300046511 Ga0495608_0005234 Ga0495608_0005234_5820_6830 336
430 3300046512 Ga0495610_0060887 Ga0495610_0060887_295_1305 336
431 3300046512 Ga0495610_0091284 Ga0495610_0091284_228_1238 336
432 3300046516 Ga0495628_0001674 Ga0495628_0001674_10187_11197 336
433 3300046519 Ga0495632_0083193 Ga0495632_0083193_266_1276 336
434 3300046520 Ga0495637_0001059 Ga0495637_0001059_10587_11597 336
435 3300046522 Ga0495643_0007767 Ga0495643_0007767_3944_4954 336
436 3300046524 Ga0495648_0006023 Ga0495648_0006023_8024_9037 336
437 3300046528 Ga0495642_0003934 Ga0495642_0003934_385_1395 336
438 3300046529 Ga0495652_0015350 Ga0495652_0015350_659_1669 336
439 3300046529 Ga0495652_0066383 Ga0495652_0066383_1160_2170 336
440 3300046539 Ga0495621_0018294 Ga0495621_0018294_536_1546 336
441 3300046542 Ga0495597_0042820 Ga0495597_0042820_555_1565 336
442 3300046543 Ga0495645_0011320 Ga0495645_0011320_1142_2152 336
443 3300046616 Ga0495668_0069952 Ga0495668_0069952_529_1539 336
444 3300046660 Ga0495625_0001836 Ga0495625_0001836_22554_23564 336
445 3300046679 Ga0495623_0050337 Ga0495623_0050337_281_1291 336
446 3300046680 Ga0495646_0002050 Ga0495646_0002050_2536_3546 336
447 3300046692 Ga0495671_0001980 Ga0495671_0001980_9150_10160 336
448 3300046810 Ga0495660_0056800 Ga0495660_0056800_1094_2104 336
449 3300047443 Ga0495687_010508 Ga0495687_010508_776_1786 336
450 3300047447 Ga0495685_022587 Ga0495685_022587_45_1055 336
451 3300048088 Ga0495602_0023857 Ga0495602_0023857_4129_5139 336
452 3300048904 Ga0496101_0261704 Ga0496101_0261704_143_1153 336
453 3300048905 Ga0496102_0094810 Ga0496102_0094810_326_1336 336
454 3300048908 Ga0496105_0314927 Ga0496105_0314927_77_1087 336
455 3300048909 Ga0496106_0073572 Ga0496106_0073572_650_1660 336
456 3300048910 Ga0496107_0050803 Ga0496107_0050803_332_1342 336
457 3300048912 Ga0496109_0043436 Ga0496109_0043436_307_1317 336
458 3300048913 Ga0496110_0409257 Ga0496110_0409257_65_1075 336
459 3300048917 Ga0496114_0090600 Ga0496114_0090600_755_1765 336
460 3300048924 Ga0496121_0027380 Ga0496121_0027380_1248_2258 336
461 3300048928 Ga0496125_0002222 Ga0496125_0002222_22097_23140 336
462 3300048928 Ga0496125_0147665 Ga0496125_0147665_428_1450 336
463 3300049588 Ga0501072_0278487 Ga0501072_0278487_227_1240 336
464 3300050489 nmdc:mga03683_7666_c1 nmdc:mga03683_7666_c1_652_1662 336
465 3300050493 nmdc:mga0k408_121504_c1 nmdc:mga0k408_121504_c1_344_1354 336
466 3300050493 nmdc:mga0k408_25213_c1 nmdc:mga0k408_25213_c1_120_1130 336
467 3300050493 nmdc:mga0k408_5413_c1 nmdc:mga0k408_5413_c1_4964_5974 336
468 3300050493 nmdc:mga0k408_98158_c1 nmdc:mga0k408_98158_c1_390_1412 336
469 3300053079 Ga0500610_0005747 Ga0500610_0005747_2667_3677 336
470 3300053088 Ga0500644_0001249 Ga0500644_0001249_4238_5248 336
471 3300053088 Ga0500644_0026181 Ga0500644_0026181_404_1414 336
472 3300053096 Ga0500641_0052029 Ga0500641_0052029_188_1198 336
473 3300053117 Ga0500593_000664 Ga0500593_000664_9163_10173 336
474 3300053118 Ga0500594_0000381 Ga0500594_0000381_5317_6327 336
475 3300053121 Ga0500607_000049 Ga0500607_000049_71548_72558 336
476 3300053122 Ga0500608_001834 Ga0500608_001834_4682_5704 336
477 3300053136 Ga0500559_0000021 Ga0500559_0000021_89641_90651 336
478 3300053138 Ga0500564_048639 Ga0500564_048639_466_1476 336
479 3300053156 Ga0500622_0001453 Ga0500622_0001453_13190_14200 336
480 3300053158 Ga0500627_0035571 Ga0500627_0035571_348_1358 336
481 3300053161 Ga0500634_0038870 Ga0500634_0038870_735_1745 336
482 3300053177 Ga0500636_0042897 Ga0500636_0042897_73_1083 336
483 3300053730 Ga0500645_000228 Ga0500645_000228_5009_6019 336
484 3300053730 Ga0500645_003067 Ga0500645_003067_1499_2509 336
485 3300053730 Ga0500645_005034 Ga0500645_005034_390_1400 336
486 3300053739 Ga0500587_000179 Ga0500587_000179_5087_6097 336
487 3300001979 JGI24740J21852_10032351 JGI24740J21852_100323512 337
488 3300003322 rootL2_10012652 rootL2_100126525 337
489 3300003574 Ga0007410J51695_1034327 Ga0007410J51695_10343271 337
490 3300003579 Ga0007429J51699_1050987 Ga0007429J51699_10509871 337
491 3300003693 Ga0032354_1019303 Ga0032354_10193031 337
492 3300003761 Ga0055535_1000378 Ga0055535_100037816 337
493 3300003762 Ga0055542_1000036 Ga0055542_1000036189 337
494 3300003771 Ga0055526_1005065 Ga0055526_10050657 337
495 3300003773 Ga0055537_1000541 Ga0055537_100054114 337
496 3300003773 Ga0055537_1003257 Ga0055537_10032573 337
497 3300003775 Ga0055524_1003426 Ga0055524_10034263 337
498 3300003781 Ga0055536_1001912 Ga0055536_10019127 337
499 3300003781 Ga0055536_1007703 Ga0055536_10077031 337
500 3300003781 Ga0055536_1008036 Ga0055536_10080364 337
501 3300003784 Ga0055534_1000491 Ga0055534_100049114 337
502 3300003784 Ga0055534_1012575 Ga0055534_10125752 337
503 3300003790 Ga0055528_1000927 Ga0055528_10009278 337
504 3300003790 Ga0055528_1006976 Ga0055528_10069763 337
505 3300003791 Ga0055530_10001000 Ga0055530_100010007 337
506 3300003791 Ga0055530_10005427 Ga0055530_100054275 337
507 3300003792 Ga0055540_1002459 Ga0055540_10024596 337
508 3300003792 Ga0055540_1004268 Ga0055540_10042685 337
509 3300003792 Ga0055540_1019857 Ga0055540_10198572 337
510 3300003794 Ga0055531_10001971 Ga0055531_100019718 337
511 3300003794 Ga0055531_10004950 Ga0055531_100049503 337
512 3300004625 Ga0055543_1006181 Ga0055543_10061813 337
513 3300005328 Ga0070676_10044472 Ga0070676_100444724 337
514 3300005334 Ga0068869_100173081 Ga0068869_1001730812 337
515 3300005335 Ga0070666_10023526 Ga0070666_100235262 337
516 3300005338 Ga0068868_100060809 Ga0068868_1000608094 337
517 3300005354 Ga0070675_100015016 Ga0070675_1000150162 337
518 3300005355 Ga0070671_100048597 Ga0070671_1000485972 337
519 3300005356 Ga0070674_100174012 Ga0070674_1001740121 337
520 3300005364 Ga0070673_100127277 Ga0070673_1001272772 337
521 3300005445 Ga0070708_100009421 Ga0070708_1000094214 337
522 3300005455 Ga0070663_100023491 Ga0070663_1000234911 337
523 3300005456 Ga0070678_100057815 Ga0070678_1000578153 337
524 3300005457 Ga0070662_100005652 Ga0070662_1000056522 337
525 3300005457 Ga0070662_100346747 Ga0070662_1003467471 337
526 3300005458 Ga0070681_10363987 Ga0070681_103639871 337
527 3300005459 Ga0068867_100138994 Ga0068867_1001389942 337
528 3300005468 Ga0070707_100002457 Ga0070707_1000024578 337
529 3300005471 Ga0070698_100127696 Ga0070698_1001276962 337
530 3300005518 Ga0070699_100017017 Ga0070699_1000170172 337
531 3300005530 Ga0070679_100077751 Ga0070679_1000777511 337
532 3300005539 Ga0068853_100018520 Ga0068853_1000185201 337
533 3300005543 Ga0070672_100011595 Ga0070672_1000115952 337
534 3300005543 Ga0070672_100021295 Ga0070672_1000212954 337
535 3300005548 Ga0070665_100050614 Ga0070665_1000506141 337
536 3300005548 Ga0070665_100070637 Ga0070665_1000706372 337
537 3300005564 Ga0070664_100007153 Ga0070664_1000071538 337
538 3300005577 Ga0068857_100032041 Ga0068857_1000320411 337
539 3300005577 Ga0068857_100195744 Ga0068857_1001957442 337
540 3300005616 Ga0068852_100124830 Ga0068852_1001248302 337
541 3300005718 Ga0068866_10132879 Ga0068866_101328792 337
542 3300005834 Ga0068851_10019323 Ga0068851_100193232 337
543 3300005841 Ga0068863_100111901 Ga0068863_1001119014 337
544 3300005843 Ga0068860_100018974 Ga0068860_1000189745 337
545 3300005843 Ga0068860_100151032 Ga0068860_1001510322 337
546 3300006028 Ga0070717_10258504 Ga0070717_102585042 337
547 3300006038 Ga0075365_10006589 Ga0075365_100065897 337
548 3300006042 Ga0075368_10037677 Ga0075368_100376772 337
549 3300006048 Ga0075363_100012444 Ga0075363_1000124443 337
550 3300006048 Ga0075363_100017985 Ga0075363_1000179853 337
551 3300006051 Ga0075364_10032617 Ga0075364_100326174 337
552 3300006177 Ga0075362_10007235 Ga0075362_100072353 337
553 3300006178 Ga0075367_10003595 Ga0075367_100035952 337
554 3300006186 Ga0075369_10042042 Ga0075369_100420421 337
555 3300006195 Ga0075366_10001162 Ga0075366_100011625 337
556 3300006195 Ga0075366_10025893 Ga0075366_100258934 337
557 3300006195 Ga0075366_10147607 Ga0075366_101476072 337
558 3300006353 Ga0075370_10000374 Ga0075370_100003744 337
559 3300006353 Ga0075370_10001917 Ga0075370_100019171 337
560 3300006353 Ga0075370_10039180 Ga0075370_100391803 337
561 3300006353 Ga0075370_10124972 Ga0075370_101249722 337
562 3300006880 Ga0075429_100002916 Ga0075429_1000029169 337
563 3300006881 Ga0068865_100159390 Ga0068865_1001593902 337
564 3300006948 Ga0099826_10001740 Ga0099826_100017406 337
565 3300009093 Ga0105240_10039983 Ga0105240_100399835 337
566 3300009147 Ga0114129_10071266 Ga0114129_100712665 337
567 3300009148 Ga0105243_10061249 Ga0105243_100612492 337
568 3300009148 Ga0105243_10149034 Ga0105243_101490342 337
569 3300009545 Ga0105237_10009701 Ga0105237_100097012 337
570 3300009545 Ga0105237_10155780 Ga0105237_101557802 337
571 3300010375 Ga0105239_10043224 Ga0105239_100432241 337
572 3300010375 Ga0105239_10446611 Ga0105239_104466112 337
573 3300013100 Ga0157373_10026668 Ga0157373_100266682 337
574 3300013104 Ga0157370_10009310 Ga0157370_100093107 337
575 3300013104 Ga0157370_10293098 Ga0157370_102930982 337
576 3300013307 Ga0157372_10038299 Ga0157372_100382994 337
577 3300013308 Ga0157375_10126822 Ga0157375_101268224 337
578 3300014326 Ga0157380_10187607 Ga0157380_101876072 337
579 3300014497 Ga0182008_10003813 Ga0182008_100038136 337
580 3300015261 Ga0182006_1002649 Ga0182006_10026493 337
581 3300015262 Ga0182007_10003708 Ga0182007_100037082 337
582 3300017792 Ga0163161_10066436 Ga0163161_100664362 337
583 3300025228 Ga0209672_101649 Ga0209672_1016496 337
584 3300025229 Ga0209147_100472 Ga0209147_10047210 337
585 3300025242 Ga0209258_100091 Ga0209258_100091190 337
586 3300025254 Ga0209148_1000033 Ga0209148_1000033294 337
587 3300025263 Ga0209565_1000020 Ga0209565_1000020208 337
588 3300025263 Ga0209565_1001505 Ga0209565_10015052 337
589 3300025273 Ga0209673_1000154 Ga0209673_100015418 337
590 3300025273 Ga0209673_1000350 Ga0209673_10003509 337
591 3300025284 Ga0209130_1000782 Ga0209130_100078217 337
592 3300025291 Ga0209675_1000014 Ga0209675_1000014197 337
593 3300025291 Ga0209675_1010718 Ga0209675_10107182 337
594 3300025292 Ga0209676_1000048 Ga0209676_100004829 337
595 3300025292 Ga0209676_1000433 Ga0209676_100043356 337
596 3300025294 Ga0209025_1012640 Ga0209025_10126406 337
597 3300025295 Ga0209564_1000103 Ga0209564_100010324 337
598 3300025298 Ga0209050_1000012 Ga0209050_100001229 337
599 3300025298 Ga0209050_1000511 Ga0209050_100051116 337
600 3300025299 Ga0209256_1000650 Ga0209256_100065030 337
601 3300025302 Ga0207426_1000161 Ga0207426_1000161144 337
602 3300025303 Ga0209051_1000273 Ga0209051_100027345 337
603 3300025303 Ga0209051_1000326 Ga0209051_100032649 337
604 3300025304 Ga0209257_1000249 Ga0209257_100024944 337
605 3300025304 Ga0209257_1002775 Ga0209257_10027759 337
606 3300025728 Ga0207655_1007062 Ga0207655_10070625 337
607 3300025903 Ga0207680_10033768 Ga0207680_100337682 337
608 3300025907 Ga0207645_10034688 Ga0207645_100346884 337
609 3300025913 Ga0207695_10111304 Ga0207695_101113042 337
610 3300025914 Ga0207671_10008666 Ga0207671_100086661 337
611 3300025914 Ga0207671_10183100 Ga0207671_101831002 337
612 3300025914 Ga0207671_10218062 Ga0207671_102180622 337
613 3300025921 Ga0207652_10049635 Ga0207652_100496352 337
614 3300025922 Ga0207646_10000722 Ga0207646_1000072225 337
615 3300025926 Ga0207659_10098242 Ga0207659_100982422 337
616 3300025931 Ga0207644_10029391 Ga0207644_100293912 337
617 3300025933 Ga0207706_10057340 Ga0207706_100573402 337
618 3300025933 Ga0207706_10322990 Ga0207706_103229902 337
619 3300025935 Ga0207709_10001312 Ga0207709_100013125 337
620 3300025937 Ga0207669_10109283 Ga0207669_101092832 337
621 3300025938 Ga0207704_10099163 Ga0207704_100991632 337
622 3300025938 Ga0207704_10198283 Ga0207704_101982831 337
623 3300025940 Ga0207691_10009883 Ga0207691_100098835 337
624 3300025942 Ga0207689_10165773 Ga0207689_101657732 337
625 3300025945 Ga0207679_10006620 Ga0207679_100066202 337
626 3300025960 Ga0207651_10181019 Ga0207651_101810192 337
627 3300025960 Ga0207651_10341546 Ga0207651_103415462 337
628 3300026023 Ga0207677_10038687 Ga0207677_100386871 337
629 3300026088 Ga0207641_10280663 Ga0207641_102806631 337
630 3300026089 Ga0207648_10080841 Ga0207648_100808414 337
631 3300026089 Ga0207648_10128690 Ga0207648_101286903 337
632 3300026089 Ga0207648_10203958 Ga0207648_102039582 337
633 3300026089 Ga0207648_10221002 Ga0207648_102210022 337
634 3300026116 Ga0207674_10016615 Ga0207674_100166154 337
635 3300026116 Ga0207674_10053553 Ga0207674_100535532 337
636 3300026116 Ga0207674_10090185 Ga0207674_100901852 337
637 3300026121 Ga0207683_10173876 Ga0207683_101738762 337
638 3300026121 Ga0207683_10288444 Ga0207683_102884442 337
639 3300026142 Ga0207698_10098874 Ga0207698_100988743 337
640 3300027866 Ga0209813_10028074 Ga0209813_100280742 337
641 3300028379 Ga0268266_10034410 Ga0268266_100344104 337
642 3300028381 Ga0268264_10021238 Ga0268264_100212386 337
643 3300028381 Ga0268264_10277364 Ga0268264_102773642 337
644 3300028786 Ga0307517_10009612 Ga0307517_100096128 337
645 3300028786 Ga0307517_10162746 Ga0307517_101627462 337
646 3300028794 Ga0307515_10000367 Ga0307515_1000036767 337
647 3300028794 Ga0307515_10006221 Ga0307515_100062216 337
648 3300028794 Ga0307515_10089497 Ga0307515_100894972 337
649 3300028794 Ga0307515_10146266 Ga0307515_101462661 337
650 3300030742 Ga0316183_1046813 Ga0316183_10468133 337
651 3300031456 Ga0307513_10174139 Ga0307513_101741392 337
652 3300031548 Ga0307408_100101016 Ga0307408_1001010163 337
653 3300031548 Ga0307408_100300404 Ga0307408_1003004042 337
654 3300031616 Ga0307508_10000041 Ga0307508_10000041117 337
655 3300031616 Ga0307508_10010688 Ga0307508_100106886 337
656 3300031649 Ga0307514_10006116 Ga0307514_100061168 337
657 3300031649 Ga0307514_10036313 Ga0307514_100363134 337
658 3300031852 Ga0307410_10135230 Ga0307410_101352302 337
659 3300031901 Ga0307406_10033190 Ga0307406_100331903 337
660 3300031903 Ga0307407_10267635 Ga0307407_102676352 337
661 3300031911 Ga0307412_10055103 Ga0307412_100551032 337
662 3300031911 Ga0307412_10079068 Ga0307412_100790683 337
663 3300032002 Ga0307416_100425603 Ga0307416_1004256031 337
664 3300032004 Ga0307414_10127449 Ga0307414_101274492 337
665 3300032004 Ga0307414_10325684 Ga0307414_103256842 337
666 3300032005 Ga0307411_10012599 Ga0307411_100125994 337
667 3300033180 Ga0307510_10015773 Ga0307510_100157735 337
668 3300033180 Ga0307510_10086046 Ga0307510_100860462 337
669 3300035112 Ga0373932_0021658 Ga0373932_0021658_473_1492 337
670 3300037471 Ga0395905_0000279 Ga0395905_0000279_9285_10322 337
671 3300037471 Ga0395905_0025964 Ga0395905_0025964_2330_3343 337
672 3300037471 Ga0395905_0094788 Ga0395905_0094788_1589_2623 337
673 3300041411 Ga0439466_0005209 Ga0439466_0005209_1787_2812 337
674 3300041999 Ga0439433_0017026 Ga0439433_0017026_248_1279 337
675 3300042007 Ga0439449_0000172 Ga0439449_0000172_314_1345 337
676 3300042123 Ga0450921_000615 Ga0450921_000615_204_1229 337
677 3300042184 Ga0450908_000944 Ga0450908_000944_3458_4483 337
678 3300042435 Ga0439434_0003820 Ga0439434_0003820_2407_3432 337
679 3300042435 Ga0439434_0005330 Ga0439434_0005330_1838_2860 337
680 3300042531 Ga0450918_005030 Ga0450918_005030_815_1840 337
681 3300044712 Ga0453684_0466244 Ga0453684_0466244_289_1359 337
682 3300045051 Ga0451576_0005927 Ga0451576_0005927_9630_10700 337
683 3300046457 Ga0495590_0046063 Ga0495590_0046063_138_1157 337
684 3300046460 Ga0495638_0025109 Ga0495638_0025109_1879_2895 337
685 3300046460 Ga0495638_0078466 Ga0495638_0078466_822_1835 337
686 3300046471 Ga0495650_0000011 Ga0495650_0000011_557171_558211 337
687 3300046491 Ga0495584_0009010 Ga0495584_0009010_3504_4517 337
688 3300046491 Ga0495584_0064163 Ga0495584_0064163_577_1593 337
689 3300046492 Ga0495585_0001878 Ga0495585_0001878_4544_5560 337
690 3300046501 Ga0495607_0010905 Ga0495607_0010905_3189_4202 337
691 3300046506 Ga0495583_0000549 Ga0495583_0000549_18808_19824 337
692 3300046506 Ga0495583_0006755 Ga0495583_0006755_2041_3054 337
693 3300046506 Ga0495583_0042590 Ga0495583_0042590_399_1415 337
694 3300046507 Ga0495606_0002140 Ga0495606_0002140_4411_5424 337
695 3300046512 Ga0495610_0040205 Ga0495610_0040205_936_1964 337
696 3300046513 Ga0495616_0001816 Ga0495616_0001816_8227_9243 337
697 3300046515 Ga0495620_0047852 Ga0495620_0047852_778_1797 337
698 3300046518 Ga0495631_0000752 Ga0495631_0000752_11005_12021 337
699 3300046518 Ga0495631_0000901 Ga0495631_0000901_9614_10642 337
700 3300046519 Ga0495632_0037620 Ga0495632_0037620_250_1269 337
701 3300046522 Ga0495643_0057541 Ga0495643_0057541_174_1190 337
702 3300046524 Ga0495648_0072704 Ga0495648_0072704_316_1332 337
703 3300046528 Ga0495642_0030467 Ga0495642_0030467_122_1135 337
704 3300046530 Ga0495654_0014744 Ga0495654_0014744_881_1909 337
705 3300046538 Ga0495609_0000054 Ga0495609_0000054_104042_105055 337
706 3300046539 Ga0495621_0003864 Ga0495621_0003864_1255_2271 337
707 3300046539 Ga0495621_0034720 Ga0495621_0034720_107_1126 337
708 3300046558 Ga0495633_0002572 Ga0495633_0002572_2913_3929 337
709 3300046615 Ga0495656_0000383 Ga0495656_0000383_4549_5568 337
710 3300046616 Ga0495668_0000458 Ga0495668_0000458_22046_23059 337
711 3300046616 Ga0495668_0014948 Ga0495668_0014948_833_1849 337
712 3300046616 Ga0495668_0020313 Ga0495668_0020313_2672_3685 337
713 3300046616 Ga0495668_0093881 Ga0495668_0093881_118_1146 337
714 3300046648 Ga0495611_0004982 Ga0495611_0004982_3911_4927 337
715 3300046660 Ga0495625_0001565 Ga0495625_0001565_19999_21024 337
716 3300046665 Ga0495661_0000603 Ga0495661_0000603_24517_25533 337
717 3300046683 Ga0495658_0109821 Ga0495658_0109821_247_1275 337
718 3300046684 Ga0495669_0010367 Ga0495669_0010367_2068_3081 337
719 3300046691 Ga0495670_0000525 Ga0495670_0000525_10982_11998 337
720 3300046692 Ga0495671_0093306 Ga0495671_0093306_359_1372 337
721 3300046694 Ga0495649_0001093 Ga0495649_0001093_14680_15699 337
722 3300046694 Ga0495649_0012427 Ga0495649_0012427_3543_4556 337
723 3300046694 Ga0495649_0099234 Ga0495649_0099234_245_1264 337
724 3300046810 Ga0495660_0005348 Ga0495660_0005348_6312_7331 337
725 3300047318 Ga0495636_0007366 Ga0495636_0007366_413_1426 337
726 3300047321 Ga0495676_0049869 Ga0495676_0049869_1262_2281 337
727 3300047321 Ga0495676_0094516 Ga0495676_0094516_901_1917 337
728 3300047443 Ga0495687_000272 Ga0495687_000272_13479_14498 337
729 3300047443 Ga0495687_021798 Ga0495687_021798_2007_3026 337
730 3300047445 Ga0495677_0005597 Ga0495677_0005597_2984_4000 337
731 3300047445 Ga0495677_0007304 Ga0495677_0007304_2662_3675 337
732 3300047446 Ga0495679_023319 Ga0495679_023319_984_1997 337
733 3300047470 Ga0495681_0001920 Ga0495681_0001920_11196_12212 337
734 3300047470 Ga0495681_0009981 Ga0495681_0009981_3107_4120 337
735 3300047472 Ga0495686_0000456 Ga0495686_0000456_43636_44652 337
736 3300047472 Ga0495686_0004521 Ga0495686_0004521_7191_8204 337
737 3300047673 Ga0495593_0057061 Ga0495593_0057061_582_1598 337
738 3300048091 Ga0495626_0032593 Ga0495626_0032593_1324_2343 337
739 3300048905 Ga0496102_0031313 Ga0496102_0031313_496_1512 337
740 3300048905 Ga0496102_0116504 Ga0496102_0116504_1424_2440 337
741 3300048906 Ga0496103_0252587 Ga0496103_0252587_34_1050 337
742 3300048920 Ga0496117_0007943 Ga0496117_0007943_53_1081 337
743 3300048921 Ga0496118_0035594 Ga0496118_0035594_79_1092 337
744 3300048926 Ga0496123_0066840 Ga0496123_0066840_1066_2082 337
745 3300048927 Ga0496124_0034024 Ga0496124_0034024_1918_2946 337
746 3300048927 Ga0496124_0043133 Ga0496124_0043133_2808_3821 337
747 3300048927 Ga0496124_0260797 Ga0496124_0260797_156_1175 337
748 3300048928 Ga0496125_0076280 Ga0496125_0076280_1493_2521 337
749 3300048928 Ga0496125_0084519 Ga0496125_0084519_28_1041 337
750 3300049537 Ga0501321_001463 Ga0501321_001463_369_1403 337
751 3300049759 Ga0501262_001309 Ga0501262_001309_1136_2149 337
752 3300050490 nmdc:mga03n38_23386_c1 nmdc:mga03n38_23386_c1_345_1358 337
753 3300050490 nmdc:mga03n38_9776_c1 nmdc:mga03n38_9776_c1_1707_2732 337
754 3300050492 nmdc:mga0yw44_11476_c1 nmdc:mga0yw44_11476_c1_1385_2398 337
755 3300050493 nmdc:mga0k408_2239_c1 nmdc:mga0k408_2239_c1_8317_9336 337
756 3300050493 nmdc:mga0k408_26694_c1 nmdc:mga0k408_26694_c1_414_1433 337
757 3300050493 nmdc:mga0k408_3111_c1 nmdc:mga0k408_3111_c1_6870_7889 337
758 3300050493 nmdc:mga0k408_43050_c1 nmdc:mga0k408_43050_c1_1546_2565 337
759 3300050493 nmdc:mga0k408_51645_c1 nmdc:mga0k408_51645_c1_647_1660 337
760 3300050494 nmdc:mga06z11_165112_c1 nmdc:mga06z11_165112_c1_79_1098 337
761 3300050494 nmdc:mga06z11_82589_c1 nmdc:mga06z11_82589_c1_492_1517 337
762 3300050496 nmdc:mga07m45_16459_c1 nmdc:mga07m45_16459_c1_1613_2632 337
763 3300050496 nmdc:mga07m45_17988_c1 nmdc:mga07m45_17988_c1_1488_2507 337
764 3300050496 nmdc:mga07m45_252_c1 nmdc:mga07m45_252_c1_6996_8015 337
765 3300050496 nmdc:mga07m45_3121_c1 nmdc:mga07m45_3121_c1_299_1315 337
766 3300050496 nmdc:mga07m45_67744_c1 nmdc:mga07m45_67744_c1_328_1347 337
767 3300050507 nmdc:mga05p37_112973_c1 nmdc:mga05p37_112973_c1_1107_2123 337
768 3300050508 nmdc:mga09592_1120_c1 nmdc:mga09592_1120_c1_10782_11804 337
769 3300053093 Ga0500651_0000082 Ga0500651_0000082_34929_35957 337
770 3300053110 Ga0500571_000152 Ga0500571_000152_7705_8721 337
771 3300053116 Ga0500592_006756 Ga0500592_006756_81_1109 337
772 3300053118 Ga0500594_0001035 Ga0500594_0001035_1886_2914 337
773 3300053120 Ga0500597_053624 Ga0500597_053624_149_1177 337
774 3300053125 Ga0500618_000085 Ga0500618_000085_48689_49702 337
775 3300053131 Ga0500652_062342 Ga0500652_062342_494_1513 337
776 3300053133 Ga0500655_001890 Ga0500655_001890_1965_2981 337
777 3300053134 Ga0500658_0001380 Ga0500658_0001380_4896_5924 337
778 3300053134 Ga0500658_0001412 Ga0500658_0001412_4404_5432 337
779 3300053134 Ga0500658_0002901 Ga0500658_0002901_2143_3162 337
780 3300053138 Ga0500564_012785 Ga0500564_012785_1654_2670 337
781 3300053139 Ga0500568_0002320 Ga0500568_0002320_2172_3200 337
782 3300053141 Ga0500574_000300 Ga0500574_000300_1940_2968 337
783 3300053161 Ga0500634_0051321 Ga0500634_0051321_1009_2037 337
784 3300053162 Ga0500638_000234 Ga0500638_000234_7359_8375 337
785 3300053177 Ga0500636_0030537 Ga0500636_0030537_1050_2066 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08546

ApbA_C

Ketopantoate reductase PanE/ApbA C terminal

199

321

0.96

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

3

108

0.93

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

105

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ghy-assembly3.cif.gz_A crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 0.975 2 322
7fgp-assembly1.cif.gz_A crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9687 1 28
3ghy-assembly3.cif.gz_B crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 0.9661 3 324
3ka7-assembly1.cif.gz_A crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 0.9546 1 28
3ghy-assembly3.cif.gz_A crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 0.9512 2 322
ID Description Score Start End Superfamily
af_P75728_4_256_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9834 2 29 3.50.50.60
3ghyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9659 3 196 3.40.50.720
3ghyA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9607 199 322 1.10.1040.10
3ghyB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9522 199 324 1.10.1040.10
af_Q2FZ31_2_179_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9462 2 27 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A4Q3Q9L1-F1-model_v4 deleted 0.9943 185 335
AF-A0A435EZ16-F1-model_v4 deleted 0.9929 212 323
AF-A0A4S1FUP0-F1-model_v4 Oxidoreductase 0.9928 215 312 GO:0005737
AF-A0A7K0JYB5-F1-model_v4 deleted 0.9897 161 326
AF-A0A3S1HP38-F1-model_v4 2-dehydropantoate 2-reductase 0.9891 145 323 GO:0005737

Feature Viewer

pLDDT pTM Quality
95.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map