F480728
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 785 | 411 | 743 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100023491|Ga0070663_1000234911 |
| Length | 339 |
| Sequence | MKVAIIGAGAIGGYVGVKLALAGEDVTFIVRGANLTAIRQRGMKLIMADGSEHVARNVRATNDYAEAGPQDVVILAMKAHQVEAVARDVPKLFGPDTAVVTMQNGIPYWYFHKHGGPGREGTRVNSVDPTGIVGECIPAERVIGCVVYPASELIAPGVVKHIEGERFPVGELDGSASERVNRISAVFTNAGFKAPVLDNIRAEIWLKLWGNLTFNPISSLTHSTLVDICQYPLTRELAAAMMREAQAVANKLGIEFRIPLDKRIAGAEKVGKHKTSMLQDIEAGRAPEIDALVGTVVELGRLTDTPTPHIDTVYALVKLLGKNIDEQRGQVRLLELAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 8 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 9 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 10 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 11 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 12 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 13 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 14 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 15 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 16 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 17 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 18 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 19 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 20 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 21 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 22 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 23 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 24 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 25 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 26 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 27 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 28 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 29 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 30 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 31 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 32 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 33 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 34 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 35 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 36 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 37 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 38 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 39 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 40 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 41 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 42 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 43 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 44 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 45 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 46 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 47 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 50 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 51 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 52 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 53 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 54 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 55 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 65 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 68 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 69 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 75 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 77 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 115 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 116 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 117 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 118 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 119 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 129 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 160 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 161 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 227 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 228 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 229 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 230 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 231 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 232 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 233 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 234 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 250 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 251 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 252 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 259 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 262 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 263 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 264 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 265 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 266 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 267 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 268 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 269 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 270 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 271 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 272 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 273 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 274 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 275 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 276 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 279 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 284 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 285 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 383 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 385 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 386 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 387 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 390 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 392 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 394 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 395 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 397 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 402 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 404 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 406 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 408 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 409 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.14 |
| Metatranscriptomes | 0.51 |
| Isolates | 5.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.06 |
| Nodule | 0.25 |
| Rhizoplane | 2.04 |
| Rhizosphere | 64.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10032351 | 3300001979 | Bacteria | 1673 |
| 2 | JGI25158J39367_1006071 | 3300002739 | Bacteria | 1747 |
| 3 | JGI25152J39213_1002250 | 3300002773 | Bacteria | 7463 |
| 4 | JGI25152J39213_1004246 | 3300002773 | Bacteria | 4584 |
| 5 | JGI25159J45721_1002244 | 3300002987 | Bacteria | 7463 |
| 6 | JGI25151J46595_10001379 | 3300003187 | Bacteria | 16767 |
| 7 | JGI25151J46595_10004400 | 3300003187 | Bacteria | 7463 |
| 8 | JGI25151J46595_10010447 | 3300003187 | Bacteria | 4315 |
| 9 | JGI25153J46596_10004540 | 3300003215 | Bacteria | 7463 |
| 10 | rootL2_10012652 | 3300003322 | Bacteria | 5153 |
| 11 | JGI25160J50197_1002233 | 3300003354 | Bacteria | 9095 |
| 12 | JGI25161J50226_1005453 | 3300003374 | Bacteria | 2460 |
| 13 | Ga0007410J51695_1034327 | 3300003574 | Bacteria | 1215 |
| 14 | Ga0007429J51699_1050987 | 3300003579 | Bacteria | 1424 |
| 15 | Ga0032354_1019303 | 3300003693 | Bacteria | 1513 |
| 16 | Ga0055535_1000378 | 3300003761 | Bacteria | 42270 |
| 17 | Ga0055542_1000036 | 3300003762 | Bacteria | 227346 |
| 18 | Ga0055526_1005065 | 3300003771 | Bacteria | 7693 |
| 19 | Ga0055526_1005307 | 3300003771 | Bacteria | 7463 |
| 20 | Ga0055537_1000541 | 3300003773 | Bacteria | 21788 |
| 21 | Ga0055537_1001916 | 3300003773 | Bacteria | 7463 |
| 22 | Ga0055537_1003257 | 3300003773 | Bacteria | 5055 |
| 23 | Ga0055524_1003426 | 3300003775 | Bacteria | 7699 |
| 24 | Ga0055524_1003604 | 3300003775 | Bacteria | 7463 |
| 25 | Ga0055536_1001912 | 3300003781 | Bacteria | 12075 |
| 26 | Ga0055536_1007703 | 3300003781 | Bacteria | 4769 |
| 27 | Ga0055536_1008036 | 3300003781 | Bacteria | 4611 |
| 28 | Ga0055534_1000491 | 3300003784 | Bacteria | 21788 |
| 29 | Ga0055534_1001989 | 3300003784 | Bacteria | 7463 |
| 30 | Ga0055534_1012575 | 3300003784 | Bacteria | 1666 |
| 31 | Ga0055528_1000927 | 3300003790 | Bacteria | 19592 |
| 32 | Ga0055528_1003783 | 3300003790 | Bacteria | 7463 |
| 33 | Ga0055528_1006976 | 3300003790 | Bacteria | 5055 |
| 34 | Ga0055530_10001000 | 3300003791 | Bacteria | 22575 |
| 35 | Ga0055530_10005427 | 3300003791 | Bacteria | 6067 |
| 36 | Ga0055540_1002459 | 3300003792 | Bacteria | 9752 |
| 37 | Ga0055540_1004132 | 3300003792 | Bacteria | 6709 |
| 38 | Ga0055540_1004268 | 3300003792 | Bacteria | 6539 |
| 39 | Ga0055540_1019857 | 3300003792 | Bacteria | 1797 |
| 40 | Ga0055531_10001511 | 3300003794 | Bacteria | 17074 |
| 41 | Ga0055531_10001971 | 3300003794 | Bacteria | 14315 |
| 42 | Ga0055531_10004950 | 3300003794 | Bacteria | 7915 |
| 43 | Ga0055531_10005440 | 3300003794 | Bacteria | 7455 |
| 44 | Ga0055543_1000596 | 3300004625 | Bacteria | 19728 |
| 45 | Ga0055543_1006181 | 3300004625 | Bacteria | 2935 |
| 46 | Ga0065165_1003176 | 3300005262 | Bacteria | 12037 |
| 47 | Ga0065707_10083176 | 3300005295 | Bacteria | 10109 |
| 48 | Ga0070658_10060413 | 3300005327 | Bacteria | 3087 |
| 49 | Ga0070676_10004778 | 3300005328 | Bacteria | 7162 |
| 50 | Ga0070676_10044472 | 3300005328 | Bacteria | 2584 |
| 51 | Ga0070676_10062637 | 3300005328 | Bacteria | 2214 |
| 52 | Ga0070690_100011917 | 3300005330 | Bacteria | 5104 |
| 53 | Ga0070670_100016983 | 3300005331 | Bacteria | 6249 |
| 54 | Ga0070670_100088047 | 3300005331 | Bacteria | 2669 |
| 55 | Ga0070670_100095830 | 3300005331 | Bacteria | 2552 |
| 56 | Ga0070670_100319766 | 3300005331 | Bacteria | 1359 |
| 57 | Ga0070677_10006815 | 3300005333 | Bacteria | 3796 |
| 58 | Ga0068869_100173081 | 3300005334 | Bacteria | 1688 |
| 59 | Ga0070666_10001802 | 3300005335 | Bacteria | 13044 |
| 60 | Ga0070666_10023526 | 3300005335 | Bacteria | 4011 |
| 61 | Ga0070666_10041292 | 3300005335 | Bacteria | 3082 |
| 62 | Ga0070666_10148399 | 3300005335 | Bacteria | 1635 |
| 63 | Ga0068868_100000766 | 3300005338 | Bacteria | 21697 |
| 64 | Ga0068868_100060809 | 3300005338 | Bacteria | 2992 |
| 65 | Ga0068868_100106082 | 3300005338 | Bacteria | 2279 |
| 66 | Ga0068868_100234213 | 3300005338 | Bacteria | 1541 |
| 67 | Ga0070689_100005140 | 3300005340 | Bacteria | 8899 |
| 68 | Ga0070668_100003200 | 3300005347 | Bacteria | 12063 |
| 69 | Ga0070668_100005640 | 3300005347 | Bacteria | 9280 |
| 70 | Ga0070668_100041642 | 3300005347 | Bacteria | 3519 |
| 71 | Ga0070668_100319710 | 3300005347 | Bacteria | 1306 |
| 72 | Ga0070675_100000445 | 3300005354 | Bacteria | 28157 |
| 73 | Ga0070675_100001023 | 3300005354 | Bacteria | 20128 |
| 74 | Ga0070675_100015016 | 3300005354 | Bacteria | 6116 |
| 75 | Ga0070675_100044798 | 3300005354 | Bacteria | 3618 |
| 76 | Ga0070675_100261225 | 3300005354 | Bacteria | 1517 |
| 77 | Ga0070671_100000187 | 3300005355 | Bacteria | 41664 |
| 78 | Ga0070671_100009551 | 3300005355 | Bacteria | 7792 |
| 79 | Ga0070671_100048597 | 3300005355 | Bacteria | 3528 |
| 80 | Ga0070674_100146204 | 3300005356 | Bacteria | 1779 |
| 81 | Ga0070674_100174012 | 3300005356 | Bacteria | 1644 |
| 82 | Ga0070673_100001644 | 3300005364 | Bacteria | 13244 |
| 83 | Ga0070673_100127277 | 3300005364 | Bacteria | 2133 |
| 84 | Ga0070673_100137682 | 3300005364 | Bacteria | 2057 |
| 85 | Ga0070673_100160896 | 3300005364 | Bacteria | 1909 |
| 86 | Ga0070688_100025652 | 3300005365 | Bacteria | 3492 |
| 87 | Ga0070667_100001048 | 3300005367 | Bacteria | 25219 |
| 88 | Ga0070667_100002039 | 3300005367 | Bacteria | 17908 |
| 89 | Ga0070667_100043191 | 3300005367 | Bacteria | 3783 |
| 90 | Ga0070667_100087323 | 3300005367 | Bacteria | 2677 |
| 91 | Ga0070667_100095454 | 3300005367 | Bacteria | 2564 |
| 92 | Ga0070667_100100367 | 3300005367 | Bacteria | 2500 |
| 93 | Ga0070708_100009421 | 3300005445 | Bacteria | 7874 |
| 94 | Ga0070663_100003597 | 3300005455 | Bacteria | 8952 |
| 95 | Ga0070663_100023491 | 3300005455 | Bacteria | 4134 |
| 96 | Ga0070663_100063435 | 3300005455 | Bacteria | 2668 |
| 97 | Ga0070678_100000859 | 3300005456 | Bacteria | 15492 |
| 98 | Ga0070678_100001085 | 3300005456 | Bacteria | 14246 |
| 99 | Ga0070678_100044459 | 3300005456 | Bacteria | 3172 |
| 100 | Ga0070678_100057815 | 3300005456 | Bacteria | 2843 |
| 101 | Ga0070662_100005652 | 3300005457 | Bacteria | 7999 |
| 102 | Ga0070662_100303388 | 3300005457 | Bacteria | 1298 |
| 103 | Ga0070662_100346747 | 3300005457 | Bacteria | 1216 |
| 104 | Ga0070681_10014476 | 3300005458 | Bacteria | 7849 |
| 105 | Ga0070681_10363987 | 3300005458 | Bacteria | 1356 |
| 106 | Ga0068867_100001358 | 3300005459 | Bacteria | 16910 |
| 107 | Ga0068867_100138994 | 3300005459 | Bacteria | 1897 |
| 108 | Ga0070685_10075129 | 3300005466 | Bacteria | 2012 |
| 109 | Ga0070706_100142410 | 3300005467 | Bacteria | 2238 |
| 110 | Ga0070707_100002457 | 3300005468 | Bacteria | 17652 |
| 111 | Ga0070698_100127696 | 3300005471 | Bacteria | 2499 |
| 112 | Ga0070699_100017017 | 3300005518 | Bacteria | 6243 |
| 113 | Ga0070679_100077751 | 3300005530 | Bacteria | 3308 |
| 114 | Ga0068853_100018520 | 3300005539 | Bacteria | 5765 |
| 115 | Ga0068853_100037871 | 3300005539 | Bacteria | 4106 |
| 116 | Ga0068853_100073389 | 3300005539 | Bacteria | 2983 |
| 117 | Ga0070672_100003076 | 3300005543 | Bacteria | 10761 |
| 118 | Ga0070672_100011595 | 3300005543 | Bacteria | 6150 |
| 119 | Ga0070672_100021295 | 3300005543 | Bacteria | 4742 |
| 120 | Ga0070672_100067320 | 3300005543 | Bacteria | 2838 |
| 121 | Ga0070665_100007846 | 3300005548 | Bacteria | 10827 |
| 122 | Ga0070665_100050614 | 3300005548 | Bacteria | 4168 |
| 123 | Ga0070665_100070637 | 3300005548 | Bacteria | 3498 |
| 124 | Ga0070665_100252815 | 3300005548 | Bacteria | 1763 |
| 125 | Ga0070664_100007153 | 3300005564 | Bacteria | 8997 |
| 126 | Ga0068857_100032041 | 3300005577 | Bacteria | 4646 |
| 127 | Ga0068857_100195744 | 3300005577 | Bacteria | 1842 |
| 128 | Ga0068854_100187108 | 3300005578 | Bacteria | 1621 |
| 129 | Ga0068852_100124830 | 3300005616 | Bacteria | 2362 |
| 130 | Ga0068852_100126387 | 3300005616 | Bacteria | 2349 |
| 131 | Ga0068859_100001853 | 3300005617 | Bacteria | 21493 |
| 132 | Ga0068864_100000330 | 3300005618 | Bacteria | 41727 |
| 133 | Ga0068864_100029596 | 3300005618 | Bacteria | 4639 |
| 134 | Ga0068866_10132879 | 3300005718 | Bacteria | 1418 |
| 135 | Ga0068861_100002134 | 3300005719 | Bacteria | 12795 |
| 136 | Ga0068851_10019323 | 3300005834 | Bacteria | 3292 |
| 137 | Ga0068851_10022194 | 3300005834 | Bacteria | 3088 |
| 138 | Ga0068851_10039796 | 3300005834 | Bacteria | 2361 |
| 139 | Ga0068863_100000715 | 3300005841 | Bacteria | 33387 |
| 140 | Ga0068863_100013924 | 3300005841 | Bacteria | 7754 |
| 141 | Ga0068863_100111901 | 3300005841 | Bacteria | 2600 |
| 142 | Ga0068858_100000900 | 3300005842 | Bacteria | 30822 |
| 143 | Ga0068860_100018974 | 3300005843 | Bacteria | 6680 |
| 144 | Ga0068860_100019618 | 3300005843 | Bacteria | 6557 |
| 145 | Ga0068860_100151032 | 3300005843 | Bacteria | 2237 |
| 146 | Ga0068860_100175711 | 3300005843 | Bacteria | 2070 |
| 147 | Ga0068862_100044774 | 3300005844 | Bacteria | 3775 |
| 148 | Ga0068862_100201760 | 3300005844 | Bacteria | 1794 |
| 149 | Ga0070717_10258504 | 3300006028 | Bacteria | 1540 |
| 150 | Ga0075365_10006589 | 3300006038 | Bacteria | 6407 |
| 151 | Ga0075368_10037677 | 3300006042 | Bacteria | 1892 |
| 152 | Ga0075363_100012444 | 3300006048 | Bacteria | 4102 |
| 153 | Ga0075363_100017985 | 3300006048 | Bacteria | 3514 |
| 154 | Ga0075364_10032617 | 3300006051 | Bacteria | 3349 |
| 155 | Ga0075364_10216939 | 3300006051 | Bacteria | 1298 |
| 156 | Ga0075362_10007235 | 3300006177 | Bacteria | 4189 |
| 157 | Ga0075362_10045271 | 3300006177 | Bacteria | 1954 |
| 158 | Ga0075367_10003595 | 3300006178 | Bacteria | 7424 |
| 159 | Ga0075369_10042042 | 3300006186 | Bacteria | 1958 |
| 160 | Ga0075369_10055625 | 3300006186 | Bacteria | 1719 |
| 161 | Ga0075366_10001162 | 3300006195 | Bacteria | 13025 |
| 162 | Ga0075366_10025893 | 3300006195 | Bacteria | 3431 |
| 163 | Ga0075366_10037194 | 3300006195 | Bacteria | 2872 |
| 164 | Ga0075366_10042135 | 3300006195 | Bacteria | 2702 |
| 165 | Ga0075366_10107728 | 3300006195 | Bacteria | 1675 |
| 166 | Ga0075366_10127915 | 3300006195 | Bacteria | 1532 |
| 167 | Ga0075366_10147607 | 3300006195 | Bacteria | 1423 |
| 168 | Ga0097621_100157134 | 3300006237 | Bacteria | 1952 |
| 169 | Ga0075370_10000374 | 3300006353 | Bacteria | 16453 |
| 170 | Ga0075370_10001858 | 3300006353 | Bacteria | 9458 |
| 171 | Ga0075370_10001917 | 3300006353 | Bacteria | 9366 |
| 172 | Ga0075370_10011949 | 3300006353 | Bacteria | 4575 |
| 173 | Ga0075370_10016711 | 3300006353 | Bacteria | 3951 |
| 174 | Ga0075370_10039180 | 3300006353 | Bacteria | 2669 |
| 175 | Ga0075370_10124972 | 3300006353 | Bacteria | 1499 |
| 176 | Ga0068871_100008254 | 3300006358 | Bacteria | 7487 |
| 177 | Ga0068871_100128775 | 3300006358 | Bacteria | 2144 |
| 178 | Ga0075429_100002916 | 3300006880 | Bacteria | 14508 |
| 179 | Ga0068865_100004245 | 3300006881 | Bacteria | 8643 |
| 180 | Ga0068865_100159390 | 3300006881 | Bacteria | 1720 |
| 181 | Ga0097620_100001853 | 3300006931 | Bacteria | 21493 |
| 182 | Ga0099826_10001740 | 3300006948 | Bacteria | 13438 |
| 183 | Ga0105240_10009145 | 3300009093 | Bacteria | 14061 |
| 184 | Ga0105240_10012540 | 3300009093 | Bacteria | 11693 |
| 185 | Ga0105240_10039983 | 3300009093 | Bacteria | 6004 |
| 186 | Ga0111539_10467961 | 3300009094 | Bacteria | 1468 |
| 187 | Ga0105245_10194377 | 3300009098 | Bacteria | 1945 |
| 188 | Ga0114129_10071266 | 3300009147 | Bacteria | 4846 |
| 189 | Ga0105243_10061249 | 3300009148 | Bacteria | 3009 |
| 190 | Ga0105243_10072545 | 3300009148 | Bacteria | 2787 |
| 191 | Ga0105243_10122564 | 3300009148 | Bacteria | 2194 |
| 192 | Ga0105243_10149034 | 3300009148 | Bacteria | 2005 |
| 193 | Ga0105241_10035684 | 3300009174 | Bacteria | 3740 |
| 194 | Ga0105242_10219050 | 3300009176 | Bacteria | 1700 |
| 195 | Ga0105242_10226583 | 3300009176 | Bacteria | 1673 |
| 196 | Ga0105242_10228964 | 3300009176 | Bacteria | 1665 |
| 197 | Ga0105248_10004935 | 3300009177 | Bacteria | 14737 |
| 198 | Ga0105248_10797089 | 3300009177 | Bacteria | 1066 |
| 199 | Ga0105237_10000407 | 3300009545 | Bacteria | 61234 |
| 200 | Ga0105237_10009701 | 3300009545 | Bacteria | 10299 |
| 201 | Ga0105237_10155780 | 3300009545 | Bacteria | 2281 |
| 202 | Ga0105238_10005854 | 3300009551 | Bacteria | 12178 |
| 203 | Ga0105249_10075911 | 3300009553 | Bacteria | 3113 |
| 204 | Ga0105249_10581861 | 3300009553 | Bacteria | 1173 |
| 205 | Ga0105239_10000335 | 3300010375 | Bacteria | 68810 |
| 206 | Ga0105239_10043224 | 3300010375 | Bacteria | 4938 |
| 207 | Ga0105239_10446611 | 3300010375 | Bacteria | 1467 |
| 208 | Ga0105246_10071797 | 3300011119 | Bacteria | 2438 |
| 209 | Ga0157373_10026668 | 3300013100 | Bacteria | 4171 |
| 210 | Ga0157370_10001435 | 3300013104 | Bacteria | 29541 |
| 211 | Ga0157370_10009310 | 3300013104 | Bacteria | 10518 |
| 212 | Ga0157370_10293098 | 3300013104 | Bacteria | 1503 |
| 213 | Ga0157374_10006819 | 3300013296 | Bacteria | 9715 |
| 214 | Ga0157374_10167418 | 3300013296 | Bacteria | 2143 |
| 215 | Ga0157378_10012819 | 3300013297 | Bacteria | 7337 |
| 216 | Ga0163162_10004795 | 3300013306 | Bacteria | 13049 |
| 217 | Ga0163162_10256948 | 3300013306 | Bacteria | 1879 |
| 218 | Ga0157372_10038299 | 3300013307 | Bacteria | 5291 |
| 219 | Ga0157375_10005097 | 3300013308 | Bacteria | 11399 |
| 220 | Ga0157375_10005292 | 3300013308 | Bacteria | 11206 |
| 221 | Ga0157375_10094435 | 3300013308 | Bacteria | 3060 |
| 222 | Ga0157375_10126822 | 3300013308 | Bacteria | 2668 |
| 223 | Ga0157375_10221040 | 3300013308 | Bacteria | 2052 |
| 224 | Ga0163163_10000980 | 3300014325 | Bacteria | 24230 |
| 225 | Ga0163163_10104763 | 3300014325 | Bacteria | 2854 |
| 226 | Ga0163163_10187418 | 3300014325 | Bacteria | 2116 |
| 227 | Ga0157380_10065616 | 3300014326 | Bacteria | 2918 |
| 228 | Ga0157380_10109763 | 3300014326 | Bacteria | 2315 |
| 229 | Ga0157380_10187607 | 3300014326 | Bacteria | 1822 |
| 230 | Ga0182008_10003813 | 3300014497 | Bacteria | 8960 |
| 231 | Ga0182008_10035285 | 3300014497 | Bacteria | 2506 |
| 232 | Ga0157377_10209602 | 3300014745 | Bacteria | 1242 |
| 233 | Ga0157379_10006787 | 3300014968 | Bacteria | 9896 |
| 234 | Ga0157376_10038215 | 3300014969 | Bacteria | 3904 |
| 235 | Ga0157376_10069577 | 3300014969 | Bacteria | 2984 |
| 236 | Ga0157376_10213687 | 3300014969 | Bacteria | 1782 |
| 237 | Ga0157376_10612282 | 3300014969 | Bacteria | 1085 |
| 238 | Ga0182006_1002649 | 3300015261 | Bacteria | 9641 |
| 239 | Ga0182007_10003708 | 3300015262 | Bacteria | 7142 |
| 240 | Ga0182007_10006550 | 3300015262 | Bacteria | 4991 |
| 241 | Ga0182005_1000279 | 3300015265 | Bacteria | 32226 |
| 242 | Ga0163161_10003484 | 3300017792 | Bacteria | 11032 |
| 243 | Ga0163161_10015558 | 3300017792 | Bacteria | 5305 |
| 244 | Ga0163161_10066436 | 3300017792 | Bacteria | 2633 |
| 245 | Ga0163161_10091611 | 3300017792 | Bacteria | 2250 |
| 246 | Ga0213872_10008485 | 3300021361 | Bacteria | 4972 |
| 247 | Ga0213875_10002672 | 3300021388 | Bacteria | 10520 |
| 248 | Ga0209436_102895 | 3300025208 | Bacteria | 4839 |
| 249 | Ga0209672_101649 | 3300025228 | Bacteria | 7301 |
| 250 | Ga0209147_100472 | 3300025229 | Bacteria | 24613 |
| 251 | Ga0209258_100091 | 3300025242 | Bacteria | 227454 |
| 252 | Ga0207425_1000190 | 3300025245 | Bacteria | 49963 |
| 253 | Ga0207425_1002381 | 3300025245 | Bacteria | 6667 |
| 254 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 255 | Ga0209129_1000091 | 3300025258 | Bacteria | 175716 |
| 256 | Ga0209129_1002201 | 3300025258 | Bacteria | 9795 |
| 257 | Ga0209129_1007264 | 3300025258 | Bacteria | 3340 |
| 258 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 259 | Ga0209565_1000335 | 3300025263 | Bacteria | 41834 |
| 260 | Ga0209565_1001505 | 3300025263 | Bacteria | 10158 |
| 261 | Ga0209673_1000154 | 3300025273 | Bacteria | 146394 |
| 262 | Ga0209673_1000350 | 3300025273 | Bacteria | 84527 |
| 263 | Ga0209673_1002703 | 3300025273 | Bacteria | 11764 |
| 264 | Ga0209130_1000140 | 3300025284 | Bacteria | 115434 |
| 265 | Ga0209130_1000782 | 3300025284 | Bacteria | 27407 |
| 266 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 267 | Ga0209675_1000659 | 3300025291 | Bacteria | 24288 |
| 268 | Ga0209675_1010718 | 3300025291 | Bacteria | 3104 |
| 269 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 270 | Ga0209676_1000433 | 3300025292 | Bacteria | 72480 |
| 271 | Ga0209025_1000207 | 3300025294 | Bacteria | 140774 |
| 272 | Ga0209025_1000286 | 3300025294 | Bacteria | 114096 |
| 273 | Ga0209025_1000356 | 3300025294 | Bacteria | 98547 |
| 274 | Ga0209025_1012640 | 3300025294 | Bacteria | 5391 |
| 275 | Ga0209564_1000103 | 3300025295 | Bacteria | 221166 |
| 276 | Ga0209564_1000597 | 3300025295 | Bacteria | 56580 |
| 277 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 278 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 279 | Ga0209050_1000511 | 3300025298 | Bacteria | 65746 |
| 280 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 281 | Ga0209256_1000650 | 3300025299 | Bacteria | 47330 |
| 282 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 283 | Ga0207426_1000161 | 3300025302 | Bacteria | 172765 |
| 284 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 285 | Ga0209051_1000273 | 3300025303 | Bacteria | 84847 |
| 286 | Ga0209051_1000326 | 3300025303 | Bacteria | 71572 |
| 287 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 288 | Ga0209257_1000249 | 3300025304 | Bacteria | 124522 |
| 289 | Ga0209257_1002775 | 3300025304 | Bacteria | 16544 |
| 290 | Ga0209257_1005208 | 3300025304 | Bacteria | 9327 |
| 291 | Ga0207656_10014325 | 3300025321 | Bacteria | 3052 |
| 292 | Ga0207655_1007062 | 3300025728 | Bacteria | 7347 |
| 293 | Ga0207682_10002412 | 3300025893 | Bacteria | 8416 |
| 294 | Ga0207680_10000940 | 3300025903 | Bacteria | 13755 |
| 295 | Ga0207680_10017960 | 3300025903 | Bacteria | 3747 |
| 296 | Ga0207680_10033768 | 3300025903 | Bacteria | 2922 |
| 297 | Ga0207645_10000912 | 3300025907 | Bacteria | 24531 |
| 298 | Ga0207645_10034688 | 3300025907 | Bacteria | 3241 |
| 299 | Ga0207707_10018330 | 3300025912 | Bacteria | 6101 |
| 300 | Ga0207695_10007295 | 3300025913 | Bacteria | 14117 |
| 301 | Ga0207695_10111304 | 3300025913 | Bacteria | 2717 |
| 302 | Ga0207671_10008666 | 3300025914 | Bacteria | 8587 |
| 303 | Ga0207671_10183100 | 3300025914 | Bacteria | 1631 |
| 304 | Ga0207671_10218062 | 3300025914 | Bacteria | 1494 |
| 305 | Ga0207652_10049635 | 3300025921 | Bacteria | 3593 |
| 306 | Ga0207646_10000722 | 3300025922 | Bacteria | 42791 |
| 307 | Ga0207681_10054037 | 3300025923 | Bacteria | 2729 |
| 308 | Ga0207681_10118906 | 3300025923 | Bacteria | 1935 |
| 309 | Ga0207694_10063832 | 3300025924 | Bacteria | 2869 |
| 310 | Ga0207650_10033963 | 3300025925 | Bacteria | 3698 |
| 311 | Ga0207650_10200291 | 3300025925 | Bacteria | 1599 |
| 312 | Ga0207659_10000484 | 3300025926 | Bacteria | 23967 |
| 313 | Ga0207659_10024192 | 3300025926 | Bacteria | 4066 |
| 314 | Ga0207659_10098242 | 3300025926 | Bacteria | 2201 |
| 315 | Ga0207687_10090908 | 3300025927 | Bacteria | 2225 |
| 316 | Ga0207644_10000525 | 3300025931 | Bacteria | 24823 |
| 317 | Ga0207644_10029391 | 3300025931 | Bacteria | 3813 |
| 318 | Ga0207706_10057340 | 3300025933 | Bacteria | 3431 |
| 319 | Ga0207706_10322990 | 3300025933 | Bacteria | 1343 |
| 320 | Ga0207706_10333136 | 3300025933 | Bacteria | 1320 |
| 321 | Ga0207709_10001312 | 3300025935 | Bacteria | 17674 |
| 322 | Ga0207709_10013032 | 3300025935 | Bacteria | 4584 |
| 323 | Ga0207709_10072135 | 3300025935 | Bacteria | 2195 |
| 324 | Ga0207709_10144105 | 3300025935 | Bacteria | 1641 |
| 325 | Ga0207670_10015558 | 3300025936 | Bacteria | 4549 |
| 326 | Ga0207669_10109283 | 3300025937 | Bacteria | 1849 |
| 327 | Ga0207704_10010234 | 3300025938 | Bacteria | 4564 |
| 328 | Ga0207704_10063942 | 3300025938 | Bacteria | 2296 |
| 329 | Ga0207704_10099163 | 3300025938 | Bacteria | 1937 |
| 330 | Ga0207704_10198283 | 3300025938 | Bacteria | 1467 |
| 331 | Ga0207691_10000342 | 3300025940 | Bacteria | 46924 |
| 332 | Ga0207691_10009883 | 3300025940 | Bacteria | 9160 |
| 333 | Ga0207691_10046682 | 3300025940 | Bacteria | 3978 |
| 334 | Ga0207691_10051006 | 3300025940 | Bacteria | 3785 |
| 335 | Ga0207691_10086083 | 3300025940 | Bacteria | 2820 |
| 336 | Ga0207711_10001399 | 3300025941 | Bacteria | 22639 |
| 337 | Ga0207711_10077529 | 3300025941 | Bacteria | 2897 |
| 338 | Ga0207689_10103093 | 3300025942 | Bacteria | 2344 |
| 339 | Ga0207689_10165773 | 3300025942 | Bacteria | 1820 |
| 340 | Ga0207679_10006620 | 3300025945 | Bacteria | 7332 |
| 341 | Ga0207651_10082645 | 3300025960 | Bacteria | 2319 |
| 342 | Ga0207651_10181019 | 3300025960 | Bacteria | 1672 |
| 343 | Ga0207651_10341546 | 3300025960 | Bacteria | 1258 |
| 344 | Ga0207712_10295692 | 3300025961 | Bacteria | 1327 |
| 345 | Ga0207668_10002518 | 3300025972 | Bacteria | 10693 |
| 346 | Ga0207668_10266532 | 3300025972 | Bacteria | 1398 |
| 347 | Ga0207658_10000553 | 3300025986 | Bacteria | 33951 |
| 348 | Ga0207658_10015677 | 3300025986 | Bacteria | 5201 |
| 349 | Ga0207658_10055114 | 3300025986 | Bacteria | 2944 |
| 350 | Ga0207658_10134358 | 3300025986 | Bacteria | 1992 |
| 351 | Ga0207677_10000623 | 3300026023 | Bacteria | 21544 |
| 352 | Ga0207677_10038687 | 3300026023 | Bacteria | 3130 |
| 353 | Ga0207703_10000773 | 3300026035 | Bacteria | 31458 |
| 354 | Ga0207639_10025987 | 3300026041 | Bacteria | 4251 |
| 355 | Ga0207639_10072426 | 3300026041 | Bacteria | 2698 |
| 356 | Ga0207678_10004759 | 3300026067 | Bacteria | 12190 |
| 357 | Ga0207678_10020565 | 3300026067 | Bacteria | 5787 |
| 358 | Ga0207678_10105682 | 3300026067 | Bacteria | 2402 |
| 359 | Ga0207702_10462684 | 3300026078 | Bacteria | 1232 |
| 360 | Ga0207641_10001102 | 3300026088 | Bacteria | 27131 |
| 361 | Ga0207641_10059118 | 3300026088 | Bacteria | 3263 |
| 362 | Ga0207641_10280663 | 3300026088 | Bacteria | 1567 |
| 363 | Ga0207648_10080841 | 3300026089 | Bacteria | 2835 |
| 364 | Ga0207648_10128690 | 3300026089 | Bacteria | 2228 |
| 365 | Ga0207648_10129440 | 3300026089 | Bacteria | 2221 |
| 366 | Ga0207648_10203958 | 3300026089 | Bacteria | 1754 |
| 367 | Ga0207648_10221002 | 3300026089 | Bacteria | 1684 |
| 368 | Ga0207676_10000742 | 3300026095 | Bacteria | 25556 |
| 369 | Ga0207676_10226541 | 3300026095 | Bacteria | 1668 |
| 370 | Ga0207676_10245620 | 3300026095 | Bacteria | 1608 |
| 371 | Ga0207674_10016615 | 3300026116 | Bacteria | 8047 |
| 372 | Ga0207674_10053553 | 3300026116 | Bacteria | 4112 |
| 373 | Ga0207674_10090185 | 3300026116 | Bacteria | 3057 |
| 374 | Ga0207675_100001409 | 3300026118 | Bacteria | 24039 |
| 375 | Ga0207675_100067256 | 3300026118 | Bacteria | 3349 |
| 376 | Ga0207675_100273380 | 3300026118 | Bacteria | 1640 |
| 377 | Ga0207683_10000020 | 3300026121 | Bacteria | 118805 |
| 378 | Ga0207683_10003309 | 3300026121 | Bacteria | 14048 |
| 379 | Ga0207683_10026998 | 3300026121 | Bacteria | 4962 |
| 380 | Ga0207683_10160635 | 3300026121 | Bacteria | 2031 |
| 381 | Ga0207683_10173876 | 3300026121 | Bacteria | 1951 |
| 382 | Ga0207683_10288444 | 3300026121 | Bacteria | 1500 |
| 383 | Ga0207698_10011424 | 3300026142 | Bacteria | 5758 |
| 384 | Ga0207698_10032804 | 3300026142 | Bacteria | 3767 |
| 385 | Ga0207698_10098874 | 3300026142 | Bacteria | 2412 |
| 386 | Ga0209813_10028074 | 3300027866 | Bacteria | 1638 |
| 387 | Ga0268266_10034410 | 3300028379 | Bacteria | 4309 |
| 388 | Ga0268266_10160688 | 3300028379 | Bacteria | 2032 |
| 389 | Ga0268265_10020503 | 3300028380 | Bacteria | 4613 |
| 390 | Ga0268265_10088567 | 3300028380 | Bacteria | 2466 |
| 391 | Ga0268265_10193399 | 3300028380 | Bacteria | 1759 |
| 392 | Ga0268264_10008521 | 3300028381 | Bacteria | 8522 |
| 393 | Ga0268264_10018269 | 3300028381 | Bacteria | 5735 |
| 394 | Ga0268264_10021238 | 3300028381 | Bacteria | 5304 |
| 395 | Ga0268264_10179100 | 3300028381 | Bacteria | 1924 |
| 396 | Ga0268264_10277364 | 3300028381 | Bacteria | 1568 |
| 397 | Ga0307517_10009612 | 3300028786 | Bacteria | 13684 |
| 398 | Ga0307517_10162746 | 3300028786 | Bacteria | 1492 |
| 399 | Ga0307515_10000034 | 3300028794 | Bacteria | 344640 |
| 400 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 401 | Ga0307515_10000367 | 3300028794 | Bacteria | 111166 |
| 402 | Ga0307515_10000586 | 3300028794 | Bacteria | 85517 |
| 403 | Ga0307515_10005841 | 3300028794 | Bacteria | 24838 |
| 404 | Ga0307515_10006221 | 3300028794 | Bacteria | 23979 |
| 405 | Ga0307515_10071598 | 3300028794 | Bacteria | 4696 |
| 406 | Ga0307515_10089497 | 3300028794 | Bacteria | 3875 |
| 407 | Ga0307515_10146266 | 3300028794 | Bacteria | 2501 |
| 408 | Ga0307511_10001889 | 3300030521 | Bacteria | 21986 |
| 409 | Ga0307512_10145404 | 3300030522 | Bacteria | 1436 |
| 410 | Ga0316183_1046813 | 3300030742 | Bacteria | 3201 |
| 411 | Ga0316182_1100821 | 3300030745 | Bacteria | 2718 |
| 412 | Ga0265328_10004417 | 3300031239 | Bacteria | 6107 |
| 413 | Ga0265340_10053131 | 3300031247 | Bacteria | 1957 |
| 414 | Ga0265316_10116782 | 3300031344 | Bacteria | 2017 |
| 415 | Ga0307513_10000012 | 3300031456 | Bacteria | 328865 |
| 416 | Ga0307513_10000514 | 3300031456 | Bacteria | 55608 |
| 417 | Ga0307513_10008606 | 3300031456 | Bacteria | 13021 |
| 418 | Ga0307513_10012803 | 3300031456 | Bacteria | 10329 |
| 419 | Ga0307513_10014348 | 3300031456 | Bacteria | 9676 |
| 420 | Ga0307513_10116491 | 3300031456 | Bacteria | 2651 |
| 421 | Ga0307513_10174139 | 3300031456 | Bacteria | 2025 |
| 422 | Ga0307513_10211504 | 3300031456 | Bacteria | 1770 |
| 423 | Ga0307513_10318978 | 3300031456 | Bacteria | 1313 |
| 424 | Ga0307509_10001193 | 3300031507 | Bacteria | 44217 |
| 425 | Ga0307509_10011999 | 3300031507 | Bacteria | 10407 |
| 426 | Ga0307408_100101016 | 3300031548 | Bacteria | 2198 |
| 427 | Ga0307408_100300404 | 3300031548 | Bacteria | 1344 |
| 428 | Ga0307508_10000041 | 3300031616 | Bacteria | 147868 |
| 429 | Ga0307508_10010688 | 3300031616 | Bacteria | 8390 |
| 430 | Ga0307508_10021258 | 3300031616 | Bacteria | 5899 |
| 431 | Ga0307514_10004105 | 3300031649 | Bacteria | 13508 |
| 432 | Ga0307514_10006116 | 3300031649 | Bacteria | 10568 |
| 433 | Ga0307514_10036313 | 3300031649 | Bacteria | 3917 |
| 434 | Ga0307514_10053099 | 3300031649 | Bacteria | 3129 |
| 435 | Ga0307516_10001570 | 3300031730 | Bacteria | 31465 |
| 436 | Ga0307516_10006191 | 3300031730 | Bacteria | 14085 |
| 437 | Ga0307405_10013201 | 3300031731 | Bacteria | 4401 |
| 438 | Ga0307410_10135230 | 3300031852 | Bacteria | 1816 |
| 439 | Ga0307406_10033190 | 3300031901 | Bacteria | 3157 |
| 440 | Ga0307407_10267635 | 3300031903 | Bacteria | 1178 |
| 441 | Ga0307412_10055103 | 3300031911 | Bacteria | 2642 |
| 442 | Ga0307412_10079068 | 3300031911 | Bacteria | 2267 |
| 443 | Ga0307416_100425603 | 3300032002 | Bacteria | 1373 |
| 444 | Ga0307414_10127449 | 3300032004 | Bacteria | 1969 |
| 445 | Ga0307414_10325684 | 3300032004 | Bacteria | 1309 |
| 446 | Ga0307411_10012599 | 3300032005 | Bacteria | 4623 |
| 447 | Ga0307507_10085860 | 3300033179 | Bacteria | 2734 |
| 448 | Ga0307510_10015773 | 3300033180 | Bacteria | 8933 |
| 449 | Ga0307510_10026010 | 3300033180 | Bacteria | 6737 |
| 450 | Ga0307510_10031266 | 3300033180 | Bacteria | 6018 |
| 451 | Ga0307510_10086046 | 3300033180 | Bacteria | 3017 |
| 452 | Ga0373926_0095122 | 3300035083 | Bacteria | 1110 |
| 453 | Ga0373944_0015207 | 3300035089 | Bacteria | 2157 |
| 454 | Ga0373932_0021658 | 3300035112 | Bacteria | 1699 |
| 455 | Ga0373945_0024980 | 3300035116 | Bacteria | 2073 |
| 456 | Ga0373937_0243658 | 3300036401 | Bacteria | 1694 |
| 457 | Ga0395905_0000279 | 3300037471 | Bacteria | 75846 |
| 458 | Ga0395905_0009110 | 3300037471 | Bacteria | 9724 |
| 459 | Ga0395905_0025964 | 3300037471 | Bacteria | 5522 |
| 460 | Ga0395905_0090613 | 3300037471 | Bacteria | 2867 |
| 461 | Ga0395905_0094788 | 3300037471 | Bacteria | 2800 |
| 462 | Ga0436364_0783083 | 3300037853 | Bacteria | 1061 |
| 463 | Ga0436364_1478496 | 3300037853 | Bacteria | 16430 |
| 464 | Ga0436360_0355167 | 3300039438 | Bacteria | 1216 |
| 465 | Ga0436360_0677787 | 3300039438 | Bacteria | 1422 |
| 466 | Ga0436361_0360094 | 3300039447 | Bacteria | 10024 |
| 467 | Ga0436363_0546706 | 3300039450 | Bacteria | 9166 |
| 468 | Ga0436362_1020986 | 3300039453 | Bacteria | 1441 |
| 469 | Ga0439436_0001703 | 3300041404 | Bacteria | 6430 |
| 470 | Ga0439436_0002775 | 3300041404 | Bacteria | 5296 |
| 471 | Ga0439439_0000253 | 3300041406 | Bacteria | 8385 |
| 472 | Ga0439447_011358 | 3300041407 | Bacteria | 2603 |
| 473 | Ga0439466_0005209 | 3300041411 | Bacteria | 4976 |
| 474 | Ga0439433_0010564 | 3300041999 | Bacteria | 2016 |
| 475 | Ga0439433_0017026 | 3300041999 | Bacteria | 1612 |
| 476 | Ga0439432_005346 | 3300042006 | Bacteria | 4633 |
| 477 | Ga0439449_0000172 | 3300042007 | Bacteria | 22425 |
| 478 | Ga0439449_0000803 | 3300042007 | Bacteria | 12106 |
| 479 | Ga0439449_0006219 | 3300042007 | Bacteria | 4562 |
| 480 | Ga0439449_0043583 | 3300042007 | Bacteria | 1665 |
| 481 | Ga0439452_026084 | 3300042010 | Bacteria | 1478 |
| 482 | Ga0439462_0001382 | 3300042015 | Bacteria | 5369 |
| 483 | Ga0450921_000615 | 3300042123 | Bacteria | 1780 |
| 484 | Ga0450903_017470 | 3300042138 | Bacteria | 1121 |
| 485 | Ga0450910_010046 | 3300042147 | Bacteria | 1344 |
| 486 | Ga0439446_0003954 | 3300042156 | Bacteria | 3727 |
| 487 | Ga0450908_000944 | 3300042184 | Bacteria | 5601 |
| 488 | Ga0450908_002422 | 3300042184 | Bacteria | 3652 |
| 489 | Ga0439434_0003820 | 3300042435 | Bacteria | 4401 |
| 490 | Ga0439434_0005330 | 3300042435 | Bacteria | 3764 |
| 491 | Ga0439434_0016772 | 3300042435 | Bacteria | 2189 |
| 492 | Ga0439464_0013717 | 3300042439 | Bacteria | 2173 |
| 493 | Ga0450918_005030 | 3300042531 | Bacteria | 2380 |
| 494 | Ga0450893_0003041 | 3300042532 | Bacteria | 2642 |
| 495 | Ga0453683_0002485 | 3300044673 | Bacteria | 14250 |
| 496 | Ga0466965_0013943 | 3300044683 | Bacteria | 3800 |
| 497 | Ga0466964_0019594 | 3300044706 | Bacteria | 2601 |
| 498 | Ga0453684_0045386 | 3300044712 | Bacteria | 5863 |
| 499 | Ga0453684_0466244 | 3300044712 | Bacteria | 1403 |
| 500 | Ga0466957_0017998 | 3300044842 | Bacteria | 4144 |
| 501 | Ga0466960_0039465 | 3300044901 | Bacteria | 2227 |
| 502 | Ga0451576_0005927 | 3300045051 | Bacteria | 15139 |
| 503 | Ga0451576_0030112 | 3300045051 | Bacteria | 5804 |
| 504 | Ga0495617_001092 | 3300046452 | Bacteria | 12333 |
| 505 | Ga0495627_001688 | 3300046453 | Bacteria | 12141 |
| 506 | Ga0495592_0000727 | 3300046454 | Bacteria | 23029 |
| 507 | Ga0495592_0046542 | 3300046454 | Bacteria | 3233 |
| 508 | Ga0495590_0000010 | 3300046457 | Bacteria | 317890 |
| 509 | Ga0495590_0046063 | 3300046457 | Bacteria | 1521 |
| 510 | Ga0495638_0000157 | 3300046460 | Bacteria | 107187 |
| 511 | Ga0495638_0025109 | 3300046460 | Bacteria | 3877 |
| 512 | Ga0495638_0078466 | 3300046460 | Bacteria | 2009 |
| 513 | Ga0495651_0082369 | 3300046462 | Bacteria | 2427 |
| 514 | Ga0495653_0010798 | 3300046463 | Bacteria | 7474 |
| 515 | Ga0495650_0000011 | 3300046471 | Bacteria | 615329 |
| 516 | Ga0495584_0009010 | 3300046491 | Bacteria | 5155 |
| 517 | Ga0495584_0064163 | 3300046491 | Bacteria | 1846 |
| 518 | Ga0495584_0085626 | 3300046491 | Bacteria | 1588 |
| 519 | Ga0495585_0001878 | 3300046492 | Bacteria | 15827 |
| 520 | Ga0495596_0003413 | 3300046500 | Bacteria | 8055 |
| 521 | Ga0495607_0006282 | 3300046501 | Bacteria | 8377 |
| 522 | Ga0495607_0010905 | 3300046501 | Bacteria | 6082 |
| 523 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 524 | Ga0495583_0000549 | 3300046506 | Bacteria | 52554 |
| 525 | Ga0495583_0006755 | 3300046506 | Bacteria | 7416 |
| 526 | Ga0495583_0042590 | 3300046506 | Bacteria | 2119 |
| 527 | Ga0495606_0000059 | 3300046507 | Bacteria | 186886 |
| 528 | Ga0495606_0000987 | 3300046507 | Bacteria | 41467 |
| 529 | Ga0495606_0002140 | 3300046507 | Bacteria | 23813 |
| 530 | Ga0495606_0011359 | 3300046507 | Bacteria | 7272 |
| 531 | Ga0495606_0014404 | 3300046507 | Bacteria | 6175 |
| 532 | Ga0495606_0017482 | 3300046507 | Bacteria | 5419 |
| 533 | Ga0495608_0003574 | 3300046511 | Bacteria | 11143 |
| 534 | Ga0495608_0005234 | 3300046511 | Bacteria | 9269 |
| 535 | Ga0495610_0007809 | 3300046512 | Bacteria | 7048 |
| 536 | Ga0495610_0040205 | 3300046512 | Bacteria | 2359 |
| 537 | Ga0495610_0060887 | 3300046512 | Bacteria | 1796 |
| 538 | Ga0495610_0091284 | 3300046512 | Bacteria | 1380 |
| 539 | Ga0495616_0001816 | 3300046513 | Bacteria | 14461 |
| 540 | Ga0495618_0028426 | 3300046514 | Bacteria | 3484 |
| 541 | Ga0495620_0047852 | 3300046515 | Bacteria | 1838 |
| 542 | Ga0495628_0001674 | 3300046516 | Bacteria | 20237 |
| 543 | Ga0495628_0004299 | 3300046516 | Bacteria | 12663 |
| 544 | Ga0495631_0000752 | 3300046518 | Bacteria | 20761 |
| 545 | Ga0495631_0000901 | 3300046518 | Bacteria | 18559 |
| 546 | Ga0495632_0037620 | 3300046519 | Bacteria | 2454 |
| 547 | Ga0495632_0083193 | 3300046519 | Bacteria | 1524 |
| 548 | Ga0495637_0001059 | 3300046520 | Bacteria | 17182 |
| 549 | Ga0495637_0010571 | 3300046520 | Bacteria | 4458 |
| 550 | Ga0495643_0000099 | 3300046522 | Bacteria | 145425 |
| 551 | Ga0495643_0000299 | 3300046522 | Bacteria | 69119 |
| 552 | Ga0495643_0007767 | 3300046522 | Bacteria | 6865 |
| 553 | Ga0495643_0057541 | 3300046522 | Bacteria | 2071 |
| 554 | Ga0495648_0002672 | 3300046524 | Bacteria | 16122 |
| 555 | Ga0495648_0006023 | 3300046524 | Bacteria | 9959 |
| 556 | Ga0495648_0019308 | 3300046524 | Bacteria | 4797 |
| 557 | Ga0495648_0071236 | 3300046524 | Bacteria | 2016 |
| 558 | Ga0495648_0072704 | 3300046524 | Bacteria | 1989 |
| 559 | Ga0495642_0003934 | 3300046528 | Bacteria | 5811 |
| 560 | Ga0495642_0006222 | 3300046528 | Bacteria | 4581 |
| 561 | Ga0495642_0030467 | 3300046528 | Bacteria | 2158 |
| 562 | Ga0495652_0015010 | 3300046529 | Bacteria | 6938 |
| 563 | Ga0495652_0015350 | 3300046529 | Bacteria | 6856 |
| 564 | Ga0495652_0066383 | 3300046529 | Bacteria | 3028 |
| 565 | Ga0495654_0014744 | 3300046530 | Bacteria | 4155 |
| 566 | Ga0495654_0025658 | 3300046530 | Bacteria | 3035 |
| 567 | Ga0495609_0000054 | 3300046538 | Bacteria | 147369 |
| 568 | Ga0495609_0021033 | 3300046538 | Bacteria | 3010 |
| 569 | Ga0495621_0003864 | 3300046539 | Bacteria | 4162 |
| 570 | Ga0495621_0018294 | 3300046539 | Bacteria | 2274 |
| 571 | Ga0495621_0032765 | 3300046539 | Bacteria | 1788 |
| 572 | Ga0495621_0034720 | 3300046539 | Bacteria | 1743 |
| 573 | Ga0495597_0000159 | 3300046542 | Bacteria | 59699 |
| 574 | Ga0495597_0000690 | 3300046542 | Bacteria | 27246 |
| 575 | Ga0495597_0042820 | 3300046542 | Bacteria | 2017 |
| 576 | Ga0495645_0011320 | 3300046543 | Bacteria | 6273 |
| 577 | Ga0495622_0000048 | 3300046557 | Bacteria | 108955 |
| 578 | Ga0495633_0000063 | 3300046558 | Bacteria | 141657 |
| 579 | Ga0495633_0001033 | 3300046558 | Bacteria | 22774 |
| 580 | Ga0495633_0002572 | 3300046558 | Bacteria | 12716 |
| 581 | Ga0495633_0009801 | 3300046558 | Bacteria | 5265 |
| 582 | Ga0495656_0000383 | 3300046615 | Bacteria | 14729 |
| 583 | Ga0495668_0000458 | 3300046616 | Bacteria | 52227 |
| 584 | Ga0495668_0000609 | 3300046616 | Bacteria | 43205 |
| 585 | Ga0495668_0014948 | 3300046616 | Bacteria | 4541 |
| 586 | Ga0495668_0020313 | 3300046616 | Bacteria | 3821 |
| 587 | Ga0495668_0069952 | 3300046616 | Bacteria | 1929 |
| 588 | Ga0495668_0093881 | 3300046616 | Bacteria | 1643 |
| 589 | Ga0495611_0004982 | 3300046648 | Bacteria | 5687 |
| 590 | Ga0495625_0000241 | 3300046660 | Bacteria | 85835 |
| 591 | Ga0495625_0001565 | 3300046660 | Bacteria | 27230 |
| 592 | Ga0495625_0001836 | 3300046660 | Bacteria | 24291 |
| 593 | Ga0495625_0002578 | 3300046660 | Bacteria | 19468 |
| 594 | Ga0495625_0007495 | 3300046660 | Bacteria | 9484 |
| 595 | Ga0495659_0000068 | 3300046664 | Bacteria | 46175 |
| 596 | Ga0495661_0000603 | 3300046665 | Bacteria | 36732 |
| 597 | Ga0495657_0065344 | 3300046675 | Bacteria | 2393 |
| 598 | Ga0495599_0003655 | 3300046678 | Bacteria | 9020 |
| 599 | Ga0495623_0050337 | 3300046679 | Bacteria | 2638 |
| 600 | Ga0495646_0002050 | 3300046680 | Bacteria | 12216 |
| 601 | Ga0495646_0003855 | 3300046680 | Bacteria | 9373 |
| 602 | Ga0495658_0109821 | 3300046683 | Bacteria | 1657 |
| 603 | Ga0495669_0010367 | 3300046684 | Bacteria | 3937 |
| 604 | Ga0495624_0018658 | 3300046690 | Bacteria | 4638 |
| 605 | Ga0495670_0000525 | 3300046691 | Bacteria | 18162 |
| 606 | Ga0495671_0000628 | 3300046692 | Bacteria | 25878 |
| 607 | Ga0495671_0001980 | 3300046692 | Bacteria | 13161 |
| 608 | Ga0495671_0093306 | 3300046692 | Bacteria | 1473 |
| 609 | Ga0495649_0001093 | 3300046694 | Bacteria | 21156 |
| 610 | Ga0495649_0005158 | 3300046694 | Bacteria | 8376 |
| 611 | Ga0495649_0012427 | 3300046694 | Bacteria | 4950 |
| 612 | Ga0495649_0099234 | 3300046694 | Bacteria | 1549 |
| 613 | Ga0495649_0145276 | 3300046694 | Bacteria | 1247 |
| 614 | Ga0495600_0001607 | 3300046809 | Bacteria | 12592 |
| 615 | Ga0495660_0005348 | 3300046810 | Bacteria | 7687 |
| 616 | Ga0495660_0056800 | 3300046810 | Bacteria | 2114 |
| 617 | Ga0495660_0117245 | 3300046810 | Bacteria | 1351 |
| 618 | Ga0495604_0008167 | 3300047317 | Bacteria | 8284 |
| 619 | Ga0495636_0007366 | 3300047318 | Bacteria | 4329 |
| 620 | Ga0495672_0000169 | 3300047320 | Bacteria | 94803 |
| 621 | Ga0495672_0000277 | 3300047320 | Bacteria | 71082 |
| 622 | Ga0495676_0049869 | 3300047321 | Bacteria | 3362 |
| 623 | Ga0495676_0094516 | 3300047321 | Bacteria | 2226 |
| 624 | Ga0495687_000272 | 3300047443 | Bacteria | 68390 |
| 625 | Ga0495687_010508 | 3300047443 | Bacteria | 5073 |
| 626 | Ga0495687_021798 | 3300047443 | Bacteria | 3088 |
| 627 | Ga0495677_0005597 | 3300047445 | Bacteria | 4760 |
| 628 | Ga0495677_0007304 | 3300047445 | Bacteria | 4132 |
| 629 | Ga0495679_023319 | 3300047446 | Bacteria | 2100 |
| 630 | Ga0495685_022587 | 3300047447 | Bacteria | 2165 |
| 631 | Ga0495673_0000059 | 3300047469 | Bacteria | 233234 |
| 632 | Ga0495681_0001920 | 3300047470 | Bacteria | 15243 |
| 633 | Ga0495681_0009981 | 3300047470 | Bacteria | 5784 |
| 634 | Ga0495686_0000456 | 3300047472 | Bacteria | 61394 |
| 635 | Ga0495686_0004521 | 3300047472 | Bacteria | 11397 |
| 636 | Ga0495686_0031119 | 3300047472 | Bacteria | 3462 |
| 637 | Ga0495593_0057061 | 3300047673 | Bacteria | 2051 |
| 638 | Ga0495602_0023857 | 3300048088 | Bacteria | 5948 |
| 639 | Ga0495626_0032593 | 3300048091 | Bacteria | 2501 |
| 640 | Ga0496101_0261704 | 3300048904 | Bacteria | 1349 |
| 641 | Ga0496102_0005899 | 3300048905 | Bacteria | 10429 |
| 642 | Ga0496102_0031313 | 3300048905 | Bacteria | 4771 |
| 643 | Ga0496102_0094810 | 3300048905 | Bacteria | 2765 |
| 644 | Ga0496102_0116504 | 3300048905 | Bacteria | 2493 |
| 645 | Ga0496103_0252587 | 3300048906 | Bacteria | 1135 |
| 646 | Ga0496104_0063560 | 3300048907 | Bacteria | 3501 |
| 647 | Ga0496105_0314927 | 3300048908 | Bacteria | 1255 |
| 648 | Ga0496106_0073572 | 3300048909 | Bacteria | 2614 |
| 649 | Ga0496107_0050803 | 3300048910 | Bacteria | 2990 |
| 650 | Ga0496109_0043436 | 3300048912 | Bacteria | 4074 |
| 651 | Ga0496110_0409257 | 3300048913 | Bacteria | 1236 |
| 652 | Ga0496114_0090600 | 3300048917 | Bacteria | 2596 |
| 653 | Ga0496117_0007943 | 3300048920 | Bacteria | 10194 |
| 654 | Ga0496118_0035594 | 3300048921 | Bacteria | 4039 |
| 655 | Ga0496121_0027380 | 3300048924 | Bacteria | 5335 |
| 656 | Ga0496123_0066840 | 3300048926 | Bacteria | 2275 |
| 657 | Ga0496124_0034024 | 3300048927 | Bacteria | 4478 |
| 658 | Ga0496124_0043133 | 3300048927 | Bacteria | 3879 |
| 659 | Ga0496124_0260797 | 3300048927 | Bacteria | 1275 |
| 660 | Ga0496125_0002222 | 3300048928 | Bacteria | 25860 |
| 661 | Ga0496125_0076280 | 3300048928 | Bacteria | 2589 |
| 662 | Ga0496125_0084519 | 3300048928 | Bacteria | 2409 |
| 663 | Ga0496125_0147665 | 3300048928 | Bacteria | 1622 |
| 664 | Ga0495678_003519 | 3300049459 | Bacteria | 9629 |
| 665 | Ga0495678_003851 | 3300049459 | Bacteria | 9016 |
| 666 | Ga0495678_020480 | 3300049459 | Bacteria | 2927 |
| 667 | Ga0495678_028332 | 3300049459 | Bacteria | 2364 |
| 668 | Ga0501321_001463 | 3300049537 | Bacteria | 1885 |
| 669 | Ga0501072_0278487 | 3300049588 | Bacteria | 1331 |
| 670 | Ga0501262_001309 | 3300049759 | Bacteria | 2787 |
| 671 | nmdc:mga03683_7666_c1 | 3300050489 | Bacteria | 3759 |
| 672 | nmdc:mga03683_8154_c1 | 3300050489 | Bacteria | 3670 |
| 673 | nmdc:mga03n38_117884_c1 | 3300050490 | Bacteria | 1301 |
| 674 | nmdc:mga03n38_23386_c1 | 3300050490 | Bacteria | 2513 |
| 675 | nmdc:mga03n38_9776_c1 | 3300050490 | Bacteria | 3501 |
| 676 | nmdc:mga0yw44_11476_c1 | 3300050492 | Bacteria | 4577 |
| 677 | nmdc:mga0k408_121504_c1 | 3300050493 | Bacteria | 1547 |
| 678 | nmdc:mga0k408_2239_c1 | 3300050493 | Bacteria | 10340 |
| 679 | nmdc:mga0k408_25213_c1 | 3300050493 | Bacteria | 3367 |
| 680 | nmdc:mga0k408_26694_c1 | 3300050493 | Bacteria | 3276 |
| 681 | nmdc:mga0k408_3111_c1 | 3300050493 | Bacteria | 8793 |
| 682 | nmdc:mga0k408_43050_c1 | 3300050493 | Bacteria | 2601 |
| 683 | nmdc:mga0k408_51645_c1 | 3300050493 | Bacteria | 2382 |
| 684 | nmdc:mga0k408_5413_c1 | 3300050493 | Bacteria | 6792 |
| 685 | nmdc:mga0k408_62551_c1 | 3300050493 | Bacteria | 2165 |
| 686 | nmdc:mga0k408_98158_c1 | 3300050493 | Bacteria | 1726 |
| 687 | nmdc:mga06z11_165112_c1 | 3300050494 | Bacteria | 1268 |
| 688 | nmdc:mga06z11_82589_c1 | 3300050494 | Bacteria | 1727 |
| 689 | nmdc:mga07m45_16459_c1 | 3300050496 | Bacteria | 3959 |
| 690 | nmdc:mga07m45_17988_c1 | 3300050496 | Bacteria | 3806 |
| 691 | nmdc:mga07m45_252_c1 | 3300050496 | Bacteria | 21862 |
| 692 | nmdc:mga07m45_3121_c1 | 3300050496 | Bacteria | 7935 |
| 693 | nmdc:mga07m45_31634_c1 | 3300050496 | Bacteria | 2933 |
| 694 | nmdc:mga07m45_4497_c1 | 3300050496 | Bacteria | 6826 |
| 695 | nmdc:mga07m45_67744_c1 | 3300050496 | Bacteria | 2029 |
| 696 | nmdc:mga05p37_112973_c1 | 3300050507 | Bacteria | 3340 |
| 697 | nmdc:mga09592_1120_c1 | 3300050508 | Bacteria | 21354 |
| 698 | nmdc:mga08y16_165364_c1 | 3300050511 | Bacteria | 2298 |
| 699 | Ga0500610_0005747 | 3300053079 | Bacteria | 5124 |
| 700 | Ga0500644_0001249 | 3300053088 | Bacteria | 6970 |
| 701 | Ga0500644_0015193 | 3300053088 | Bacteria | 2189 |
| 702 | Ga0500644_0026181 | 3300053088 | Bacteria | 1802 |
| 703 | Ga0500583_0066586 | 3300053092 | Bacteria | 1714 |
| 704 | Ga0500651_0000082 | 3300053093 | Bacteria | 60329 |
| 705 | Ga0500641_0052029 | 3300053096 | Bacteria | 1687 |
| 706 | Ga0500571_000152 | 3300053110 | Bacteria | 23934 |
| 707 | Ga0500592_006756 | 3300053116 | Bacteria | 1827 |
| 708 | Ga0500593_000229 | 3300053117 | Bacteria | 23119 |
| 709 | Ga0500593_000664 | 3300053117 | Bacteria | 13093 |
| 710 | Ga0500594_0000381 | 3300053118 | Bacteria | 9925 |
| 711 | Ga0500594_0001035 | 3300053118 | Bacteria | 5952 |
| 712 | Ga0500594_0001930 | 3300053118 | Bacteria | 4489 |
| 713 | Ga0500595_002534 | 3300053119 | Bacteria | 8971 |
| 714 | Ga0500597_053624 | 3300053120 | Bacteria | 1722 |
| 715 | Ga0500607_000049 | 3300053121 | Bacteria | 80941 |
| 716 | Ga0500608_001834 | 3300053122 | Bacteria | 7561 |
| 717 | Ga0500618_000085 | 3300053125 | Bacteria | 75760 |
| 718 | Ga0500652_062342 | 3300053131 | Bacteria | 1537 |
| 719 | Ga0500655_001890 | 3300053133 | Bacteria | 3896 |
| 720 | Ga0500655_004040 | 3300053133 | Bacteria | 2644 |
| 721 | Ga0500658_0001380 | 3300053134 | Bacteria | 9814 |
| 722 | Ga0500658_0001412 | 3300053134 | Bacteria | 9674 |
| 723 | Ga0500658_0002901 | 3300053134 | Bacteria | 6583 |
| 724 | Ga0500559_0000021 | 3300053136 | Bacteria | 129980 |
| 725 | Ga0500564_012785 | 3300053138 | Bacteria | 3740 |
| 726 | Ga0500564_048639 | 3300053138 | Bacteria | 1943 |
| 727 | Ga0500568_0002320 | 3300053139 | Bacteria | 11291 |
| 728 | Ga0500568_0026589 | 3300053139 | Bacteria | 2427 |
| 729 | Ga0500574_000300 | 3300053141 | Bacteria | 6074 |
| 730 | Ga0500574_001994 | 3300053141 | Bacteria | 3229 |
| 731 | Ga0500586_000148 | 3300053145 | Bacteria | 12803 |
| 732 | Ga0500604_0007985 | 3300053151 | Bacteria | 2807 |
| 733 | Ga0500622_0001453 | 3300053156 | Bacteria | 18934 |
| 734 | Ga0500627_0035571 | 3300053158 | Bacteria | 2116 |
| 735 | Ga0500634_0038870 | 3300053161 | Bacteria | 2586 |
| 736 | Ga0500634_0051321 | 3300053161 | Bacteria | 2219 |
| 737 | Ga0500638_000234 | 3300053162 | Bacteria | 11917 |
| 738 | Ga0500636_0030537 | 3300053177 | Bacteria | 3187 |
| 739 | Ga0500636_0042897 | 3300053177 | Bacteria | 2673 |
| 740 | Ga0500645_000228 | 3300053730 | Bacteria | 42875 |
| 741 | Ga0500645_003067 | 3300053730 | Bacteria | 7017 |
| 742 | Ga0500645_005034 | 3300053730 | Bacteria | 4947 |
| 743 | Ga0500587_000179 | 3300053739 | Bacteria | 6384 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0243658 | Ga0373937_0243658_10_882 | 290 |
| 2 | 3300050496 | nmdc:mga07m45_31634_c1 | nmdc:mga07m45_31634_c1_1812_2708 | 292 |
| 3 | 3300046501 | Ga0495607_0006282 | Ga0495607_0006282_3671_4630 | 301 |
| 4 | 3300009177 | Ga0105248_10797089 | Ga0105248_107970891 | 304 |
| 5 | 3300049459 | Ga0495678_020480 | Ga0495678_020480_22_948 | 308 |
| 6 | 3300035116 | Ga0373945_0024980 | Ga0373945_0024980_18_956 | 312 |
| 7 | 3300005844 | Ga0068862_100044774 | Ga0068862_1000447742 | 315 |
| 8 | 3300009148 | Ga0105243_10122564 | Ga0105243_101225642 | 315 |
| 9 | 3300025935 | Ga0207709_10144105 | Ga0207709_101441051 | 315 |
| 10 | 3300028380 | Ga0268265_10193399 | Ga0268265_101933992 | 315 |
| 11 | 3300003792 | Ga0055540_1004132 | Ga0055540_10041322 | 316 |
| 12 | 3300006353 | Ga0075370_10001858 | Ga0075370_100018581 | 316 |
| 13 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025368 | 316 |
| 14 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039240 | 316 |
| 15 | 3300039453 | Ga0436362_1020986 | Ga0436362_1020986_142_1146 | 316 |
| 16 | 3300044673 | Ga0453683_0002485 | Ga0453683_0002485_11559_12566 | 316 |
| 17 | 3300045051 | Ga0451576_0030112 | Ga0451576_0030112_1021_2028 | 316 |
| 18 | 3300050496 | nmdc:mga07m45_4497_c1 | nmdc:mga07m45_4497_c1_4568_5587 | 316 |
| 19 | 3300053088 | Ga0500644_0015193 | Ga0500644_0015193_50_1015 | 317 |
| 20 | 3300009176 | Ga0105242_10219050 | Ga0105242_102190501 | 318 |
| 21 | 3300037853 | Ga0436364_0783083 | Ga0436364_0783083_32_997 | 319 |
| 22 | 3300046452 | Ga0495617_001092 | Ga0495617_001092_150_1109 | 319 |
| 23 | 3300046457 | Ga0495590_0000010 | Ga0495590_0000010_118881_119840 | 319 |
| 24 | 3300046460 | Ga0495638_0000157 | Ga0495638_0000157_93700_94659 | 319 |
| 25 | 3300046506 | Ga0495583_0000006 | Ga0495583_0000006_120701_121660 | 319 |
| 26 | 3300046507 | Ga0495606_0000059 | Ga0495606_0000059_97822_98781 | 319 |
| 27 | 3300046507 | Ga0495606_0000987 | Ga0495606_0000987_9202_10161 | 319 |
| 28 | 3300046507 | Ga0495606_0014404 | Ga0495606_0014404_1645_2604 | 319 |
| 29 | 3300046512 | Ga0495610_0007809 | Ga0495610_0007809_4682_5641 | 319 |
| 30 | 3300046520 | Ga0495637_0010571 | Ga0495637_0010571_591_1550 | 319 |
| 31 | 3300046522 | Ga0495643_0000099 | Ga0495643_0000099_66170_67129 | 319 |
| 32 | 3300046522 | Ga0495643_0000299 | Ga0495643_0000299_65585_66544 | 319 |
| 33 | 3300046524 | Ga0495648_0002672 | Ga0495648_0002672_2573_3532 | 319 |
| 34 | 3300046524 | Ga0495648_0019308 | Ga0495648_0019308_2017_2976 | 319 |
| 35 | 3300046524 | Ga0495648_0071236 | Ga0495648_0071236_15_974 | 319 |
| 36 | 3300046528 | Ga0495642_0006222 | Ga0495642_0006222_991_1950 | 319 |
| 37 | 3300046538 | Ga0495609_0021033 | Ga0495609_0021033_816_1775 | 319 |
| 38 | 3300046542 | Ga0495597_0000159 | Ga0495597_0000159_54885_55844 | 319 |
| 39 | 3300046542 | Ga0495597_0000690 | Ga0495597_0000690_17448_18407 | 319 |
| 40 | 3300046557 | Ga0495622_0000048 | Ga0495622_0000048_95880_96839 | 319 |
| 41 | 3300046558 | Ga0495633_0000063 | Ga0495633_0000063_62027_62986 | 319 |
| 42 | 3300046558 | Ga0495633_0009801 | Ga0495633_0009801_1064_2023 | 319 |
| 43 | 3300046660 | Ga0495625_0000241 | Ga0495625_0000241_72321_73280 | 319 |
| 44 | 3300046660 | Ga0495625_0007495 | Ga0495625_0007495_5660_6619 | 319 |
| 45 | 3300046694 | Ga0495649_0005158 | Ga0495649_0005158_3909_4868 | 319 |
| 46 | 3300046810 | Ga0495660_0117245 | Ga0495660_0117245_316_1275 | 319 |
| 47 | 3300047320 | Ga0495672_0000277 | Ga0495672_0000277_54087_55046 | 319 |
| 48 | 3300047469 | Ga0495673_0000059 | Ga0495673_0000059_139979_140938 | 319 |
| 49 | 3300049459 | Ga0495678_003851 | Ga0495678_003851_2095_3054 | 319 |
| 50 | 3300049459 | Ga0495678_028332 | Ga0495678_028332_1391_2350 | 319 |
| 51 | 3300053118 | Ga0500594_0001930 | Ga0500594_0001930_1204_2163 | 319 |
| 52 | 3300053145 | Ga0500586_000148 | Ga0500586_000148_7345_8304 | 319 |
| 53 | iso_pu_bacteria | 2842711865 | 2842715667 | 319 |
| 54 | iso_pu_bacteria | 2857558681 | 2857562660 | 319 |
| 55 | 3300011119 | Ga0105246_10071797 | Ga0105246_100717972 | 321 |
| 56 | 3300041404 | Ga0439436_0001703 | Ga0439436_0001703_4635_5651 | 321 |
| 57 | 3300042006 | Ga0439432_005346 | Ga0439432_005346_2507_3523 | 321 |
| 58 | 3300042007 | Ga0439449_0000803 | Ga0439449_0000803_8197_9222 | 321 |
| 59 | 3300042007 | Ga0439449_0043583 | Ga0439449_0043583_78_1094 | 321 |
| 60 | 3300042138 | Ga0450903_017470 | Ga0450903_017470_22_1056 | 322 |
| 61 | 3300046616 | Ga0495668_0000609 | Ga0495668_0000609_27729_28697 | 322 |
| 62 | 3300046507 | Ga0495606_0011359 | Ga0495606_0011359_244_1215 | 323 |
| 63 | 3300046530 | Ga0495654_0025658 | Ga0495654_0025658_1628_2599 | 323 |
| 64 | 3300046558 | Ga0495633_0001033 | Ga0495633_0001033_12747_13718 | 323 |
| 65 | 3300046660 | Ga0495625_0002578 | Ga0495625_0002578_14672_15643 | 323 |
| 66 | 3300046664 | Ga0495659_0000068 | Ga0495659_0000068_32332_33303 | 323 |
| 67 | 3300046692 | Ga0495671_0000628 | Ga0495671_0000628_2086_3057 | 323 |
| 68 | 3300046694 | Ga0495649_0145276 | Ga0495649_0145276_26_1000 | 323 |
| 69 | 3300047320 | Ga0495672_0000169 | Ga0495672_0000169_79065_80036 | 323 |
| 70 | 3300050489 | nmdc:mga03683_8154_c1 | nmdc:mga03683_8154_c1_2625_3596 | 323 |
| 71 | 3300050490 | nmdc:mga03n38_117884_c1 | nmdc:mga03n38_117884_c1_312_1289 | 323 |
| 72 | 3300046507 | Ga0495606_0017482 | Ga0495606_0017482_3526_4500 | 324 |
| 73 | 3300047472 | Ga0495686_0031119 | Ga0495686_0031119_2073_3047 | 324 |
| 74 | 3300005843 | Ga0068860_100175711 | Ga0068860_1001757112 | 326 |
| 75 | 3300035083 | Ga0373926_0095122 | Ga0373926_0095122_34_1014 | 326 |
| 76 | 3300035089 | Ga0373944_0015207 | Ga0373944_0015207_727_1707 | 326 |
| 77 | 3300005295 | Ga0065707_10083176 | Ga0065707_100831763 | 327 |
| 78 | 3300005347 | Ga0070668_100041642 | Ga0070668_1000416422 | 327 |
| 79 | 3300005367 | Ga0070667_100087323 | Ga0070667_1000873232 | 327 |
| 80 | 3300005455 | Ga0070663_100063435 | Ga0070663_1000634352 | 327 |
| 81 | 3300005459 | Ga0068867_100001358 | Ga0068867_1000013589 | 327 |
| 82 | 3300005719 | Ga0068861_100002134 | Ga0068861_10000213412 | 327 |
| 83 | 3300005844 | Ga0068862_100201760 | Ga0068862_1002017602 | 327 |
| 84 | 3300006881 | Ga0068865_100004245 | Ga0068865_1000042455 | 327 |
| 85 | 3300009148 | Ga0105243_10072545 | Ga0105243_100725452 | 327 |
| 86 | 3300009553 | Ga0105249_10075911 | Ga0105249_100759113 | 327 |
| 87 | 3300009553 | Ga0105249_10581861 | Ga0105249_105818611 | 327 |
| 88 | 3300013297 | Ga0157378_10012819 | Ga0157378_100128192 | 327 |
| 89 | 3300013308 | Ga0157375_10094435 | Ga0157375_100944352 | 327 |
| 90 | 3300014326 | Ga0157380_10065616 | Ga0157380_100656163 | 327 |
| 91 | 3300014969 | Ga0157376_10612282 | Ga0157376_106122821 | 327 |
| 92 | 3300017792 | Ga0163161_10015558 | Ga0163161_100155582 | 327 |
| 93 | 3300025935 | Ga0207709_10013032 | Ga0207709_100130322 | 327 |
| 94 | 3300025938 | Ga0207704_10010234 | Ga0207704_100102342 | 327 |
| 95 | 3300025940 | Ga0207691_10046682 | Ga0207691_100466823 | 327 |
| 96 | 3300025961 | Ga0207712_10295692 | Ga0207712_102956921 | 327 |
| 97 | 3300026067 | Ga0207678_10105682 | Ga0207678_101056822 | 327 |
| 98 | 3300026089 | Ga0207648_10129440 | Ga0207648_101294402 | 327 |
| 99 | 3300026118 | Ga0207675_100001409 | Ga0207675_1000014092 | 327 |
| 100 | 3300026118 | Ga0207675_100273380 | Ga0207675_1002733801 | 327 |
| 101 | 3300028380 | Ga0268265_10020503 | Ga0268265_100205033 | 327 |
| 102 | 3300028380 | Ga0268265_10088567 | Ga0268265_100885672 | 327 |
| 103 | 3300028381 | Ga0268264_10008521 | Ga0268264_100085213 | 327 |
| 104 | 3300039450 | Ga0436363_0546706 | Ga0436363_0546706_3082_4065 | 327 |
| 105 | 3300050493 | nmdc:mga0k408_62551_c1 | nmdc:mga0k408_62551_c1_1097_2080 | 327 |
| 106 | 3300002739 | JGI25158J39367_1006071 | JGI25158J39367_10060712 | 328 |
| 107 | 3300009176 | Ga0105242_10226583 | Ga0105242_102265832 | 328 |
| 108 | 3300031247 | Ga0265340_10053131 | Ga0265340_100531311 | 328 |
| 109 | 3300005327 | Ga0070658_10060413 | Ga0070658_100604133 | 330 |
| 110 | 3300005328 | Ga0070676_10004778 | Ga0070676_100047783 | 330 |
| 111 | 3300005331 | Ga0070670_100016983 | Ga0070670_1000169836 | 330 |
| 112 | 3300005347 | Ga0070668_100003200 | Ga0070668_10000320012 | 330 |
| 113 | 3300005354 | Ga0070675_100001023 | Ga0070675_10000102310 | 330 |
| 114 | 3300005355 | Ga0070671_100000187 | Ga0070671_10000018713 | 330 |
| 115 | 3300005364 | Ga0070673_100001644 | Ga0070673_10000164412 | 330 |
| 116 | 3300005367 | Ga0070667_100002039 | Ga0070667_10000203911 | 330 |
| 117 | 3300005455 | Ga0070663_100003597 | Ga0070663_1000035978 | 330 |
| 118 | 3300005456 | Ga0070678_100001085 | Ga0070678_1000010855 | 330 |
| 119 | 3300005539 | Ga0068853_100037871 | Ga0068853_1000378714 | 330 |
| 120 | 3300005543 | Ga0070672_100003076 | Ga0070672_1000030769 | 330 |
| 121 | 3300005548 | Ga0070665_100007846 | Ga0070665_1000078465 | 330 |
| 122 | 3300005834 | Ga0068851_10022194 | Ga0068851_100221942 | 330 |
| 123 | 3300005843 | Ga0068860_100019618 | Ga0068860_1000196187 | 330 |
| 124 | 3300013308 | Ga0157375_10005097 | Ga0157375_1000509712 | 330 |
| 125 | 3300014325 | Ga0163163_10104763 | Ga0163163_101047632 | 330 |
| 126 | 3300014969 | Ga0157376_10213687 | Ga0157376_102136872 | 330 |
| 127 | 3300021388 | Ga0213875_10002672 | Ga0213875_100026726 | 330 |
| 128 | 3300025907 | Ga0207645_10000912 | Ga0207645_1000091218 | 330 |
| 129 | 3300025925 | Ga0207650_10033963 | Ga0207650_100339632 | 330 |
| 130 | 3300025926 | Ga0207659_10024192 | Ga0207659_100241926 | 330 |
| 131 | 3300025940 | Ga0207691_10000342 | Ga0207691_1000034237 | 330 |
| 132 | 3300025942 | Ga0207689_10103093 | Ga0207689_101030933 | 330 |
| 133 | 3300025960 | Ga0207651_10082645 | Ga0207651_100826452 | 330 |
| 134 | 3300025972 | Ga0207668_10002518 | Ga0207668_100025183 | 330 |
| 135 | 3300025986 | Ga0207658_10015677 | Ga0207658_100156775 | 330 |
| 136 | 3300026041 | Ga0207639_10072426 | Ga0207639_100724262 | 330 |
| 137 | 3300026067 | Ga0207678_10004759 | Ga0207678_100047598 | 330 |
| 138 | 3300026095 | Ga0207676_10245620 | Ga0207676_102456202 | 330 |
| 139 | 3300026121 | Ga0207683_10000020 | Ga0207683_1000002088 | 330 |
| 140 | 3300026142 | Ga0207698_10011424 | Ga0207698_100114242 | 330 |
| 141 | 3300028381 | Ga0268264_10018269 | Ga0268264_100182694 | 330 |
| 142 | 3300037853 | Ga0436364_1478496 | Ga0436364_1478496_3787_4785 | 330 |
| 143 | iso_pu_bacteria | 2954767861 | 2954769113 | 330 |
| 144 | 3300005335 | Ga0070666_10041292 | Ga0070666_100412923 | 331 |
| 145 | 3300005347 | Ga0070668_100005640 | Ga0070668_1000056402 | 331 |
| 146 | 3300005367 | Ga0070667_100043191 | Ga0070667_1000431913 | 331 |
| 147 | 3300039438 | Ga0436360_0355167 | Ga0436360_0355167_33_1034 | 331 |
| 148 | iso_pu_bacteria | 2818991436 | 2819545378 | 331 |
| 149 | 3300005330 | Ga0070690_100011917 | Ga0070690_1000119174 | 332 |
| 150 | 3300005331 | Ga0070670_100088047 | Ga0070670_1000880471 | 332 |
| 151 | 3300005335 | Ga0070666_10001802 | Ga0070666_100018025 | 332 |
| 152 | 3300005338 | Ga0068868_100000766 | Ga0068868_10000076616 | 332 |
| 153 | 3300005340 | Ga0070689_100005140 | Ga0070689_1000051409 | 332 |
| 154 | 3300005354 | Ga0070675_100000445 | Ga0070675_10000044514 | 332 |
| 155 | 3300005355 | Ga0070671_100009551 | Ga0070671_1000095514 | 332 |
| 156 | 3300005365 | Ga0070688_100025652 | Ga0070688_1000256523 | 332 |
| 157 | 3300005367 | Ga0070667_100095454 | Ga0070667_1000954543 | 332 |
| 158 | 3300005456 | Ga0070678_100000859 | Ga0070678_10000085910 | 332 |
| 159 | 3300005457 | Ga0070662_100303388 | Ga0070662_1003033881 | 332 |
| 160 | 3300005466 | Ga0070685_10075129 | Ga0070685_100751292 | 332 |
| 161 | 3300005616 | Ga0068852_100126387 | Ga0068852_1001263873 | 332 |
| 162 | 3300005617 | Ga0068859_100001853 | Ga0068859_10000185319 | 332 |
| 163 | 3300005618 | Ga0068864_100000330 | Ga0068864_10000033022 | 332 |
| 164 | 3300005841 | Ga0068863_100000715 | Ga0068863_10000071521 | 332 |
| 165 | 3300005842 | Ga0068858_100000900 | Ga0068858_1000009009 | 332 |
| 166 | 3300006051 | Ga0075364_10216939 | Ga0075364_102169392 | 332 |
| 167 | 3300006358 | Ga0068871_100008254 | Ga0068871_1000082546 | 332 |
| 168 | 3300006931 | Ga0097620_100001853 | Ga0097620_1000018534 | 332 |
| 169 | 3300009093 | Ga0105240_10012540 | Ga0105240_100125403 | 332 |
| 170 | 3300009177 | Ga0105248_10004935 | Ga0105248_100049359 | 332 |
| 171 | 3300013296 | Ga0157374_10006819 | Ga0157374_100068196 | 332 |
| 172 | 3300013306 | Ga0163162_10004795 | Ga0163162_100047956 | 332 |
| 173 | 3300013306 | Ga0163162_10256948 | Ga0163162_102569482 | 332 |
| 174 | 3300013308 | Ga0157375_10005292 | Ga0157375_100052929 | 332 |
| 175 | 3300014325 | Ga0163163_10000980 | Ga0163163_100009803 | 332 |
| 176 | 3300014745 | Ga0157377_10209602 | Ga0157377_102096021 | 332 |
| 177 | 3300014968 | Ga0157379_10006787 | Ga0157379_100067877 | 332 |
| 178 | 3300014969 | Ga0157376_10038215 | Ga0157376_100382154 | 332 |
| 179 | 3300017792 | Ga0163161_10091611 | Ga0163161_100916112 | 332 |
| 180 | 3300025903 | Ga0207680_10000940 | Ga0207680_100009406 | 332 |
| 181 | 3300025925 | Ga0207650_10200291 | Ga0207650_102002912 | 332 |
| 182 | 3300025926 | Ga0207659_10000484 | Ga0207659_100004848 | 332 |
| 183 | 3300025931 | Ga0207644_10000525 | Ga0207644_1000052513 | 332 |
| 184 | 3300025933 | Ga0207706_10333136 | Ga0207706_103331361 | 332 |
| 185 | 3300025936 | Ga0207670_10015558 | Ga0207670_100155582 | 332 |
| 186 | 3300025940 | Ga0207691_10051006 | Ga0207691_100510062 | 332 |
| 187 | 3300025941 | Ga0207711_10001399 | Ga0207711_1000139921 | 332 |
| 188 | 3300025986 | Ga0207658_10055114 | Ga0207658_100551141 | 332 |
| 189 | 3300026023 | Ga0207677_10000623 | Ga0207677_1000062315 | 332 |
| 190 | 3300026035 | Ga0207703_10000773 | Ga0207703_1000077313 | 332 |
| 191 | 3300026041 | Ga0207639_10025987 | Ga0207639_100259874 | 332 |
| 192 | 3300026088 | Ga0207641_10001102 | Ga0207641_1000110213 | 332 |
| 193 | 3300026095 | Ga0207676_10000742 | Ga0207676_1000074213 | 332 |
| 194 | 3300026121 | Ga0207683_10003309 | Ga0207683_1000330910 | 332 |
| 195 | 3300026142 | Ga0207698_10032804 | Ga0207698_100328044 | 332 |
| 196 | 3300039438 | Ga0436360_0677787 | Ga0436360_0677787_20_1045 | 332 |
| 197 | iso_pu_bacteria | 2585428062 | 2587757729 | 332 |
| 198 | iso_pu_bacteria | 2643221658 | 2644328614 | 332 |
| 199 | iso_pu_bacteria | 2738543013 | 2739248034 | 332 |
| 200 | iso_pu_bacteria | 2831265667 | 2831272164 | 332 |
| 201 | iso_pu_bacteria | 2885198086 | 2885202935 | 332 |
| 202 | iso_pu_bacteria | 2885211737 | 2885216668 | 332 |
| 203 | iso_pu_bacteria | 2904541872 | 2904547078 | 332 |
| 204 | iso_pu_bacteria | 2929160207 | 2929165614 | 332 |
| 205 | iso_pu_bacteria | 2945909444 | 2945909711 | 332 |
| 206 | 3300021361 | Ga0213872_10008485 | Ga0213872_100084853 | 333 |
| 207 | 3300039447 | Ga0436361_0360094 | Ga0436361_0360094_1341_2345 | 333 |
| 208 | iso_pu_bacteria | 2513020051 | 2513229550 | 333 |
| 209 | iso_pu_bacteria | 2599185214 | 2599626457 | 333 |
| 210 | iso_pu_bacteria | 2599185226 | 2599677090 | 333 |
| 211 | iso_pu_bacteria | 2599185227 | 2599682158 | 333 |
| 212 | iso_pu_bacteria | 2599185229 | 2599695809 | 333 |
| 213 | iso_pu_bacteria | 2643221628 | 2644161625 | 333 |
| 214 | iso_pu_bacteria | 2643221645 | 2644251771 | 333 |
| 215 | iso_pu_bacteria | 2643221664 | 2644360432 | 333 |
| 216 | iso_pu_bacteria | 2643221672 | 2644399849 | 333 |
| 217 | iso_pu_bacteria | 2738541280 | 2738740531 | 333 |
| 218 | iso_pu_bacteria | 2738541300 | 2738843216 | 333 |
| 219 | iso_pu_bacteria | 2738543018 | 2739272147 | 333 |
| 220 | iso_pu_bacteria | 2738543030 | 2739341191 | 333 |
| 221 | iso_pu_bacteria | 2808606418 | 2809146314 | 333 |
| 222 | iso_pu_bacteria | 2818991446 | 2819601729 | 333 |
| 223 | iso_pu_bacteria | 2838054893 | 2838059328 | 333 |
| 224 | iso_pu_bacteria | 2842677519 | 2842680252 | 333 |
| 225 | iso_pu_bacteria | 2885192300 | 2885194399 | 333 |
| 226 | iso_pu_bacteria | 2899924645 | 2899930796 | 333 |
| 227 | iso_pu_bacteria | 2919462493 | 2919463698 | 333 |
| 228 | iso_pu_bacteria | 2928037797 | 2928040883 | 333 |
| 229 | iso_pu_bacteria | 2928044640 | 2928047725 | 333 |
| 230 | iso_pu_bacteria | 2928051484 | 2928055615 | 333 |
| 231 | iso_pu_bacteria | 2928064002 | 2928069712 | 333 |
| 232 | iso_pu_bacteria | 2928070936 | 2928075428 | 333 |
| 233 | iso_pu_bacteria | 2928084124 | 2928088413 | 333 |
| 234 | iso_pu_bacteria | 2945945610 | 2945945816 | 333 |
| 235 | iso_pu_bacteria | 2945972063 | 2945975446 | 333 |
| 236 | iso_pu_bacteria | 2945984333 | 2945988320 | 333 |
| 237 | 3300025941 | Ga0207711_10077529 | Ga0207711_100775292 | 334 |
| 238 | 3300030745 | Ga0316182_1100821 | Ga0316182_11008212 | 334 |
| 239 | 3300031239 | Ga0265328_10004417 | Ga0265328_100044176 | 334 |
| 240 | 3300031344 | Ga0265316_10116782 | Ga0265316_101167822 | 334 |
| 241 | 3300049459 | Ga0495678_003519 | Ga0495678_003519_5876_6880 | 334 |
| 242 | 3300003794 | Ga0055531_10001511 | Ga0055531_1000151118 | 335 |
| 243 | 3300005328 | Ga0070676_10062637 | Ga0070676_100626372 | 335 |
| 244 | 3300005331 | Ga0070670_100095830 | Ga0070670_1000958302 | 335 |
| 245 | 3300005331 | Ga0070670_100319766 | Ga0070670_1003197661 | 335 |
| 246 | 3300005333 | Ga0070677_10006815 | Ga0070677_100068152 | 335 |
| 247 | 3300005354 | Ga0070675_100044798 | Ga0070675_1000447984 | 335 |
| 248 | 3300005356 | Ga0070674_100146204 | Ga0070674_1001462043 | 335 |
| 249 | 3300005364 | Ga0070673_100137682 | Ga0070673_1001376822 | 335 |
| 250 | 3300005364 | Ga0070673_100160896 | Ga0070673_1001608961 | 335 |
| 251 | 3300005367 | Ga0070667_100100367 | Ga0070667_1001003672 | 335 |
| 252 | 3300005458 | Ga0070681_10014476 | Ga0070681_100144766 | 335 |
| 253 | 3300005543 | Ga0070672_100067320 | Ga0070672_1000673202 | 335 |
| 254 | 3300005578 | Ga0068854_100187108 | Ga0068854_1001871082 | 335 |
| 255 | 3300005834 | Ga0068851_10039796 | Ga0068851_100397964 | 335 |
| 256 | 3300006186 | Ga0075369_10055625 | Ga0075369_100556251 | 335 |
| 257 | 3300006358 | Ga0068871_100128775 | Ga0068871_1001287751 | 335 |
| 258 | 3300009094 | Ga0111539_10467961 | Ga0111539_104679611 | 335 |
| 259 | 3300009176 | Ga0105242_10228964 | Ga0105242_102289642 | 335 |
| 260 | 3300013296 | Ga0157374_10167418 | Ga0157374_101674182 | 335 |
| 261 | 3300013308 | Ga0157375_10221040 | Ga0157375_102210401 | 335 |
| 262 | 3300014325 | Ga0163163_10187418 | Ga0163163_101874183 | 335 |
| 263 | 3300014326 | Ga0157380_10109763 | Ga0157380_101097632 | 335 |
| 264 | 3300014497 | Ga0182008_10035285 | Ga0182008_100352852 | 335 |
| 265 | 3300015265 | Ga0182005_1000279 | Ga0182005_10002799 | 335 |
| 266 | 3300025893 | Ga0207682_10002412 | Ga0207682_100024122 | 335 |
| 267 | 3300025912 | Ga0207707_10018330 | Ga0207707_100183305 | 335 |
| 268 | 3300025923 | Ga0207681_10054037 | Ga0207681_100540372 | 335 |
| 269 | 3300025923 | Ga0207681_10118906 | Ga0207681_101189062 | 335 |
| 270 | 3300025940 | Ga0207691_10086083 | Ga0207691_100860832 | 335 |
| 271 | 3300026067 | Ga0207678_10020565 | Ga0207678_100205654 | 335 |
| 272 | 3300026118 | Ga0207675_100067256 | Ga0207675_1000672565 | 335 |
| 273 | 3300028794 | Ga0307515_10071598 | Ga0307515_100715985 | 335 |
| 274 | 3300030521 | Ga0307511_10001889 | Ga0307511_1000188918 | 335 |
| 275 | 3300031456 | Ga0307513_10008606 | Ga0307513_100086066 | 335 |
| 276 | 3300042439 | Ga0439464_0013717 | Ga0439464_0013717_505_1512 | 335 |
| 277 | 3300046454 | Ga0495592_0046542 | Ga0495592_0046542_1443_2450 | 335 |
| 278 | 3300046462 | Ga0495651_0082369 | Ga0495651_0082369_606_1613 | 335 |
| 279 | 3300046463 | Ga0495653_0010798 | Ga0495653_0010798_2392_3399 | 335 |
| 280 | 3300046511 | Ga0495608_0003574 | Ga0495608_0003574_10021_11028 | 335 |
| 281 | 3300046514 | Ga0495618_0028426 | Ga0495618_0028426_879_1886 | 335 |
| 282 | 3300046516 | Ga0495628_0004299 | Ga0495628_0004299_7474_8481 | 335 |
| 283 | 3300046529 | Ga0495652_0015010 | Ga0495652_0015010_4361_5368 | 335 |
| 284 | 3300046539 | Ga0495621_0032765 | Ga0495621_0032765_522_1532 | 335 |
| 285 | 3300046675 | Ga0495657_0065344 | Ga0495657_0065344_157_1164 | 335 |
| 286 | 3300046678 | Ga0495599_0003655 | Ga0495599_0003655_3809_4816 | 335 |
| 287 | 3300046680 | Ga0495646_0003855 | Ga0495646_0003855_4061_5068 | 335 |
| 288 | 3300046690 | Ga0495624_0018658 | Ga0495624_0018658_1969_2976 | 335 |
| 289 | 3300046809 | Ga0495600_0001607 | Ga0495600_0001607_4063_5070 | 335 |
| 290 | 3300047317 | Ga0495604_0008167 | Ga0495604_0008167_352_1359 | 335 |
| 291 | 3300048905 | Ga0496102_0005899 | Ga0496102_0005899_6257_7264 | 335 |
| 292 | 3300048907 | Ga0496104_0063560 | Ga0496104_0063560_213_1223 | 335 |
| 293 | 3300050511 | nmdc:mga08y16_165364_c1 | nmdc:mga08y16_165364_c1_853_1863 | 335 |
| 294 | 3300053092 | Ga0500583_0066586 | Ga0500583_0066586_591_1610 | 335 |
| 295 | 3300053117 | Ga0500593_000229 | Ga0500593_000229_20335_21342 | 335 |
| 296 | 3300053119 | Ga0500595_002534 | Ga0500595_002534_3484_4491 | 335 |
| 297 | 3300053133 | Ga0500655_004040 | Ga0500655_004040_1615_2634 | 335 |
| 298 | 3300053139 | Ga0500568_0026589 | Ga0500568_0026589_1078_2097 | 335 |
| 299 | 3300053141 | Ga0500574_001994 | Ga0500574_001994_1296_2303 | 335 |
| 300 | 3300053151 | Ga0500604_0007985 | Ga0500604_0007985_243_1262 | 335 |
| 301 | 3300002773 | JGI25152J39213_1002250 | JGI25152J39213_10022507 | 336 |
| 302 | 3300002773 | JGI25152J39213_1004246 | JGI25152J39213_10042463 | 336 |
| 303 | 3300002987 | JGI25159J45721_1002244 | JGI25159J45721_10022443 | 336 |
| 304 | 3300003187 | JGI25151J46595_10001379 | JGI25151J46595_1000137910 | 336 |
| 305 | 3300003187 | JGI25151J46595_10004400 | JGI25151J46595_100044007 | 336 |
| 306 | 3300003187 | JGI25151J46595_10010447 | JGI25151J46595_100104473 | 336 |
| 307 | 3300003215 | JGI25153J46596_10004540 | JGI25153J46596_100045407 | 336 |
| 308 | 3300003354 | JGI25160J50197_1002233 | JGI25160J50197_10022339 | 336 |
| 309 | 3300003374 | JGI25161J50226_1005453 | JGI25161J50226_10054532 | 336 |
| 310 | 3300003771 | Ga0055526_1005307 | Ga0055526_10053077 | 336 |
| 311 | 3300003773 | Ga0055537_1001916 | Ga0055537_10019167 | 336 |
| 312 | 3300003775 | Ga0055524_1003604 | Ga0055524_10036047 | 336 |
| 313 | 3300003784 | Ga0055534_1001989 | Ga0055534_10019897 | 336 |
| 314 | 3300003790 | Ga0055528_1003783 | Ga0055528_10037837 | 336 |
| 315 | 3300003794 | Ga0055531_10005440 | Ga0055531_100054407 | 336 |
| 316 | 3300004625 | Ga0055543_1000596 | Ga0055543_100059616 | 336 |
| 317 | 3300005262 | Ga0065165_1003176 | Ga0065165_10031763 | 336 |
| 318 | 3300005335 | Ga0070666_10148399 | Ga0070666_101483991 | 336 |
| 319 | 3300005338 | Ga0068868_100106082 | Ga0068868_1001060823 | 336 |
| 320 | 3300005338 | Ga0068868_100234213 | Ga0068868_1002342131 | 336 |
| 321 | 3300005347 | Ga0070668_100319710 | Ga0070668_1003197101 | 336 |
| 322 | 3300005354 | Ga0070675_100261225 | Ga0070675_1002612252 | 336 |
| 323 | 3300005367 | Ga0070667_100001048 | Ga0070667_10000104811 | 336 |
| 324 | 3300005456 | Ga0070678_100044459 | Ga0070678_1000444594 | 336 |
| 325 | 3300005467 | Ga0070706_100142410 | Ga0070706_1001424102 | 336 |
| 326 | 3300005539 | Ga0068853_100073389 | Ga0068853_1000733891 | 336 |
| 327 | 3300005548 | Ga0070665_100252815 | Ga0070665_1002528152 | 336 |
| 328 | 3300005618 | Ga0068864_100029596 | Ga0068864_1000295962 | 336 |
| 329 | 3300005841 | Ga0068863_100013924 | Ga0068863_1000139245 | 336 |
| 330 | 3300006177 | Ga0075362_10045271 | Ga0075362_100452712 | 336 |
| 331 | 3300006195 | Ga0075366_10037194 | Ga0075366_100371942 | 336 |
| 332 | 3300006195 | Ga0075366_10042135 | Ga0075366_100421352 | 336 |
| 333 | 3300006195 | Ga0075366_10107728 | Ga0075366_101077283 | 336 |
| 334 | 3300006195 | Ga0075366_10127915 | Ga0075366_101279152 | 336 |
| 335 | 3300006237 | Ga0097621_100157134 | Ga0097621_1001571341 | 336 |
| 336 | 3300006353 | Ga0075370_10011949 | Ga0075370_100119494 | 336 |
| 337 | 3300006353 | Ga0075370_10016711 | Ga0075370_100167112 | 336 |
| 338 | 3300009093 | Ga0105240_10009145 | Ga0105240_100091457 | 336 |
| 339 | 3300009098 | Ga0105245_10194377 | Ga0105245_101943772 | 336 |
| 340 | 3300009174 | Ga0105241_10035684 | Ga0105241_100356844 | 336 |
| 341 | 3300009545 | Ga0105237_10000407 | Ga0105237_1000040727 | 336 |
| 342 | 3300009551 | Ga0105238_10005854 | Ga0105238_100058543 | 336 |
| 343 | 3300010375 | Ga0105239_10000335 | Ga0105239_1000033536 | 336 |
| 344 | 3300013104 | Ga0157370_10001435 | Ga0157370_1000143525 | 336 |
| 345 | 3300014969 | Ga0157376_10069577 | Ga0157376_100695772 | 336 |
| 346 | 3300015262 | Ga0182007_10006550 | Ga0182007_100065503 | 336 |
| 347 | 3300017792 | Ga0163161_10003484 | Ga0163161_100034844 | 336 |
| 348 | 3300025208 | Ga0209436_102895 | Ga0209436_1028952 | 336 |
| 349 | 3300025245 | Ga0207425_1000190 | Ga0207425_100019028 | 336 |
| 350 | 3300025245 | Ga0207425_1002381 | Ga0207425_10023811 | 336 |
| 351 | 3300025258 | Ga0209129_1000091 | Ga0209129_100009115 | 336 |
| 352 | 3300025258 | Ga0209129_1002201 | Ga0209129_10022019 | 336 |
| 353 | 3300025258 | Ga0209129_1007264 | Ga0209129_10072643 | 336 |
| 354 | 3300025263 | Ga0209565_1000335 | Ga0209565_100033523 | 336 |
| 355 | 3300025273 | Ga0209673_1002703 | Ga0209673_10027033 | 336 |
| 356 | 3300025284 | Ga0209130_1000140 | Ga0209130_1000140103 | 336 |
| 357 | 3300025291 | Ga0209675_1000659 | Ga0209675_10006593 | 336 |
| 358 | 3300025294 | Ga0209025_1000207 | Ga0209025_1000207119 | 336 |
| 359 | 3300025294 | Ga0209025_1000286 | Ga0209025_100028678 | 336 |
| 360 | 3300025294 | Ga0209025_1000356 | Ga0209025_100035678 | 336 |
| 361 | 3300025295 | Ga0209564_1000597 | Ga0209564_100059723 | 336 |
| 362 | 3300025297 | Ga0209758_1000092 | Ga0209758_1000092133 | 336 |
| 363 | 3300025299 | Ga0209256_1000094 | Ga0209256_1000094103 | 336 |
| 364 | 3300025302 | Ga0207426_1000084 | Ga0207426_1000084100 | 336 |
| 365 | 3300025304 | Ga0209257_1005208 | Ga0209257_10052083 | 336 |
| 366 | 3300025321 | Ga0207656_10014325 | Ga0207656_100143253 | 336 |
| 367 | 3300025903 | Ga0207680_10017960 | Ga0207680_100179605 | 336 |
| 368 | 3300025913 | Ga0207695_10007295 | Ga0207695_100072959 | 336 |
| 369 | 3300025924 | Ga0207694_10063832 | Ga0207694_100638324 | 336 |
| 370 | 3300025927 | Ga0207687_10090908 | Ga0207687_100909082 | 336 |
| 371 | 3300025935 | Ga0207709_10072135 | Ga0207709_100721352 | 336 |
| 372 | 3300025938 | Ga0207704_10063942 | Ga0207704_100639422 | 336 |
| 373 | 3300025972 | Ga0207668_10266532 | Ga0207668_102665321 | 336 |
| 374 | 3300025986 | Ga0207658_10000553 | Ga0207658_1000055324 | 336 |
| 375 | 3300025986 | Ga0207658_10134358 | Ga0207658_101343582 | 336 |
| 376 | 3300026078 | Ga0207702_10462684 | Ga0207702_104626842 | 336 |
| 377 | 3300026088 | Ga0207641_10059118 | Ga0207641_100591185 | 336 |
| 378 | 3300026095 | Ga0207676_10226541 | Ga0207676_102265412 | 336 |
| 379 | 3300026121 | Ga0207683_10026998 | Ga0207683_100269984 | 336 |
| 380 | 3300026121 | Ga0207683_10160635 | Ga0207683_101606352 | 336 |
| 381 | 3300028379 | Ga0268266_10160688 | Ga0268266_101606882 | 336 |
| 382 | 3300028381 | Ga0268264_10179100 | Ga0268264_101791001 | 336 |
| 383 | 3300028794 | Ga0307515_10000034 | Ga0307515_10000034249 | 336 |
| 384 | 3300028794 | Ga0307515_10000179 | Ga0307515_1000017915 | 336 |
| 385 | 3300028794 | Ga0307515_10000586 | Ga0307515_1000058611 | 336 |
| 386 | 3300028794 | Ga0307515_10005841 | Ga0307515_1000584110 | 336 |
| 387 | 3300030522 | Ga0307512_10145404 | Ga0307512_101454042 | 336 |
| 388 | 3300031456 | Ga0307513_10000012 | Ga0307513_10000012234 | 336 |
| 389 | 3300031456 | Ga0307513_10000514 | Ga0307513_100005143 | 336 |
| 390 | 3300031456 | Ga0307513_10012803 | Ga0307513_100128037 | 336 |
| 391 | 3300031456 | Ga0307513_10014348 | Ga0307513_100143484 | 336 |
| 392 | 3300031456 | Ga0307513_10116491 | Ga0307513_101164913 | 336 |
| 393 | 3300031456 | Ga0307513_10211504 | Ga0307513_102115041 | 336 |
| 394 | 3300031456 | Ga0307513_10318978 | Ga0307513_103189782 | 336 |
| 395 | 3300031507 | Ga0307509_10001193 | Ga0307509_100011937 | 336 |
| 396 | 3300031507 | Ga0307509_10011999 | Ga0307509_1001199910 | 336 |
| 397 | 3300031616 | Ga0307508_10021258 | Ga0307508_100212582 | 336 |
| 398 | 3300031649 | Ga0307514_10004105 | Ga0307514_100041058 | 336 |
| 399 | 3300031649 | Ga0307514_10053099 | Ga0307514_100530992 | 336 |
| 400 | 3300031730 | Ga0307516_10001570 | Ga0307516_100015706 | 336 |
| 401 | 3300031730 | Ga0307516_10006191 | Ga0307516_100061916 | 336 |
| 402 | 3300031731 | Ga0307405_10013201 | Ga0307405_100132012 | 336 |
| 403 | 3300033179 | Ga0307507_10085860 | Ga0307507_100858603 | 336 |
| 404 | 3300033180 | Ga0307510_10026010 | Ga0307510_100260106 | 336 |
| 405 | 3300033180 | Ga0307510_10031266 | Ga0307510_100312666 | 336 |
| 406 | 3300037471 | Ga0395905_0009110 | Ga0395905_0009110_1693_2703 | 336 |
| 407 | 3300037471 | Ga0395905_0090613 | Ga0395905_0090613_537_1547 | 336 |
| 408 | 3300041404 | Ga0439436_0002775 | Ga0439436_0002775_1367_2377 | 336 |
| 409 | 3300041406 | Ga0439439_0000253 | Ga0439439_0000253_1011_2021 | 336 |
| 410 | 3300041407 | Ga0439447_011358 | Ga0439447_011358_1016_2026 | 336 |
| 411 | 3300041999 | Ga0439433_0010564 | Ga0439433_0010564_153_1163 | 336 |
| 412 | 3300042007 | Ga0439449_0006219 | Ga0439449_0006219_827_1837 | 336 |
| 413 | 3300042010 | Ga0439452_026084 | Ga0439452_026084_128_1138 | 336 |
| 414 | 3300042015 | Ga0439462_0001382 | Ga0439462_0001382_2164_3174 | 336 |
| 415 | 3300042147 | Ga0450910_010046 | Ga0450910_010046_36_1046 | 336 |
| 416 | 3300042156 | Ga0439446_0003954 | Ga0439446_0003954_468_1478 | 336 |
| 417 | 3300042184 | Ga0450908_002422 | Ga0450908_002422_1875_2885 | 336 |
| 418 | 3300042435 | Ga0439434_0016772 | Ga0439434_0016772_738_1748 | 336 |
| 419 | 3300042532 | Ga0450893_0003041 | Ga0450893_0003041_1021_2031 | 336 |
| 420 | 3300044683 | Ga0466965_0013943 | Ga0466965_0013943_2727_3737 | 336 |
| 421 | 3300044706 | Ga0466964_0019594 | Ga0466964_0019594_706_1737 | 336 |
| 422 | 3300044712 | Ga0453684_0045386 | Ga0453684_0045386_2454_3464 | 336 |
| 423 | 3300044842 | Ga0466957_0017998 | Ga0466957_0017998_2076_3086 | 336 |
| 424 | 3300044901 | Ga0466960_0039465 | Ga0466960_0039465_1138_2148 | 336 |
| 425 | 3300046453 | Ga0495627_001688 | Ga0495627_001688_2910_3920 | 336 |
| 426 | 3300046454 | Ga0495592_0000727 | Ga0495592_0000727_16983_17993 | 336 |
| 427 | 3300046491 | Ga0495584_0085626 | Ga0495584_0085626_58_1068 | 336 |
| 428 | 3300046500 | Ga0495596_0003413 | Ga0495596_0003413_1847_2860 | 336 |
| 429 | 3300046511 | Ga0495608_0005234 | Ga0495608_0005234_5820_6830 | 336 |
| 430 | 3300046512 | Ga0495610_0060887 | Ga0495610_0060887_295_1305 | 336 |
| 431 | 3300046512 | Ga0495610_0091284 | Ga0495610_0091284_228_1238 | 336 |
| 432 | 3300046516 | Ga0495628_0001674 | Ga0495628_0001674_10187_11197 | 336 |
| 433 | 3300046519 | Ga0495632_0083193 | Ga0495632_0083193_266_1276 | 336 |
| 434 | 3300046520 | Ga0495637_0001059 | Ga0495637_0001059_10587_11597 | 336 |
| 435 | 3300046522 | Ga0495643_0007767 | Ga0495643_0007767_3944_4954 | 336 |
| 436 | 3300046524 | Ga0495648_0006023 | Ga0495648_0006023_8024_9037 | 336 |
| 437 | 3300046528 | Ga0495642_0003934 | Ga0495642_0003934_385_1395 | 336 |
| 438 | 3300046529 | Ga0495652_0015350 | Ga0495652_0015350_659_1669 | 336 |
| 439 | 3300046529 | Ga0495652_0066383 | Ga0495652_0066383_1160_2170 | 336 |
| 440 | 3300046539 | Ga0495621_0018294 | Ga0495621_0018294_536_1546 | 336 |
| 441 | 3300046542 | Ga0495597_0042820 | Ga0495597_0042820_555_1565 | 336 |
| 442 | 3300046543 | Ga0495645_0011320 | Ga0495645_0011320_1142_2152 | 336 |
| 443 | 3300046616 | Ga0495668_0069952 | Ga0495668_0069952_529_1539 | 336 |
| 444 | 3300046660 | Ga0495625_0001836 | Ga0495625_0001836_22554_23564 | 336 |
| 445 | 3300046679 | Ga0495623_0050337 | Ga0495623_0050337_281_1291 | 336 |
| 446 | 3300046680 | Ga0495646_0002050 | Ga0495646_0002050_2536_3546 | 336 |
| 447 | 3300046692 | Ga0495671_0001980 | Ga0495671_0001980_9150_10160 | 336 |
| 448 | 3300046810 | Ga0495660_0056800 | Ga0495660_0056800_1094_2104 | 336 |
| 449 | 3300047443 | Ga0495687_010508 | Ga0495687_010508_776_1786 | 336 |
| 450 | 3300047447 | Ga0495685_022587 | Ga0495685_022587_45_1055 | 336 |
| 451 | 3300048088 | Ga0495602_0023857 | Ga0495602_0023857_4129_5139 | 336 |
| 452 | 3300048904 | Ga0496101_0261704 | Ga0496101_0261704_143_1153 | 336 |
| 453 | 3300048905 | Ga0496102_0094810 | Ga0496102_0094810_326_1336 | 336 |
| 454 | 3300048908 | Ga0496105_0314927 | Ga0496105_0314927_77_1087 | 336 |
| 455 | 3300048909 | Ga0496106_0073572 | Ga0496106_0073572_650_1660 | 336 |
| 456 | 3300048910 | Ga0496107_0050803 | Ga0496107_0050803_332_1342 | 336 |
| 457 | 3300048912 | Ga0496109_0043436 | Ga0496109_0043436_307_1317 | 336 |
| 458 | 3300048913 | Ga0496110_0409257 | Ga0496110_0409257_65_1075 | 336 |
| 459 | 3300048917 | Ga0496114_0090600 | Ga0496114_0090600_755_1765 | 336 |
| 460 | 3300048924 | Ga0496121_0027380 | Ga0496121_0027380_1248_2258 | 336 |
| 461 | 3300048928 | Ga0496125_0002222 | Ga0496125_0002222_22097_23140 | 336 |
| 462 | 3300048928 | Ga0496125_0147665 | Ga0496125_0147665_428_1450 | 336 |
| 463 | 3300049588 | Ga0501072_0278487 | Ga0501072_0278487_227_1240 | 336 |
| 464 | 3300050489 | nmdc:mga03683_7666_c1 | nmdc:mga03683_7666_c1_652_1662 | 336 |
| 465 | 3300050493 | nmdc:mga0k408_121504_c1 | nmdc:mga0k408_121504_c1_344_1354 | 336 |
| 466 | 3300050493 | nmdc:mga0k408_25213_c1 | nmdc:mga0k408_25213_c1_120_1130 | 336 |
| 467 | 3300050493 | nmdc:mga0k408_5413_c1 | nmdc:mga0k408_5413_c1_4964_5974 | 336 |
| 468 | 3300050493 | nmdc:mga0k408_98158_c1 | nmdc:mga0k408_98158_c1_390_1412 | 336 |
| 469 | 3300053079 | Ga0500610_0005747 | Ga0500610_0005747_2667_3677 | 336 |
| 470 | 3300053088 | Ga0500644_0001249 | Ga0500644_0001249_4238_5248 | 336 |
| 471 | 3300053088 | Ga0500644_0026181 | Ga0500644_0026181_404_1414 | 336 |
| 472 | 3300053096 | Ga0500641_0052029 | Ga0500641_0052029_188_1198 | 336 |
| 473 | 3300053117 | Ga0500593_000664 | Ga0500593_000664_9163_10173 | 336 |
| 474 | 3300053118 | Ga0500594_0000381 | Ga0500594_0000381_5317_6327 | 336 |
| 475 | 3300053121 | Ga0500607_000049 | Ga0500607_000049_71548_72558 | 336 |
| 476 | 3300053122 | Ga0500608_001834 | Ga0500608_001834_4682_5704 | 336 |
| 477 | 3300053136 | Ga0500559_0000021 | Ga0500559_0000021_89641_90651 | 336 |
| 478 | 3300053138 | Ga0500564_048639 | Ga0500564_048639_466_1476 | 336 |
| 479 | 3300053156 | Ga0500622_0001453 | Ga0500622_0001453_13190_14200 | 336 |
| 480 | 3300053158 | Ga0500627_0035571 | Ga0500627_0035571_348_1358 | 336 |
| 481 | 3300053161 | Ga0500634_0038870 | Ga0500634_0038870_735_1745 | 336 |
| 482 | 3300053177 | Ga0500636_0042897 | Ga0500636_0042897_73_1083 | 336 |
| 483 | 3300053730 | Ga0500645_000228 | Ga0500645_000228_5009_6019 | 336 |
| 484 | 3300053730 | Ga0500645_003067 | Ga0500645_003067_1499_2509 | 336 |
| 485 | 3300053730 | Ga0500645_005034 | Ga0500645_005034_390_1400 | 336 |
| 486 | 3300053739 | Ga0500587_000179 | Ga0500587_000179_5087_6097 | 336 |
| 487 | 3300001979 | JGI24740J21852_10032351 | JGI24740J21852_100323512 | 337 |
| 488 | 3300003322 | rootL2_10012652 | rootL2_100126525 | 337 |
| 489 | 3300003574 | Ga0007410J51695_1034327 | Ga0007410J51695_10343271 | 337 |
| 490 | 3300003579 | Ga0007429J51699_1050987 | Ga0007429J51699_10509871 | 337 |
| 491 | 3300003693 | Ga0032354_1019303 | Ga0032354_10193031 | 337 |
| 492 | 3300003761 | Ga0055535_1000378 | Ga0055535_100037816 | 337 |
| 493 | 3300003762 | Ga0055542_1000036 | Ga0055542_1000036189 | 337 |
| 494 | 3300003771 | Ga0055526_1005065 | Ga0055526_10050657 | 337 |
| 495 | 3300003773 | Ga0055537_1000541 | Ga0055537_100054114 | 337 |
| 496 | 3300003773 | Ga0055537_1003257 | Ga0055537_10032573 | 337 |
| 497 | 3300003775 | Ga0055524_1003426 | Ga0055524_10034263 | 337 |
| 498 | 3300003781 | Ga0055536_1001912 | Ga0055536_10019127 | 337 |
| 499 | 3300003781 | Ga0055536_1007703 | Ga0055536_10077031 | 337 |
| 500 | 3300003781 | Ga0055536_1008036 | Ga0055536_10080364 | 337 |
| 501 | 3300003784 | Ga0055534_1000491 | Ga0055534_100049114 | 337 |
| 502 | 3300003784 | Ga0055534_1012575 | Ga0055534_10125752 | 337 |
| 503 | 3300003790 | Ga0055528_1000927 | Ga0055528_10009278 | 337 |
| 504 | 3300003790 | Ga0055528_1006976 | Ga0055528_10069763 | 337 |
| 505 | 3300003791 | Ga0055530_10001000 | Ga0055530_100010007 | 337 |
| 506 | 3300003791 | Ga0055530_10005427 | Ga0055530_100054275 | 337 |
| 507 | 3300003792 | Ga0055540_1002459 | Ga0055540_10024596 | 337 |
| 508 | 3300003792 | Ga0055540_1004268 | Ga0055540_10042685 | 337 |
| 509 | 3300003792 | Ga0055540_1019857 | Ga0055540_10198572 | 337 |
| 510 | 3300003794 | Ga0055531_10001971 | Ga0055531_100019718 | 337 |
| 511 | 3300003794 | Ga0055531_10004950 | Ga0055531_100049503 | 337 |
| 512 | 3300004625 | Ga0055543_1006181 | Ga0055543_10061813 | 337 |
| 513 | 3300005328 | Ga0070676_10044472 | Ga0070676_100444724 | 337 |
| 514 | 3300005334 | Ga0068869_100173081 | Ga0068869_1001730812 | 337 |
| 515 | 3300005335 | Ga0070666_10023526 | Ga0070666_100235262 | 337 |
| 516 | 3300005338 | Ga0068868_100060809 | Ga0068868_1000608094 | 337 |
| 517 | 3300005354 | Ga0070675_100015016 | Ga0070675_1000150162 | 337 |
| 518 | 3300005355 | Ga0070671_100048597 | Ga0070671_1000485972 | 337 |
| 519 | 3300005356 | Ga0070674_100174012 | Ga0070674_1001740121 | 337 |
| 520 | 3300005364 | Ga0070673_100127277 | Ga0070673_1001272772 | 337 |
| 521 | 3300005445 | Ga0070708_100009421 | Ga0070708_1000094214 | 337 |
| 522 | 3300005455 | Ga0070663_100023491 | Ga0070663_1000234911 | 337 |
| 523 | 3300005456 | Ga0070678_100057815 | Ga0070678_1000578153 | 337 |
| 524 | 3300005457 | Ga0070662_100005652 | Ga0070662_1000056522 | 337 |
| 525 | 3300005457 | Ga0070662_100346747 | Ga0070662_1003467471 | 337 |
| 526 | 3300005458 | Ga0070681_10363987 | Ga0070681_103639871 | 337 |
| 527 | 3300005459 | Ga0068867_100138994 | Ga0068867_1001389942 | 337 |
| 528 | 3300005468 | Ga0070707_100002457 | Ga0070707_1000024578 | 337 |
| 529 | 3300005471 | Ga0070698_100127696 | Ga0070698_1001276962 | 337 |
| 530 | 3300005518 | Ga0070699_100017017 | Ga0070699_1000170172 | 337 |
| 531 | 3300005530 | Ga0070679_100077751 | Ga0070679_1000777511 | 337 |
| 532 | 3300005539 | Ga0068853_100018520 | Ga0068853_1000185201 | 337 |
| 533 | 3300005543 | Ga0070672_100011595 | Ga0070672_1000115952 | 337 |
| 534 | 3300005543 | Ga0070672_100021295 | Ga0070672_1000212954 | 337 |
| 535 | 3300005548 | Ga0070665_100050614 | Ga0070665_1000506141 | 337 |
| 536 | 3300005548 | Ga0070665_100070637 | Ga0070665_1000706372 | 337 |
| 537 | 3300005564 | Ga0070664_100007153 | Ga0070664_1000071538 | 337 |
| 538 | 3300005577 | Ga0068857_100032041 | Ga0068857_1000320411 | 337 |
| 539 | 3300005577 | Ga0068857_100195744 | Ga0068857_1001957442 | 337 |
| 540 | 3300005616 | Ga0068852_100124830 | Ga0068852_1001248302 | 337 |
| 541 | 3300005718 | Ga0068866_10132879 | Ga0068866_101328792 | 337 |
| 542 | 3300005834 | Ga0068851_10019323 | Ga0068851_100193232 | 337 |
| 543 | 3300005841 | Ga0068863_100111901 | Ga0068863_1001119014 | 337 |
| 544 | 3300005843 | Ga0068860_100018974 | Ga0068860_1000189745 | 337 |
| 545 | 3300005843 | Ga0068860_100151032 | Ga0068860_1001510322 | 337 |
| 546 | 3300006028 | Ga0070717_10258504 | Ga0070717_102585042 | 337 |
| 547 | 3300006038 | Ga0075365_10006589 | Ga0075365_100065897 | 337 |
| 548 | 3300006042 | Ga0075368_10037677 | Ga0075368_100376772 | 337 |
| 549 | 3300006048 | Ga0075363_100012444 | Ga0075363_1000124443 | 337 |
| 550 | 3300006048 | Ga0075363_100017985 | Ga0075363_1000179853 | 337 |
| 551 | 3300006051 | Ga0075364_10032617 | Ga0075364_100326174 | 337 |
| 552 | 3300006177 | Ga0075362_10007235 | Ga0075362_100072353 | 337 |
| 553 | 3300006178 | Ga0075367_10003595 | Ga0075367_100035952 | 337 |
| 554 | 3300006186 | Ga0075369_10042042 | Ga0075369_100420421 | 337 |
| 555 | 3300006195 | Ga0075366_10001162 | Ga0075366_100011625 | 337 |
| 556 | 3300006195 | Ga0075366_10025893 | Ga0075366_100258934 | 337 |
| 557 | 3300006195 | Ga0075366_10147607 | Ga0075366_101476072 | 337 |
| 558 | 3300006353 | Ga0075370_10000374 | Ga0075370_100003744 | 337 |
| 559 | 3300006353 | Ga0075370_10001917 | Ga0075370_100019171 | 337 |
| 560 | 3300006353 | Ga0075370_10039180 | Ga0075370_100391803 | 337 |
| 561 | 3300006353 | Ga0075370_10124972 | Ga0075370_101249722 | 337 |
| 562 | 3300006880 | Ga0075429_100002916 | Ga0075429_1000029169 | 337 |
| 563 | 3300006881 | Ga0068865_100159390 | Ga0068865_1001593902 | 337 |
| 564 | 3300006948 | Ga0099826_10001740 | Ga0099826_100017406 | 337 |
| 565 | 3300009093 | Ga0105240_10039983 | Ga0105240_100399835 | 337 |
| 566 | 3300009147 | Ga0114129_10071266 | Ga0114129_100712665 | 337 |
| 567 | 3300009148 | Ga0105243_10061249 | Ga0105243_100612492 | 337 |
| 568 | 3300009148 | Ga0105243_10149034 | Ga0105243_101490342 | 337 |
| 569 | 3300009545 | Ga0105237_10009701 | Ga0105237_100097012 | 337 |
| 570 | 3300009545 | Ga0105237_10155780 | Ga0105237_101557802 | 337 |
| 571 | 3300010375 | Ga0105239_10043224 | Ga0105239_100432241 | 337 |
| 572 | 3300010375 | Ga0105239_10446611 | Ga0105239_104466112 | 337 |
| 573 | 3300013100 | Ga0157373_10026668 | Ga0157373_100266682 | 337 |
| 574 | 3300013104 | Ga0157370_10009310 | Ga0157370_100093107 | 337 |
| 575 | 3300013104 | Ga0157370_10293098 | Ga0157370_102930982 | 337 |
| 576 | 3300013307 | Ga0157372_10038299 | Ga0157372_100382994 | 337 |
| 577 | 3300013308 | Ga0157375_10126822 | Ga0157375_101268224 | 337 |
| 578 | 3300014326 | Ga0157380_10187607 | Ga0157380_101876072 | 337 |
| 579 | 3300014497 | Ga0182008_10003813 | Ga0182008_100038136 | 337 |
| 580 | 3300015261 | Ga0182006_1002649 | Ga0182006_10026493 | 337 |
| 581 | 3300015262 | Ga0182007_10003708 | Ga0182007_100037082 | 337 |
| 582 | 3300017792 | Ga0163161_10066436 | Ga0163161_100664362 | 337 |
| 583 | 3300025228 | Ga0209672_101649 | Ga0209672_1016496 | 337 |
| 584 | 3300025229 | Ga0209147_100472 | Ga0209147_10047210 | 337 |
| 585 | 3300025242 | Ga0209258_100091 | Ga0209258_100091190 | 337 |
| 586 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033294 | 337 |
| 587 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020208 | 337 |
| 588 | 3300025263 | Ga0209565_1001505 | Ga0209565_10015052 | 337 |
| 589 | 3300025273 | Ga0209673_1000154 | Ga0209673_100015418 | 337 |
| 590 | 3300025273 | Ga0209673_1000350 | Ga0209673_10003509 | 337 |
| 591 | 3300025284 | Ga0209130_1000782 | Ga0209130_100078217 | 337 |
| 592 | 3300025291 | Ga0209675_1000014 | Ga0209675_1000014197 | 337 |
| 593 | 3300025291 | Ga0209675_1010718 | Ga0209675_10107182 | 337 |
| 594 | 3300025292 | Ga0209676_1000048 | Ga0209676_100004829 | 337 |
| 595 | 3300025292 | Ga0209676_1000433 | Ga0209676_100043356 | 337 |
| 596 | 3300025294 | Ga0209025_1012640 | Ga0209025_10126406 | 337 |
| 597 | 3300025295 | Ga0209564_1000103 | Ga0209564_100010324 | 337 |
| 598 | 3300025298 | Ga0209050_1000012 | Ga0209050_100001229 | 337 |
| 599 | 3300025298 | Ga0209050_1000511 | Ga0209050_100051116 | 337 |
| 600 | 3300025299 | Ga0209256_1000650 | Ga0209256_100065030 | 337 |
| 601 | 3300025302 | Ga0207426_1000161 | Ga0207426_1000161144 | 337 |
| 602 | 3300025303 | Ga0209051_1000273 | Ga0209051_100027345 | 337 |
| 603 | 3300025303 | Ga0209051_1000326 | Ga0209051_100032649 | 337 |
| 604 | 3300025304 | Ga0209257_1000249 | Ga0209257_100024944 | 337 |
| 605 | 3300025304 | Ga0209257_1002775 | Ga0209257_10027759 | 337 |
| 606 | 3300025728 | Ga0207655_1007062 | Ga0207655_10070625 | 337 |
| 607 | 3300025903 | Ga0207680_10033768 | Ga0207680_100337682 | 337 |
| 608 | 3300025907 | Ga0207645_10034688 | Ga0207645_100346884 | 337 |
| 609 | 3300025913 | Ga0207695_10111304 | Ga0207695_101113042 | 337 |
| 610 | 3300025914 | Ga0207671_10008666 | Ga0207671_100086661 | 337 |
| 611 | 3300025914 | Ga0207671_10183100 | Ga0207671_101831002 | 337 |
| 612 | 3300025914 | Ga0207671_10218062 | Ga0207671_102180622 | 337 |
| 613 | 3300025921 | Ga0207652_10049635 | Ga0207652_100496352 | 337 |
| 614 | 3300025922 | Ga0207646_10000722 | Ga0207646_1000072225 | 337 |
| 615 | 3300025926 | Ga0207659_10098242 | Ga0207659_100982422 | 337 |
| 616 | 3300025931 | Ga0207644_10029391 | Ga0207644_100293912 | 337 |
| 617 | 3300025933 | Ga0207706_10057340 | Ga0207706_100573402 | 337 |
| 618 | 3300025933 | Ga0207706_10322990 | Ga0207706_103229902 | 337 |
| 619 | 3300025935 | Ga0207709_10001312 | Ga0207709_100013125 | 337 |
| 620 | 3300025937 | Ga0207669_10109283 | Ga0207669_101092832 | 337 |
| 621 | 3300025938 | Ga0207704_10099163 | Ga0207704_100991632 | 337 |
| 622 | 3300025938 | Ga0207704_10198283 | Ga0207704_101982831 | 337 |
| 623 | 3300025940 | Ga0207691_10009883 | Ga0207691_100098835 | 337 |
| 624 | 3300025942 | Ga0207689_10165773 | Ga0207689_101657732 | 337 |
| 625 | 3300025945 | Ga0207679_10006620 | Ga0207679_100066202 | 337 |
| 626 | 3300025960 | Ga0207651_10181019 | Ga0207651_101810192 | 337 |
| 627 | 3300025960 | Ga0207651_10341546 | Ga0207651_103415462 | 337 |
| 628 | 3300026023 | Ga0207677_10038687 | Ga0207677_100386871 | 337 |
| 629 | 3300026088 | Ga0207641_10280663 | Ga0207641_102806631 | 337 |
| 630 | 3300026089 | Ga0207648_10080841 | Ga0207648_100808414 | 337 |
| 631 | 3300026089 | Ga0207648_10128690 | Ga0207648_101286903 | 337 |
| 632 | 3300026089 | Ga0207648_10203958 | Ga0207648_102039582 | 337 |
| 633 | 3300026089 | Ga0207648_10221002 | Ga0207648_102210022 | 337 |
| 634 | 3300026116 | Ga0207674_10016615 | Ga0207674_100166154 | 337 |
| 635 | 3300026116 | Ga0207674_10053553 | Ga0207674_100535532 | 337 |
| 636 | 3300026116 | Ga0207674_10090185 | Ga0207674_100901852 | 337 |
| 637 | 3300026121 | Ga0207683_10173876 | Ga0207683_101738762 | 337 |
| 638 | 3300026121 | Ga0207683_10288444 | Ga0207683_102884442 | 337 |
| 639 | 3300026142 | Ga0207698_10098874 | Ga0207698_100988743 | 337 |
| 640 | 3300027866 | Ga0209813_10028074 | Ga0209813_100280742 | 337 |
| 641 | 3300028379 | Ga0268266_10034410 | Ga0268266_100344104 | 337 |
| 642 | 3300028381 | Ga0268264_10021238 | Ga0268264_100212386 | 337 |
| 643 | 3300028381 | Ga0268264_10277364 | Ga0268264_102773642 | 337 |
| 644 | 3300028786 | Ga0307517_10009612 | Ga0307517_100096128 | 337 |
| 645 | 3300028786 | Ga0307517_10162746 | Ga0307517_101627462 | 337 |
| 646 | 3300028794 | Ga0307515_10000367 | Ga0307515_1000036767 | 337 |
| 647 | 3300028794 | Ga0307515_10006221 | Ga0307515_100062216 | 337 |
| 648 | 3300028794 | Ga0307515_10089497 | Ga0307515_100894972 | 337 |
| 649 | 3300028794 | Ga0307515_10146266 | Ga0307515_101462661 | 337 |
| 650 | 3300030742 | Ga0316183_1046813 | Ga0316183_10468133 | 337 |
| 651 | 3300031456 | Ga0307513_10174139 | Ga0307513_101741392 | 337 |
| 652 | 3300031548 | Ga0307408_100101016 | Ga0307408_1001010163 | 337 |
| 653 | 3300031548 | Ga0307408_100300404 | Ga0307408_1003004042 | 337 |
| 654 | 3300031616 | Ga0307508_10000041 | Ga0307508_10000041117 | 337 |
| 655 | 3300031616 | Ga0307508_10010688 | Ga0307508_100106886 | 337 |
| 656 | 3300031649 | Ga0307514_10006116 | Ga0307514_100061168 | 337 |
| 657 | 3300031649 | Ga0307514_10036313 | Ga0307514_100363134 | 337 |
| 658 | 3300031852 | Ga0307410_10135230 | Ga0307410_101352302 | 337 |
| 659 | 3300031901 | Ga0307406_10033190 | Ga0307406_100331903 | 337 |
| 660 | 3300031903 | Ga0307407_10267635 | Ga0307407_102676352 | 337 |
| 661 | 3300031911 | Ga0307412_10055103 | Ga0307412_100551032 | 337 |
| 662 | 3300031911 | Ga0307412_10079068 | Ga0307412_100790683 | 337 |
| 663 | 3300032002 | Ga0307416_100425603 | Ga0307416_1004256031 | 337 |
| 664 | 3300032004 | Ga0307414_10127449 | Ga0307414_101274492 | 337 |
| 665 | 3300032004 | Ga0307414_10325684 | Ga0307414_103256842 | 337 |
| 666 | 3300032005 | Ga0307411_10012599 | Ga0307411_100125994 | 337 |
| 667 | 3300033180 | Ga0307510_10015773 | Ga0307510_100157735 | 337 |
| 668 | 3300033180 | Ga0307510_10086046 | Ga0307510_100860462 | 337 |
| 669 | 3300035112 | Ga0373932_0021658 | Ga0373932_0021658_473_1492 | 337 |
| 670 | 3300037471 | Ga0395905_0000279 | Ga0395905_0000279_9285_10322 | 337 |
| 671 | 3300037471 | Ga0395905_0025964 | Ga0395905_0025964_2330_3343 | 337 |
| 672 | 3300037471 | Ga0395905_0094788 | Ga0395905_0094788_1589_2623 | 337 |
| 673 | 3300041411 | Ga0439466_0005209 | Ga0439466_0005209_1787_2812 | 337 |
| 674 | 3300041999 | Ga0439433_0017026 | Ga0439433_0017026_248_1279 | 337 |
| 675 | 3300042007 | Ga0439449_0000172 | Ga0439449_0000172_314_1345 | 337 |
| 676 | 3300042123 | Ga0450921_000615 | Ga0450921_000615_204_1229 | 337 |
| 677 | 3300042184 | Ga0450908_000944 | Ga0450908_000944_3458_4483 | 337 |
| 678 | 3300042435 | Ga0439434_0003820 | Ga0439434_0003820_2407_3432 | 337 |
| 679 | 3300042435 | Ga0439434_0005330 | Ga0439434_0005330_1838_2860 | 337 |
| 680 | 3300042531 | Ga0450918_005030 | Ga0450918_005030_815_1840 | 337 |
| 681 | 3300044712 | Ga0453684_0466244 | Ga0453684_0466244_289_1359 | 337 |
| 682 | 3300045051 | Ga0451576_0005927 | Ga0451576_0005927_9630_10700 | 337 |
| 683 | 3300046457 | Ga0495590_0046063 | Ga0495590_0046063_138_1157 | 337 |
| 684 | 3300046460 | Ga0495638_0025109 | Ga0495638_0025109_1879_2895 | 337 |
| 685 | 3300046460 | Ga0495638_0078466 | Ga0495638_0078466_822_1835 | 337 |
| 686 | 3300046471 | Ga0495650_0000011 | Ga0495650_0000011_557171_558211 | 337 |
| 687 | 3300046491 | Ga0495584_0009010 | Ga0495584_0009010_3504_4517 | 337 |
| 688 | 3300046491 | Ga0495584_0064163 | Ga0495584_0064163_577_1593 | 337 |
| 689 | 3300046492 | Ga0495585_0001878 | Ga0495585_0001878_4544_5560 | 337 |
| 690 | 3300046501 | Ga0495607_0010905 | Ga0495607_0010905_3189_4202 | 337 |
| 691 | 3300046506 | Ga0495583_0000549 | Ga0495583_0000549_18808_19824 | 337 |
| 692 | 3300046506 | Ga0495583_0006755 | Ga0495583_0006755_2041_3054 | 337 |
| 693 | 3300046506 | Ga0495583_0042590 | Ga0495583_0042590_399_1415 | 337 |
| 694 | 3300046507 | Ga0495606_0002140 | Ga0495606_0002140_4411_5424 | 337 |
| 695 | 3300046512 | Ga0495610_0040205 | Ga0495610_0040205_936_1964 | 337 |
| 696 | 3300046513 | Ga0495616_0001816 | Ga0495616_0001816_8227_9243 | 337 |
| 697 | 3300046515 | Ga0495620_0047852 | Ga0495620_0047852_778_1797 | 337 |
| 698 | 3300046518 | Ga0495631_0000752 | Ga0495631_0000752_11005_12021 | 337 |
| 699 | 3300046518 | Ga0495631_0000901 | Ga0495631_0000901_9614_10642 | 337 |
| 700 | 3300046519 | Ga0495632_0037620 | Ga0495632_0037620_250_1269 | 337 |
| 701 | 3300046522 | Ga0495643_0057541 | Ga0495643_0057541_174_1190 | 337 |
| 702 | 3300046524 | Ga0495648_0072704 | Ga0495648_0072704_316_1332 | 337 |
| 703 | 3300046528 | Ga0495642_0030467 | Ga0495642_0030467_122_1135 | 337 |
| 704 | 3300046530 | Ga0495654_0014744 | Ga0495654_0014744_881_1909 | 337 |
| 705 | 3300046538 | Ga0495609_0000054 | Ga0495609_0000054_104042_105055 | 337 |
| 706 | 3300046539 | Ga0495621_0003864 | Ga0495621_0003864_1255_2271 | 337 |
| 707 | 3300046539 | Ga0495621_0034720 | Ga0495621_0034720_107_1126 | 337 |
| 708 | 3300046558 | Ga0495633_0002572 | Ga0495633_0002572_2913_3929 | 337 |
| 709 | 3300046615 | Ga0495656_0000383 | Ga0495656_0000383_4549_5568 | 337 |
| 710 | 3300046616 | Ga0495668_0000458 | Ga0495668_0000458_22046_23059 | 337 |
| 711 | 3300046616 | Ga0495668_0014948 | Ga0495668_0014948_833_1849 | 337 |
| 712 | 3300046616 | Ga0495668_0020313 | Ga0495668_0020313_2672_3685 | 337 |
| 713 | 3300046616 | Ga0495668_0093881 | Ga0495668_0093881_118_1146 | 337 |
| 714 | 3300046648 | Ga0495611_0004982 | Ga0495611_0004982_3911_4927 | 337 |
| 715 | 3300046660 | Ga0495625_0001565 | Ga0495625_0001565_19999_21024 | 337 |
| 716 | 3300046665 | Ga0495661_0000603 | Ga0495661_0000603_24517_25533 | 337 |
| 717 | 3300046683 | Ga0495658_0109821 | Ga0495658_0109821_247_1275 | 337 |
| 718 | 3300046684 | Ga0495669_0010367 | Ga0495669_0010367_2068_3081 | 337 |
| 719 | 3300046691 | Ga0495670_0000525 | Ga0495670_0000525_10982_11998 | 337 |
| 720 | 3300046692 | Ga0495671_0093306 | Ga0495671_0093306_359_1372 | 337 |
| 721 | 3300046694 | Ga0495649_0001093 | Ga0495649_0001093_14680_15699 | 337 |
| 722 | 3300046694 | Ga0495649_0012427 | Ga0495649_0012427_3543_4556 | 337 |
| 723 | 3300046694 | Ga0495649_0099234 | Ga0495649_0099234_245_1264 | 337 |
| 724 | 3300046810 | Ga0495660_0005348 | Ga0495660_0005348_6312_7331 | 337 |
| 725 | 3300047318 | Ga0495636_0007366 | Ga0495636_0007366_413_1426 | 337 |
| 726 | 3300047321 | Ga0495676_0049869 | Ga0495676_0049869_1262_2281 | 337 |
| 727 | 3300047321 | Ga0495676_0094516 | Ga0495676_0094516_901_1917 | 337 |
| 728 | 3300047443 | Ga0495687_000272 | Ga0495687_000272_13479_14498 | 337 |
| 729 | 3300047443 | Ga0495687_021798 | Ga0495687_021798_2007_3026 | 337 |
| 730 | 3300047445 | Ga0495677_0005597 | Ga0495677_0005597_2984_4000 | 337 |
| 731 | 3300047445 | Ga0495677_0007304 | Ga0495677_0007304_2662_3675 | 337 |
| 732 | 3300047446 | Ga0495679_023319 | Ga0495679_023319_984_1997 | 337 |
| 733 | 3300047470 | Ga0495681_0001920 | Ga0495681_0001920_11196_12212 | 337 |
| 734 | 3300047470 | Ga0495681_0009981 | Ga0495681_0009981_3107_4120 | 337 |
| 735 | 3300047472 | Ga0495686_0000456 | Ga0495686_0000456_43636_44652 | 337 |
| 736 | 3300047472 | Ga0495686_0004521 | Ga0495686_0004521_7191_8204 | 337 |
| 737 | 3300047673 | Ga0495593_0057061 | Ga0495593_0057061_582_1598 | 337 |
| 738 | 3300048091 | Ga0495626_0032593 | Ga0495626_0032593_1324_2343 | 337 |
| 739 | 3300048905 | Ga0496102_0031313 | Ga0496102_0031313_496_1512 | 337 |
| 740 | 3300048905 | Ga0496102_0116504 | Ga0496102_0116504_1424_2440 | 337 |
| 741 | 3300048906 | Ga0496103_0252587 | Ga0496103_0252587_34_1050 | 337 |
| 742 | 3300048920 | Ga0496117_0007943 | Ga0496117_0007943_53_1081 | 337 |
| 743 | 3300048921 | Ga0496118_0035594 | Ga0496118_0035594_79_1092 | 337 |
| 744 | 3300048926 | Ga0496123_0066840 | Ga0496123_0066840_1066_2082 | 337 |
| 745 | 3300048927 | Ga0496124_0034024 | Ga0496124_0034024_1918_2946 | 337 |
| 746 | 3300048927 | Ga0496124_0043133 | Ga0496124_0043133_2808_3821 | 337 |
| 747 | 3300048927 | Ga0496124_0260797 | Ga0496124_0260797_156_1175 | 337 |
| 748 | 3300048928 | Ga0496125_0076280 | Ga0496125_0076280_1493_2521 | 337 |
| 749 | 3300048928 | Ga0496125_0084519 | Ga0496125_0084519_28_1041 | 337 |
| 750 | 3300049537 | Ga0501321_001463 | Ga0501321_001463_369_1403 | 337 |
| 751 | 3300049759 | Ga0501262_001309 | Ga0501262_001309_1136_2149 | 337 |
| 752 | 3300050490 | nmdc:mga03n38_23386_c1 | nmdc:mga03n38_23386_c1_345_1358 | 337 |
| 753 | 3300050490 | nmdc:mga03n38_9776_c1 | nmdc:mga03n38_9776_c1_1707_2732 | 337 |
| 754 | 3300050492 | nmdc:mga0yw44_11476_c1 | nmdc:mga0yw44_11476_c1_1385_2398 | 337 |
| 755 | 3300050493 | nmdc:mga0k408_2239_c1 | nmdc:mga0k408_2239_c1_8317_9336 | 337 |
| 756 | 3300050493 | nmdc:mga0k408_26694_c1 | nmdc:mga0k408_26694_c1_414_1433 | 337 |
| 757 | 3300050493 | nmdc:mga0k408_3111_c1 | nmdc:mga0k408_3111_c1_6870_7889 | 337 |
| 758 | 3300050493 | nmdc:mga0k408_43050_c1 | nmdc:mga0k408_43050_c1_1546_2565 | 337 |
| 759 | 3300050493 | nmdc:mga0k408_51645_c1 | nmdc:mga0k408_51645_c1_647_1660 | 337 |
| 760 | 3300050494 | nmdc:mga06z11_165112_c1 | nmdc:mga06z11_165112_c1_79_1098 | 337 |
| 761 | 3300050494 | nmdc:mga06z11_82589_c1 | nmdc:mga06z11_82589_c1_492_1517 | 337 |
| 762 | 3300050496 | nmdc:mga07m45_16459_c1 | nmdc:mga07m45_16459_c1_1613_2632 | 337 |
| 763 | 3300050496 | nmdc:mga07m45_17988_c1 | nmdc:mga07m45_17988_c1_1488_2507 | 337 |
| 764 | 3300050496 | nmdc:mga07m45_252_c1 | nmdc:mga07m45_252_c1_6996_8015 | 337 |
| 765 | 3300050496 | nmdc:mga07m45_3121_c1 | nmdc:mga07m45_3121_c1_299_1315 | 337 |
| 766 | 3300050496 | nmdc:mga07m45_67744_c1 | nmdc:mga07m45_67744_c1_328_1347 | 337 |
| 767 | 3300050507 | nmdc:mga05p37_112973_c1 | nmdc:mga05p37_112973_c1_1107_2123 | 337 |
| 768 | 3300050508 | nmdc:mga09592_1120_c1 | nmdc:mga09592_1120_c1_10782_11804 | 337 |
| 769 | 3300053093 | Ga0500651_0000082 | Ga0500651_0000082_34929_35957 | 337 |
| 770 | 3300053110 | Ga0500571_000152 | Ga0500571_000152_7705_8721 | 337 |
| 771 | 3300053116 | Ga0500592_006756 | Ga0500592_006756_81_1109 | 337 |
| 772 | 3300053118 | Ga0500594_0001035 | Ga0500594_0001035_1886_2914 | 337 |
| 773 | 3300053120 | Ga0500597_053624 | Ga0500597_053624_149_1177 | 337 |
| 774 | 3300053125 | Ga0500618_000085 | Ga0500618_000085_48689_49702 | 337 |
| 775 | 3300053131 | Ga0500652_062342 | Ga0500652_062342_494_1513 | 337 |
| 776 | 3300053133 | Ga0500655_001890 | Ga0500655_001890_1965_2981 | 337 |
| 777 | 3300053134 | Ga0500658_0001380 | Ga0500658_0001380_4896_5924 | 337 |
| 778 | 3300053134 | Ga0500658_0001412 | Ga0500658_0001412_4404_5432 | 337 |
| 779 | 3300053134 | Ga0500658_0002901 | Ga0500658_0002901_2143_3162 | 337 |
| 780 | 3300053138 | Ga0500564_012785 | Ga0500564_012785_1654_2670 | 337 |
| 781 | 3300053139 | Ga0500568_0002320 | Ga0500568_0002320_2172_3200 | 337 |
| 782 | 3300053141 | Ga0500574_000300 | Ga0500574_000300_1940_2968 | 337 |
| 783 | 3300053161 | Ga0500634_0051321 | Ga0500634_0051321_1009_2037 | 337 |
| 784 | 3300053162 | Ga0500638_000234 | Ga0500638_000234_7359_8375 | 337 |
| 785 | 3300053177 | Ga0500636_0030537 | Ga0500636_0030537_1050_2066 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ghy-assembly3.cif.gz_A | crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 | 0.975 | 2 | 322 |
| 7fgp-assembly1.cif.gz_A | crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) | 0.9687 | 1 | 28 |
| 3ghy-assembly3.cif.gz_B | crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 | 0.9661 | 3 | 324 |
| 3ka7-assembly1.cif.gz_A | crystal structure of an oxidoreductase from methanosarcina mazei. northeast structural genomics consortium target id mar208 | 0.9546 | 1 | 28 |
| 3ghy-assembly3.cif.gz_A | crystal structure of a putative ketopantoate reductase from ralstonia solanacearum molk2 | 0.9512 | 2 | 322 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75728_4_256_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9834 | 2 | 29 | 3.50.50.60 |
| 3ghyB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9659 | 3 | 196 | 3.40.50.720 |
| 3ghyA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9607 | 199 | 322 | 1.10.1040.10 |
| 3ghyB02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9522 | 199 | 324 | 1.10.1040.10 |
| af_Q2FZ31_2_179_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9462 | 2 | 27 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3Q9L1-F1-model_v4 | deleted | 0.9943 | 185 | 335 |
|
| AF-A0A435EZ16-F1-model_v4 | deleted | 0.9929 | 212 | 323 |
|
| AF-A0A4S1FUP0-F1-model_v4 | Oxidoreductase | 0.9928 | 215 | 312 |
GO:0005737
|
| AF-A0A7K0JYB5-F1-model_v4 | deleted | 0.9897 | 161 | 326 |
|
| AF-A0A3S1HP38-F1-model_v4 | 2-dehydropantoate 2-reductase | 0.9891 | 145 | 323 |
GO:0005737
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar