F480724

General Info

Members Datasets Scaffolds Average Seq Length
785 333 1570 171

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100095257|Ga0070670_1000952572
Length 195
Sequence MRVSRHPLHPDRPVVPVRPDPSRYNGPMRPDVEHKQHGPRSVRCFVLTVSDTRTEATDTGGAAVADLLTAAGHQCVGRAIVKDEAAQVRDAVEGQLASGNVDVVITTGGTGITSRDTTYEAVDALLDKRLDGFGELFRMLSYEQIGAAAMMSRATAGLVHGHIVIALPGSESAVRLAMEKLVIPEIGHMVQQARR

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
203 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
204 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
205 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
206 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
207 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
240 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
241 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
242 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
243 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
244 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
245 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
246 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
247 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
248 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
249 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
250 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
251 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
329 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
330 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
331 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.89
Nodule 0
Rhizoplane 3.82
Rhizosphere 94.78
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100095257 3300005331 Unclassified 2560
2 JGI24751J29686_10033137 3300002459 Bacteria 1071
3 JGI25406J46586_10011969 3300003203 Bacteria 3782
4 JGI25405J52794_10030776 3300003911 Bacteria 1114
5 Ga0065704_10243128 3300005289 Bacteria 1009
6 Ga0065704_10289401 3300005289 Bacteria 906
7 Ga0065715_10388329 3300005293 Bacteria 897
8 Ga0065715_10535512 3300005293 Bacteria 752
9 Ga0065707_10022274 3300005295 Bacteria 1572
10 Ga0065707_10113799 3300005295 Bacteria 2316
11 Ga0065707_10145947 3300005295 Bacteria 1714
12 Ga0070676_10000116 3300005328 Bacteria 29646
13 Ga0070676_10326497 3300005328 Bacteria 1048
14 Ga0070683_100037737 3300005329 Bacteria 4424
15 Ga0070683_100337204 3300005329 Bacteria 1435
16 Ga0070690_101020716 3300005330 Bacteria 652
17 Ga0070670_100026877 3300005331 Bacteria 4950
18 Ga0070670_100065390 3300005331 Bacteria 3120
19 Ga0070670_100535372 3300005331 Bacteria 1044
20 Ga0068869_100012164 3300005334 Bacteria 5676
21 Ga0068869_100027284 3300005334 Bacteria 3980
22 Ga0068869_100434672 3300005334 Unclassified 1085
23 Ga0070680_100003600 3300005336 Bacteria 11566
24 Ga0070680_100606527 3300005336 Bacteria 940
25 Ga0070680_101529360 3300005336 Bacteria 578
26 Ga0070682_100002609 3300005337 Bacteria 9954
27 Ga0070682_100039614 3300005337 Bacteria 2896
28 Ga0068868_100013271 3300005338 Bacteria 6037
29 Ga0068868_100058284 3300005338 Bacteria 3052
30 Ga0068868_100077287 3300005338 Bacteria 2663
31 Ga0068868_100399613 3300005338 Bacteria 1186
32 Ga0070660_100002786 3300005339 Bacteria 12003
33 Ga0070660_101321995 3300005339 Bacteria 612
34 Ga0070689_100000005 3300005340 Bacteria 396551
35 Ga0070689_100054103 3300005340 Bacteria 3107
36 Ga0070689_100221986 3300005340 Bacteria 1550
37 Ga0070691_10001345 3300005341 Bacteria 10475
38 Ga0070691_10080492 3300005341 Bacteria 1594
39 Ga0070687_100043089 3300005343 Bacteria 2291
40 Ga0070661_100000595 3300005344 Bacteria 27099
41 Ga0070692_10001137 3300005345 Bacteria 9334
42 Ga0070692_10559566 3300005345 Bacteria 750
43 Ga0070668_100530057 3300005347 Bacteria 1023
44 Ga0070668_100779254 3300005347 Bacteria 848
45 Ga0070669_100292880 3300005353 Bacteria 1307
46 Ga0070675_100080705 3300005354 Bacteria 2711
47 Ga0070675_100217980 3300005354 Unclassified 1661
48 Ga0070675_100397108 3300005354 Bacteria 1230
49 Ga0070671_100161799 3300005355 Bacteria 1892
50 Ga0070674_100047013 3300005356 Bacteria 2955
51 Ga0070673_100027523 3300005364 Bacteria 4216
52 Ga0070673_101297551 3300005364 Bacteria 684
53 Ga0070688_100962791 3300005365 Bacteria 676
54 Ga0070659_100002065 3300005366 Bacteria 14330
55 Ga0070667_100111184 3300005367 Bacteria 2376
56 Ga0070667_100193625 3300005367 Bacteria 1802
57 Ga0070703_10006193 3300005406 Bacteria 3347
58 Ga0070703_10057078 3300005406 Bacteria 1266
59 Ga0070713_100726992 3300005436 Bacteria 949
60 Ga0070701_10303901 3300005438 Bacteria 982
61 Ga0070711_100276910 3300005439 Bacteria 1326
62 Ga0070711_100356100 3300005439 Bacteria 1178
63 Ga0070705_100001948 3300005440 Bacteria 10577
64 Ga0070705_100042433 3300005440 Bacteria 2600
65 Ga0070700_100214677 3300005441 Bacteria 1360
66 Ga0070700_100292740 3300005441 Bacteria 1185
67 Ga0070694_100007021 3300005444 Bacteria 6849
68 Ga0070694_100013273 3300005444 Bacteria 5144
69 Ga0070708_100119702 3300005445 Bacteria 2427
70 Ga0070708_100122271 3300005445 Bacteria 2402
71 Ga0070663_101469307 3300005455 Bacteria 605
72 Ga0070678_100019111 3300005456 Bacteria 4458
73 Ga0070678_100499322 3300005456 Bacteria 1073
74 Ga0070678_101147045 3300005456 Bacteria 719
75 Ga0070662_100012887 3300005457 Bacteria 5556
76 Ga0070662_100941998 3300005457 Bacteria 738
77 Ga0070681_10005234 3300005458 Bacteria 12529
78 Ga0070681_10108754 3300005458 Bacteria 2712
79 Ga0070681_10410937 3300005458 Bacteria 1265
80 Ga0070681_11346630 3300005458 Bacteria 637
81 Ga0068867_100001574 3300005459 Bacteria 15863
82 Ga0068867_100083342 3300005459 Bacteria 2414
83 Ga0068867_100206052 3300005459 Bacteria 1576
84 Ga0068867_100520537 3300005459 Unclassified 1025
85 Ga0068867_101630028 3300005459 Bacteria 604
86 Ga0070706_100018784 3300005467 Bacteria 6374
87 Ga0070706_100022971 3300005467 Bacteria 5744
88 Ga0070706_100181685 3300005467 Bacteria 1964
89 Ga0070706_100255111 3300005467 Bacteria 1637
90 Ga0070706_100278057 3300005467 Bacteria 1562
91 Ga0070706_100355982 3300005467 Bacteria 1364
92 Ga0070707_100097104 3300005468 Bacteria 2854
93 Ga0070707_100275007 3300005468 Bacteria 1637
94 Ga0070707_100739498 3300005468 Bacteria 947
95 Ga0070707_100784092 3300005468 Bacteria 917
96 Ga0070698_100030811 3300005471 Bacteria 5562
97 Ga0070698_100090616 3300005471 Bacteria 3041
98 Ga0070698_100094976 3300005471 Bacteria 2960
99 Ga0070698_100192714 3300005471 Bacteria 1975
100 Ga0070698_100250391 3300005471 Bacteria 1704
101 Ga0070698_100268561 3300005471 Bacteria 1637
102 Ga0070698_101151062 3300005471 Bacteria 725
103 Ga0070699_100003176 3300005518 Bacteria 14548
104 Ga0070699_100011585 3300005518 Bacteria 7613
105 Ga0070699_100219217 3300005518 Bacteria 1695
106 Ga0070699_100439846 3300005518 Bacteria 1182
107 Ga0070679_100005377 3300005530 Bacteria 11860
108 Ga0070679_100005879 3300005530 Bacteria 11395
109 Ga0070679_100053938 3300005530 Bacteria 4002
110 Ga0070679_100090537 3300005530 Bacteria 3048
111 Ga0070679_100123254 3300005530 Bacteria 2575
112 Ga0070679_100227341 3300005530 Bacteria 1826
113 Ga0070684_100121225 3300005535 Bacteria 2353
114 Ga0070697_100015520 3300005536 Bacteria 5979
115 Ga0070697_100058966 3300005536 Bacteria 3124
116 Ga0070697_100131627 3300005536 Bacteria 2098
117 Ga0070697_100665112 3300005536 Bacteria 918
118 Ga0068853_100000603 3300005539 Bacteria 24677
119 Ga0068853_100000925 3300005539 Bacteria 20536
120 Ga0070672_100020586 3300005543 Bacteria 4815
121 Ga0070672_100261643 3300005543 Bacteria 1459
122 Ga0070672_100266595 3300005543 Unclassified 1445
123 Ga0070686_100113009 3300005544 Bacteria 1853
124 Ga0070686_100179940 3300005544 Bacteria 1501
125 Ga0070695_100000782 3300005545 Bacteria 17097
126 Ga0070695_100001312 3300005545 Bacteria 13746
127 Ga0070695_100041415 3300005545 Bacteria 2920
128 Ga0070695_100151206 3300005545 Bacteria 1620
129 Ga0070696_100003314 3300005546 Bacteria 10752
130 Ga0070696_100016434 3300005546 Bacteria 4984
131 Ga0070696_100152959 3300005546 Bacteria 1695
132 Ga0070693_100000954 3300005547 Bacteria 12832
133 Ga0070693_100032258 3300005547 Bacteria 2879
134 Ga0070693_100367240 3300005547 Bacteria 989
135 Ga0070693_100501527 3300005547 Bacteria 861
136 Ga0070665_100115542 3300005548 Bacteria 2687
137 Ga0070665_101761019 3300005548 Bacteria 626
138 Ga0070704_100030013 3300005549 Bacteria 3638
139 Ga0070704_100333509 3300005549 Bacteria 1275
140 Ga0068855_100000627 3300005563 Bacteria 43379
141 Ga0068855_100029918 3300005563 Bacteria 6513
142 Ga0068855_100147347 3300005563 Bacteria 2679
143 Ga0068855_100195175 3300005563 Bacteria 2281
144 Ga0068855_100589596 3300005563 Bacteria 1200
145 Ga0070664_100006124 3300005564 Bacteria 9731
146 Ga0068857_100013962 3300005577 Bacteria 6988
147 Ga0068857_100076363 3300005577 Bacteria 2988
148 Ga0068857_101661536 3300005577 Bacteria 624
149 Ga0068854_100008573 3300005578 Bacteria 6579
150 Ga0068854_100320115 3300005578 Bacteria 1260
151 Ga0068856_100004610 3300005614 Bacteria 13701
152 Ga0068856_100353131 3300005614 Bacteria 1489
153 Ga0070702_100094327 3300005615 Bacteria 1822
154 Ga0068852_100042562 3300005616 Bacteria 3845
155 Ga0068852_100105038 3300005616 Bacteria 2558
156 Ga0068859_100004838 3300005617 Bacteria 13707
157 Ga0068859_100022047 3300005617 Bacteria 6387
158 Ga0068859_100039001 3300005617 Bacteria 4764
159 Ga0068859_100132071 3300005617 Bacteria 2569
160 Ga0068859_100151480 3300005617 Bacteria 2395
161 Ga0068859_100265022 3300005617 Unclassified 1810
162 Ga0068859_100327309 3300005617 Bacteria 1626
163 Ga0068864_100004649 3300005618 Bacteria 11258
164 Ga0068864_100869997 3300005618 Bacteria 889
165 Ga0068866_10520031 3300005718 Bacteria 791
166 Ga0068866_10683780 3300005718 Bacteria 702
167 Ga0068861_100003283 3300005719 Bacteria 10704
168 Ga0068861_100140243 3300005719 Bacteria 1972
169 Ga0068861_100712613 3300005719 Bacteria 934
170 Ga0068851_10654763 3300005834 Bacteria 643
171 Ga0068870_10000227 3300005840 Bacteria 20692
172 Ga0068863_100072165 3300005841 Bacteria 3267
173 Ga0068863_100324164 3300005841 Bacteria 1497
174 Ga0068863_101319699 3300005841 Bacteria 728
175 Ga0068858_100062823 3300005842 Bacteria 3434
176 Ga0068858_100364854 3300005842 Bacteria 1385
177 Ga0068860_100005936 3300005843 Bacteria 12290
178 Ga0068860_100176333 3300005843 Bacteria 2066
179 Ga0068860_100429373 3300005843 Bacteria 1311
180 Ga0068860_100682235 3300005843 Bacteria 1036
181 Ga0068860_100716862 3300005843 Bacteria 1011
182 Ga0068860_101658562 3300005843 Bacteria 661
183 Ga0068862_100002127 3300005844 Bacteria 17853
184 Ga0068862_100009978 3300005844 Bacteria 7848
185 Ga0068862_100904003 3300005844 Bacteria 868
186 Ga0068862_100952603 3300005844 Bacteria 847
187 Ga0068862_101082140 3300005844 Unclassified 796
188 Ga0081455_10001074 3300005937 Bacteria 34380
189 Ga0081539_10000010 3300005985 Bacteria 484386
190 Ga0081539_10225612 3300005985 Bacteria 849
191 Ga0070715_10011152 3300006163 Bacteria 3228
192 Ga0070716_100010266 3300006173 Bacteria 4692
193 Ga0070712_100264025 3300006175 Bacteria 1380
194 Ga0075367_10092476 3300006178 Unclassified 1841
195 Ga0075366_10059435 3300006195 Bacteria 2271
196 Ga0097621_100074992 3300006237 Bacteria 2803
197 Ga0097621_100332792 3300006237 Unclassified 1347
198 Ga0097621_101141515 3300006237 Bacteria 733
199 Ga0068871_100897122 3300006358 Bacteria 821
200 Ga0075428_100031024 3300006844 Bacteria 5910
201 Ga0075428_100053936 3300006844 Bacteria 4405
202 Ga0075428_101701918 3300006844 Bacteria 658
203 Ga0075430_100029662 3300006846 Bacteria 4643
204 Ga0075430_100055234 3300006846 Bacteria 3340
205 Ga0075431_100053436 3300006847 Bacteria 4165
206 Ga0075431_100234276 3300006847 Bacteria 1870
207 Ga0075431_100741758 3300006847 Unclassified 958
208 Ga0075431_101407002 3300006847 Bacteria 657
209 Ga0075433_10192425 3300006852 Bacteria 1814
210 Ga0075433_10211926 3300006852 Unclassified 1721
211 Ga0075433_10305494 3300006852 Bacteria 1408
212 Ga0075433_10456777 3300006852 Bacteria 1126
213 Ga0075434_100030676 3300006871 Bacteria 5295
214 Ga0075434_100033031 3300006871 Bacteria 5105
215 Ga0075434_100358675 3300006871 Bacteria 1479
216 Ga0075434_100440687 3300006871 Bacteria 1324
217 Ga0075434_100779832 3300006871 Bacteria 972
218 Ga0075434_101522522 3300006871 Bacteria 678
219 Ga0075429_100173876 3300006880 Bacteria 1887
220 Ga0068865_100029112 3300006881 Bacteria 3661
221 Ga0068865_100430518 3300006881 Bacteria 1087
222 Ga0068865_100635596 3300006881 Bacteria 906
223 Ga0068865_100668915 3300006881 Bacteria 884
224 Ga0075436_100016470 3300006914 Bacteria 5059
225 Ga0075436_100036526 3300006914 Bacteria 3391
226 Ga0075436_100094477 3300006914 Bacteria 2079
227 Ga0075436_100516518 3300006914 Bacteria 875
228 Ga0097620_100004839 3300006931 Bacteria 13707
229 Ga0097620_100022047 3300006931 Bacteria 6387
230 Ga0097620_100038999 3300006931 Bacteria 4764
231 Ga0097620_100132075 3300006931 Bacteria 2569
232 Ga0097620_100151466 3300006931 Bacteria 2395
233 Ga0097620_100265037 3300006931 Unclassified 1810
234 Ga0097620_100327328 3300006931 Bacteria 1626
235 Ga0075435_100001498 3300007076 Bacteria 14993
236 Ga0075435_100015260 3300007076 Bacteria 5771
237 Ga0075435_100025788 3300007076 Bacteria 4579
238 Ga0075435_100132296 3300007076 Bacteria 2087
239 Ga0075435_100194628 3300007076 Bacteria 1717
240 Ga0099794_10008079 3300007265 Bacteria 4356
241 Ga0105240_10003114 3300009093 Bacteria 26105
242 Ga0111539_10001604 3300009094 Bacteria 30185
243 Ga0111539_10006975 3300009094 Bacteria 14498
244 Ga0111539_10083486 3300009094 Bacteria 3756
245 Ga0111539_10093621 3300009094 Bacteria 3529
246 Ga0111539_10153183 3300009094 Bacteria 2698
247 Ga0111539_10280809 3300009094 Bacteria 1938
248 Ga0111539_10510896 3300009094 Bacteria 1399
249 Ga0111539_10538345 3300009094 Bacteria 1360
250 Ga0111539_10967678 3300009094 Bacteria 990
251 Ga0105245_10456764 3300009098 Bacteria 1287
252 Ga0105245_10516124 3300009098 Bacteria 1213
253 Ga0105247_10055573 3300009101 Bacteria 2443
254 Ga0105247_10162588 3300009101 Bacteria 1479
255 Ga0114129_10031860 3300009147 Bacteria 7453
256 Ga0114129_10037341 3300009147 Bacteria 6859
257 Ga0114129_10083278 3300009147 Bacteria 4444
258 Ga0114129_10086762 3300009147 Bacteria 4340
259 Ga0114129_10136598 3300009147 Bacteria 3364
260 Ga0114129_10196757 3300009147 Bacteria 2733
261 Ga0114129_10323813 3300009147 Bacteria 2048
262 Ga0114129_10888622 3300009147 Unclassified 1130
263 Ga0105243_10367030 3300009148 Bacteria 1327
264 Ga0105243_11101487 3300009148 Bacteria 802
265 Ga0105243_11638987 3300009148 Bacteria 671
266 Ga0105241_10010639 3300009174 Bacteria 6748
267 Ga0105241_10628964 3300009174 Bacteria 973
268 Ga0105241_10843664 3300009174 Bacteria 847
269 Ga0105242_10328673 3300009176 Bacteria 1405
270 Ga0105242_11890178 3300009176 Unclassified 637
271 Ga0105248_10039376 3300009177 Bacteria 5293
272 Ga0105248_10121664 3300009177 Bacteria 2944
273 Ga0105248_10160222 3300009177 Bacteria 2538
274 Ga0105248_10185930 3300009177 Bacteria 2341
275 Ga0105248_10311750 3300009177 Bacteria 1772
276 Ga0105248_10513486 3300009177 Bacteria 1351
277 Ga0105248_10977856 3300009177 Bacteria 956
278 Ga0105248_11303167 3300009177 Bacteria 822
279 Ga0105248_11474307 3300009177 Bacteria 770
280 Ga0105237_10000040 3300009545 Bacteria 184318
281 Ga0105237_10093039 3300009545 Bacteria 3004
282 Ga0105237_10150980 3300009545 Bacteria 2320
283 Ga0105238_10451051 3300009551 Bacteria 1283
284 Ga0105238_11207329 3300009551 Bacteria 781
285 Ga0105238_11215758 3300009551 Bacteria 778
286 Ga0105249_10005756 3300009553 Bacteria 10722
287 Ga0105249_10112030 3300009553 Bacteria 2580
288 Ga0105249_10397057 3300009553 Bacteria 1408
289 Ga0105249_11261113 3300009553 Bacteria 810
290 Ga0105249_11324592 3300009553 Bacteria 792
291 Ga0105239_10086362 3300010375 Bacteria 3458
292 Ga0105239_10540119 3300010375 Bacteria 1327
293 Ga0105239_11301241 3300010375 Bacteria 838
294 Ga0105246_10011844 3300011119 Bacteria 5422
295 Ga0105246_11318468 3300011119 Bacteria 670
296 Ga0157373_10005415 3300013100 Bacteria 9587
297 Ga0157371_10020765 3300013102 Bacteria 4831
298 Ga0157370_10437294 3300013104 Bacteria 1203
299 Ga0157369_10402913 3300013105 Unclassified 1419
300 Ga0157374_10051589 3300013296 Bacteria 3828
301 Ga0157374_10273822 3300013296 Bacteria 1665
302 Ga0163162_10102626 3300013306 Bacteria 2953
303 Ga0163162_10429501 3300013306 Bacteria 1453
304 Ga0157372_10000148 3300013307 Bacteria 77512
305 Ga0157372_10200020 3300013307 Bacteria 2314
306 Ga0157372_10480399 3300013307 Bacteria 1449
307 Ga0157375_10128990 3300013308 Bacteria 2647
308 Ga0157375_12744029 3300013308 Bacteria 589
309 Ga0163163_10037769 3300014325 Bacteria 4699
310 Ga0163163_10076314 3300014325 Bacteria 3346
311 Ga0163163_10496455 3300014325 Bacteria 1282
312 Ga0163163_10875086 3300014325 Bacteria 962
313 Ga0163163_11425356 3300014325 Unclassified 754
314 Ga0157380_10042901 3300014326 Bacteria 3539
315 Ga0157380_10403000 3300014326 Bacteria 1298
316 Ga0157380_10897112 3300014326 Bacteria 912
317 Ga0157380_11033292 3300014326 Bacteria 857
318 Ga0157380_11347050 3300014326 Bacteria 762
319 Ga0157377_10036545 3300014745 Bacteria 2702
320 Ga0157379_10180249 3300014968 Bacteria 1908
321 Ga0157379_10486511 3300014968 Bacteria 1142
322 Ga0157379_10638446 3300014968 Unclassified 996
323 Ga0157379_10941591 3300014968 Unclassified 821
324 Ga0157376_11131651 3300014969 Bacteria 809
325 Ga0163161_10103670 3300017792 Bacteria 2120
326 Ga0206350_11175479 3300020080 Bacteria 1613
327 Ga0213875_10136063 3300021388 Bacteria 1149
328 Ga0209566_100113 3300025225 Bacteria 109893
329 Ga0207656_10149990 3300025321 Bacteria 1103
330 Ga0207653_10001375 3300025885 Bacteria 7896
331 Ga0207653_10011515 3300025885 Bacteria 2759
332 Ga0207642_10287943 3300025899 Bacteria 947
333 Ga0207688_10013253 3300025901 Bacteria 4481
334 Ga0207680_10087029 3300025903 Bacteria 1977
335 Ga0207645_10019123 3300025907 Bacteria 4497
336 Ga0207645_10036883 3300025907 Bacteria 3140
337 Ga0207643_10000201 3300025908 Bacteria 41352
338 Ga0207705_10036726 3300025909 Bacteria 3505
339 Ga0207684_10009320 3300025910 Bacteria 8674
340 Ga0207684_10092536 3300025910 Bacteria 2577
341 Ga0207684_10153545 3300025910 Bacteria 1981
342 Ga0207684_10156209 3300025910 Bacteria 1963
343 Ga0207684_10185059 3300025910 Bacteria 1796
344 Ga0207654_10005051 3300025911 Bacteria 6658
345 Ga0207654_10828328 3300025911 Bacteria 669
346 Ga0207707_10000561 3300025912 Bacteria 37678
347 Ga0207707_10207002 3300025912 Bacteria 1710
348 Ga0207707_11130413 3300025912 Bacteria 637
349 Ga0207695_10001182 3300025913 Bacteria 45064
350 Ga0207671_10000039 3300025914 Bacteria 226529
351 Ga0207693_10341899 3300025915 Bacteria 1171
352 Ga0207663_10238369 3300025916 Bacteria 1333
353 Ga0207660_10003466 3300025917 Bacteria 10282
354 Ga0207660_10057223 3300025917 Bacteria 2792
355 Ga0207660_10690927 3300025917 Bacteria 832
356 Ga0207662_10445960 3300025918 Bacteria 884
357 Ga0207657_10000005 3300025919 Bacteria 213481
358 Ga0207649_10010176 3300025920 Bacteria 5165
359 Ga0207652_10010961 3300025921 Bacteria 7308
360 Ga0207652_10014631 3300025921 Bacteria 6359
361 Ga0207652_10016839 3300025921 Bacteria 5974
362 Ga0207652_10184625 3300025921 Bacteria 1875
363 Ga0207652_10293463 3300025921 Bacteria 1467
364 Ga0207652_10352748 3300025921 Bacteria 1328
365 Ga0207652_10486051 3300025921 Bacteria 1112
366 Ga0207652_10735530 3300025921 Bacteria 879
367 Ga0207646_10002553 3300025922 Bacteria 21495
368 Ga0207646_10031224 3300025922 Bacteria 4824
369 Ga0207646_10168283 3300025922 Bacteria 1979
370 Ga0207681_10079092 3300025923 Unclassified 2316
371 Ga0207681_10127241 3300025923 Bacteria 1878
372 Ga0207694_10588859 3300025924 Bacteria 935
373 Ga0207650_10008526 3300025925 Bacteria 6998
374 Ga0207650_10315071 3300025925 Bacteria 1280
375 Ga0207650_10366209 3300025925 Bacteria 1188
376 Ga0207650_10479606 3300025925 Bacteria 1038
377 Ga0207650_10787419 3300025925 Bacteria 806
378 Ga0207659_10258622 3300025926 Bacteria 1415
379 Ga0207659_10462539 3300025926 Bacteria 1070
380 Ga0207659_10552923 3300025926 Bacteria 978
381 Ga0207659_11245634 3300025926 Bacteria 639
382 Ga0207644_10067324 3300025931 Bacteria 2610
383 Ga0207644_10326814 3300025931 Unclassified 1241
384 Ga0207644_10714471 3300025931 Bacteria 836
385 Ga0207690_10632488 3300025932 Bacteria 876
386 Ga0207706_10008521 3300025933 Bacteria 9453
387 Ga0207706_10199863 3300025933 Unclassified 1753
388 Ga0207709_10975078 3300025935 Bacteria 692
389 Ga0207709_11179174 3300025935 Bacteria 630
390 Ga0207670_10000004 3300025936 Bacteria 707262
391 Ga0207670_10151405 3300025936 Bacteria 1722
392 Ga0207670_10263333 3300025936 Bacteria 1337
393 Ga0207669_10003835 3300025937 Bacteria 6551
394 Ga0207704_10054627 3300025938 Bacteria 2436
395 Ga0207704_10067960 3300025938 Bacteria 2244
396 Ga0207704_11194654 3300025938 Bacteria 648
397 Ga0207704_11358103 3300025938 Bacteria 608
398 Ga0207665_10004515 3300025939 Bacteria 9229
399 Ga0207665_10035908 3300025939 Bacteria 3293
400 Ga0207691_10166641 3300025940 Bacteria 1930
401 Ga0207691_10747295 3300025940 Bacteria 824
402 Ga0207691_11174836 3300025940 Bacteria 637
403 Ga0207711_10152137 3300025941 Bacteria 2089
404 Ga0207711_10185759 3300025941 Bacteria 1892
405 Ga0207711_10409834 3300025941 Bacteria 1260
406 Ga0207711_10730427 3300025941 Bacteria 923
407 Ga0207689_10000678 3300025942 Bacteria 32485
408 Ga0207689_10010516 3300025942 Bacteria 7968
409 Ga0207689_10110460 3300025942 Bacteria 2259
410 Ga0207689_10966880 3300025942 Unclassified 718
411 Ga0207661_10045003 3300025944 Bacteria 3491
412 Ga0207679_10004419 3300025945 Bacteria 8757
413 Ga0207679_10011589 3300025945 Bacteria 5720
414 Ga0207667_10014361 3300025949 Bacteria 9033
415 Ga0207667_10027808 3300025949 Bacteria 6150
416 Ga0207667_10106181 3300025949 Bacteria 2897
417 Ga0207667_10328878 3300025949 Bacteria 1560
418 Ga0207667_10797148 3300025949 Bacteria 942
419 Ga0207651_10079300 3300025960 Bacteria 2358
420 Ga0207651_10097716 3300025960 Bacteria 2169
421 Ga0207712_10059410 3300025961 Unclassified 2706
422 Ga0207712_10667819 3300025961 Bacteria 905
423 Ga0207668_10465797 3300025972 Bacteria 1081
424 Ga0207640_10002202 3300025981 Bacteria 10481
425 Ga0207658_10027014 3300025986 Bacteria 4030
426 Ga0207658_10211276 3300025986 Bacteria 1626
427 Ga0207677_10634995 3300026023 Bacteria 941
428 Ga0207677_11402659 3300026023 Bacteria 643
429 Ga0207703_10010646 3300026035 Bacteria 7184
430 Ga0207703_10124678 3300026035 Bacteria 2216
431 Ga0207703_10525748 3300026035 Bacteria 1113
432 Ga0207703_10852126 3300026035 Bacteria 871
433 Ga0207639_10002490 3300026041 Bacteria 12341
434 Ga0207639_10010521 3300026041 Bacteria 6408
435 Ga0207678_10026942 3300026067 Bacteria 5013
436 Ga0207678_10101030 3300026067 Bacteria 2463
437 Ga0207708_10009307 3300026075 Bacteria 7272
438 Ga0207708_10062122 3300026075 Bacteria 2853
439 Ga0207708_10232245 3300026075 Bacteria 1481
440 Ga0207708_10293301 3300026075 Unclassified 1321
441 Ga0207702_10000289 3300026078 Bacteria 58398
442 Ga0207702_10046848 3300026078 Bacteria 3641
443 Ga0207702_10063460 3300026078 Bacteria 3159
444 Ga0207702_10786272 3300026078 Bacteria 940
445 Ga0207641_10072955 3300026088 Bacteria 2957
446 Ga0207648_10001316 3300026089 Bacteria 27640
447 Ga0207648_10043522 3300026089 Bacteria 3941
448 Ga0207648_10424145 3300026089 Bacteria 1208
449 Ga0207648_10600180 3300026089 Bacteria 1015
450 Ga0207648_10793161 3300026089 Bacteria 881
451 Ga0207648_11003390 3300026089 Unclassified 782
452 Ga0207676_10008622 3300026095 Bacteria 7246
453 Ga0207676_10299489 3300026095 Bacteria 1468
454 Ga0207676_10479501 3300026095 Bacteria 1178
455 Ga0207676_10957645 3300026095 Bacteria 842
456 Ga0207676_11593713 3300026095 Bacteria 651
457 Ga0207674_10001075 3300026116 Bacteria 35534
458 Ga0207674_10037328 3300026116 Bacteria 5054
459 Ga0207674_10453218 3300026116 Bacteria 1240
460 Ga0207675_100010746 3300026118 Bacteria 8577
461 Ga0207675_100038517 3300026118 Bacteria 4462
462 Ga0207675_100185497 3300026118 Bacteria 1993
463 Ga0207675_100241675 3300026118 Bacteria 1745
464 Ga0207675_100605146 3300026118 Bacteria 1099
465 Ga0207675_100742634 3300026118 Bacteria 992
466 Ga0207683_10054811 3300026121 Unclassified 3496
467 Ga0207683_10175570 3300026121 Bacteria 1941
468 Ga0207683_10498229 3300026121 Bacteria 1125
469 Ga0207698_10071663 3300026142 Bacteria 2750
470 Ga0207698_10073638 3300026142 Bacteria 2721
471 Ga0207698_10131004 3300026142 Bacteria 2143
472 Ga0207698_10185905 3300026142 Bacteria 1846
473 Ga0209983_1005805 3300027665 Unclassified 2549
474 Ga0209588_1052203 3300027671 Bacteria 1322
475 Ga0207428_10032336 3300027907 Bacteria 4303
476 Ga0207428_10553252 3300027907 Bacteria 832
477 Ga0207428_10636096 3300027907 Bacteria 766
478 Ga0268266_10235226 3300028379 Bacteria 1689
479 Ga0268266_11364451 3300028379 Bacteria 684
480 Ga0268265_10005037 3300028380 Bacteria 9067
481 Ga0268265_10010872 3300028380 Bacteria 6147
482 Ga0268264_10008494 3300028381 Bacteria 8535
483 Ga0268264_10158264 3300028381 Bacteria 2038
484 Ga0268264_10158969 3300028381 Bacteria 2033
485 Ga0268264_10234730 3300028381 Bacteria 1695
486 Ga0268264_10639884 3300028381 Bacteria 1051
487 Ga0265320_10044074 3300031240 Bacteria 2200
488 Ga0307408_100148427 3300031548 Bacteria 1848
489 Ga0265313_10046661 3300031595 Bacteria 2102
490 Ga0307516_10527954 3300031730 Bacteria 834
491 Ga0307405_10100936 3300031731 Bacteria 1935
492 Ga0307413_10744306 3300031824 Bacteria 819
493 Ga0307410_10234288 3300031852 Bacteria 1419
494 Ga0307407_10065944 3300031903 Unclassified 2134
495 Ga0307409_100187082 3300031995 Unclassified 1839
496 Ga0307409_100268355 3300031995 Bacteria 1570
497 Ga0307416_100073165 3300032002 Bacteria 2856
498 Ga0307416_101304650 3300032002 Bacteria 832
499 Ga0307414_10193507 3300032004 Bacteria 1648
500 Ga0307411_10387424 3300032005 Bacteria 1151
501 Ga0307415_100128368 3300032126 Bacteria 1915
502 Ga0307415_100140703 3300032126 Bacteria 1843
503 Ga0307415_100858344 3300032126 Unclassified 833
504 Ga0373930_0001639 3300034816 Bacteria 3377
505 Ga0373948_0074837 3300034817 Bacteria 764
506 Ga0373950_0001031 3300034818 Bacteria 3548
507 Ga0373959_0001115 3300034820 Bacteria 4371
508 Ga0373938_0000914 3300034957 Bacteria 4724
509 Ga0373928_0003628 3300035084 Bacteria 2942
510 Ga0373929_0001665 3300035085 Bacteria 4199
511 Ga0373934_0115168 3300035086 Bacteria 1092
512 Ga0373940_0004299 3300035088 Bacteria 3002
513 Ga0373940_0006487 3300035088 Bacteria 2596
514 Ga0373949_0000482 3300035090 Bacteria 13633
515 Ga0373949_0005201 3300035090 Bacteria 2917
516 Ga0373951_0000509 3300035091 Bacteria 11092
517 Ga0373951_0010217 3300035091 Bacteria 2107
518 Ga0373951_0065366 3300035091 Bacteria 918
519 Ga0373952_0014451 3300035092 Bacteria 1580
520 Ga0373923_0028698 3300035111 Bacteria 2227
521 Ga0373932_0002843 3300035112 Bacteria 4283
522 Ga0373939_0005030 3300035114 Bacteria 3141
523 Ga0373939_0076336 3300035114 Bacteria 1103
524 Ga0373941_0001206 3300035115 Bacteria 5410
525 Ga0373953_0086417 3300035117 Bacteria 1309
526 Ga0373953_0118379 3300035117 Bacteria 1124
527 Ga0373954_0134318 3300035118 Bacteria 1205
528 Ga0373960_0000552 3300035121 Bacteria 7568
529 Ga0373955_0100978 3300035172 Bacteria 1656
530 Ga0373942_0008937 3300035207 Bacteria 2340
531 Ga0373942_0011913 3300035207 Bacteria 2069
532 Ga0373961_0001603 3300035241 Bacteria 6432
533 Ga0373961_0023602 3300035241 Bacteria 1656
534 Ga0373961_0088559 3300035241 Bacteria 985
535 Ga0373962_0004201 3300035242 Bacteria 3471
536 Ga0373924_0050682 3300035410 Bacteria 1720
537 Ga0373931_0000488 3300035691 Bacteria 16182
538 Ga0373931_0032930 3300035691 Bacteria 2684
539 Ga0373931_0055407 3300035691 Bacteria 2122
540 Ga0373931_0551115 3300035691 Bacteria 749
541 Ga0373927_0182306 3300035695 Bacteria 1377
542 Ga0373927_0528411 3300035695 Bacteria 780
543 Ga0373933_0049763 3300035724 Bacteria 2499
544 Ga0373933_0113038 3300035724 Unclassified 1696
545 Ga0373933_0357086 3300035724 Bacteria 950
546 Ga0373947_0042088 3300035725 Bacteria 2726
547 Ga0373937_0040801 3300036401 Bacteria 4231
548 Ga0373937_0559275 3300036401 Bacteria 1087
549 Ga0395900_0000485 3300037418 Bacteria 56437
550 Ga0395898_0003712 3300037466 Bacteria 16942
551 Ga0395905_0355187 3300037471 Bacteria 1358
552 Ga0436364_1475068 3300037853 Bacteria 2156
553 Ga0395901_0000955 3300038443 Bacteria 31458
554 Ga0436365_1541254 3300039437 Bacteria 2238
555 Ga0439453_0016004 3300041408 Bacteria 1304
556 Ga0451802_0754946 3300041460 Bacteria 698
557 Ga0439437_022828 3300042000 Bacteria 763
558 Ga0439441_036251 3300042001 Bacteria 974
559 Ga0439445_0128279 3300042004 Bacteria 731
560 Ga0439448_0000314 3300042005 Bacteria 10711
561 Ga0439455_0016428 3300042012 Bacteria 1712
562 Ga0450914_002276 3300042118 Bacteria 1349
563 Ga0450923_053332 3300042125 Unclassified 872
564 Ga0450895_000988 3300042132 Unclassified 1859
565 Ga0450896_004993 3300042133 Bacteria 1807
566 Ga0439458_0048664 3300042157 Bacteria 1042
567 Ga0439435_0015232 3300042436 Bacteria 1911
568 Ga0439459_0000763 3300042438 Bacteria 4432
569 Ga0450918_007589 3300042531 Unclassified 1916
570 Ga0450918_017873 3300042531 Bacteria 1235
571 Ga0451577_0012391 3300042876 Bacteria 8008
572 Ga0451577_0015526 3300042876 Bacteria 7083
573 Ga0451577_0027101 3300042876 Bacteria 5188
574 Ga0451577_0693085 3300042876 Unclassified 923
575 Ga0451577_0988725 3300042876 Unclassified 756
576 Ga0453683_0406611 3300044673 Bacteria 878
577 Ga0466961_0258037 3300044693 Bacteria 1069
578 Ga0453684_0022865 3300044712 Bacteria 9252
579 Ga0453684_0082683 3300044712 Bacteria 3999
580 Ga0466959_0033178 3300045049 Bacteria 3819
581 Ga0451576_0035736 3300045051 Bacteria 5269
582 Ga0451576_0058352 3300045051 Bacteria 4034
583 Ga0451576_0064706 3300045051 Bacteria 3808
584 Ga0451576_0364055 3300045051 Bacteria 1514
585 Ga0466967_0730821 3300045976 Bacteria 981
586 Ga0495592_0253084 3300046454 Bacteria 1163
587 Ga0495651_0058050 3300046462 Bacteria 2970
588 Ga0495580_0291523 3300046472 Bacteria 1112
589 Ga0495630_0022262 3300046517 Bacteria 4682
590 Ga0495634_0223501 3300046642 Bacteria 1161
591 Ga0495634_0589607 3300046642 Bacteria 646
592 Ga0495588_0535166 3300046674 Unclassified 614
593 Ga0495600_0105339 3300046809 Bacteria 1837
594 Ga0495600_0598707 3300046809 Bacteria 670
595 Ga0495604_0811462 3300047317 Bacteria 589
596 Ga0495675_0094849 3300047444 Bacteria 1871
597 Ga0495602_0182915 3300048088 Bacteria 1614
598 Ga0495614_0333818 3300048089 Unclassified 705
599 Ga0496101_0956667 3300048904 Bacteria 674
600 Ga0496101_1215061 3300048904 Bacteria 590
601 Ga0496102_0065394 3300048905 Bacteria 3333
602 Ga0496102_0085417 3300048905 Bacteria 2914
603 Ga0496102_0202891 3300048905 Unclassified 1869
604 Ga0496103_0619727 3300048906 Bacteria 689
605 Ga0496104_0050840 3300048907 Bacteria 3910
606 Ga0496104_0358750 3300048907 Bacteria 1370
607 Ga0496105_0140273 3300048908 Bacteria 1990
608 Ga0496106_0053400 3300048909 Bacteria 3052
609 Ga0496106_0146619 3300048909 Bacteria 1859
610 Ga0496107_0042044 3300048910 Bacteria 3283
611 Ga0496108_0165239 3300048911 Bacteria 1913
612 Ga0496108_0293395 3300048911 Bacteria 1416
613 Ga0496108_0379688 3300048911 Bacteria 1234
614 Ga0496109_0108023 3300048912 Unclassified 2586
615 Ga0496109_0748594 3300048912 Bacteria 915
616 Ga0496110_0011509 3300048913 Bacteria 7244
617 Ga0496110_0261416 3300048913 Bacteria 1575
618 Ga0496110_0759918 3300048913 Bacteria 873
619 Ga0496111_0072756 3300048914 Bacteria 2502
620 Ga0496111_0412001 3300048914 Unclassified 998
621 Ga0496112_0001306 3300048915 Bacteria 18933
622 Ga0496112_0023029 3300048915 Bacteria 5944
623 Ga0496112_0028656 3300048915 Bacteria 5377
624 Ga0496112_0406825 3300048915 Bacteria 1300
625 Ga0496113_0095242 3300048916 Bacteria 2301
626 Ga0496114_0162630 3300048917 Bacteria 1942
627 Ga0496114_0853623 3300048917 Bacteria 791
628 Ga0501031_0509609 3300049568 Bacteria 776
629 Ga0501031_0628927 3300049568 Bacteria 690
630 Ga0501033_0373044 3300049570 Bacteria 997
631 Ga0501036_0207168 3300049572 Bacteria 1648
632 Ga0501036_0280085 3300049572 Bacteria 1396
633 Ga0501038_0009126 3300049574 Bacteria 9098
634 Ga0501038_0070565 3300049574 Bacteria 2966
635 Ga0501039_0045800 3300049575 Bacteria 3379
636 Ga0501039_0643183 3300049575 Bacteria 830
637 Ga0501040_0008330 3300049576 Bacteria 6743
638 Ga0501040_0224968 3300049576 Bacteria 1335
639 Ga0501040_0231674 3300049576 Unclassified 1315
640 Ga0501040_0745294 3300049576 Bacteria 709
641 Ga0501041_0004181 3300049577 Bacteria 8355
642 Ga0501041_0454454 3300049577 Bacteria 813
643 Ga0501041_0505237 3300049577 Bacteria 769
644 Ga0501042_0027645 3300049578 Bacteria 3989
645 Ga0501042_0062349 3300049578 Bacteria 2664
646 Ga0501042_0176575 3300049578 Bacteria 1541
647 Ga0501042_0852336 3300049578 Bacteria 663
648 Ga0501043_0066202 3300049579 Bacteria 2837
649 Ga0501043_0067553 3300049579 Bacteria 2807
650 Ga0501043_0327726 3300049579 Bacteria 1167
651 Ga0501043_0625353 3300049579 Bacteria 793
652 Ga0501043_0937968 3300049579 Bacteria 619
653 Ga0501046_0015837 3300049580 Bacteria 6326
654 Ga0501046_0096514 3300049580 Bacteria 2271
655 Ga0501047_0020514 3300049581 Bacteria 6345
656 Ga0501048_0203160 3300049582 Bacteria 1405
657 Ga0501048_0311765 3300049582 Bacteria 1120
658 Ga0501048_0386040 3300049582 Bacteria 1000
659 Ga0501048_1115478 3300049582 Bacteria 567
660 Ga0501048_1156147 3300049582 Bacteria 557
661 Ga0501067_0375835 3300049583 Unclassified 792
662 Ga0501067_0711375 3300049583 Bacteria 565
663 Ga0501068_0028718 3300049584 Unclassified 3291
664 Ga0501068_0258413 3300049584 Bacteria 1111
665 Ga0501069_0708169 3300049585 Bacteria 608
666 Ga0501071_0025398 3300049587 Bacteria 4150
667 Ga0501071_0390251 3300049587 Bacteria 1062
668 Ga0501071_0531301 3300049587 Bacteria 903
669 Ga0501071_0634778 3300049587 Bacteria 822
670 Ga0501072_0030881 3300049588 Bacteria 4191
671 Ga0501072_0312020 3300049588 Bacteria 1250
672 Ga0501072_0324741 3300049588 Unclassified 1223
673 Ga0501072_0376170 3300049588 Bacteria 1127
674 Ga0501072_0400625 3300049588 Bacteria 1089
675 Ga0501073_0201819 3300049589 Bacteria 1375
676 Ga0501073_0262797 3300049589 Bacteria 1191
677 Ga0501074_0078824 3300049590 Bacteria 2364
678 Ga0501074_0105423 3300049590 Bacteria 2018
679 Ga0501075_0008635 3300049591 Bacteria 7103
680 Ga0501075_0020920 3300049591 Bacteria 4766
681 Ga0501075_0149024 3300049591 Bacteria 1783
682 Ga0501075_0295038 3300049591 Bacteria 1235
683 Ga0501075_0510602 3300049591 Bacteria 917
684 Ga0501076_0028259 3300049592 Bacteria 4353
685 Ga0501076_0295095 3300049592 Bacteria 1328
686 Ga0501076_0422307 3300049592 Bacteria 1097
687 Ga0501077_0102006 3300049593 Bacteria 1818
688 Ga0501077_0256567 3300049593 Bacteria 1112
689 Ga0501225_0102158 3300049705 Bacteria 839
690 Ga0501079_0006324 3300049741 Bacteria 8887
691 Ga0501079_0035674 3300049741 Bacteria 3829
692 Ga0501079_0477609 3300049741 Bacteria 980
693 Ga0501080_0026615 3300049742 Bacteria 5374
694 Ga0501080_0102479 3300049742 Bacteria 2655
695 Ga0501080_0208969 3300049742 Bacteria 1789
696 Ga0501080_0691270 3300049742 Bacteria 900
697 Ga0501081_0023964 3300049743 Bacteria 4094
698 Ga0501081_0040930 3300049743 Bacteria 3172
699 Ga0501081_0170341 3300049743 Bacteria 1572
700 Ga0501081_0342235 3300049743 Unclassified 1101
701 Ga0501081_0358549 3300049743 Bacteria 1075
702 Ga0501035_0799665 3300049822 Unclassified 753
703 Ga0501044_0137803 3300049823 Bacteria 2430
704 Ga0501045_0006677 3300049824 Bacteria 7997
705 Ga0501045_0104171 3300049824 Bacteria 2102
706 Ga0501045_0130147 3300049824 Bacteria 1871
707 Ga0501045_0220175 3300049824 Bacteria 1413
708 Ga0501045_0310645 3300049824 Bacteria 1173
709 Ga0501045_0991686 3300049824 Unclassified 616
710 nmdc:mga00v17_451533_c1 3300050491 Bacteria 834
711 nmdc:mga0yw44_111537_c1 3300050492 Bacteria 1753
712 nmdc:mga06z11_276669_c1 3300050494 Bacteria 994
713 nmdc:mga05p37_124414_c1 3300050507 Bacteria 3167
714 nmdc:mga05p37_152205_c1 3300050507 Bacteria 2828
715 nmdc:mga05p37_1555452_c1 3300050507 Bacteria 655
716 nmdc:mga05p37_169328_c1 3300050507 Bacteria 2665
717 nmdc:mga05p37_20424_c2 3300050507 Bacteria 5382
718 nmdc:mga05p37_277489_c1 3300050507 Bacteria 2000
719 nmdc:mga05p37_470254_c1 3300050507 Unclassified 1451
720 nmdc:mga05p37_57010_c1 3300050507 Bacteria 4811
721 nmdc:mga05p37_73637_c1 3300050507 Bacteria 4204
722 nmdc:mga09592_158499_c1 3300050508 Bacteria 1954
723 nmdc:mga09592_18192_c1 3300050508 Bacteria 5761
724 nmdc:mga0qj67_51124_c1 3300050509 Bacteria 3267
725 nmdc:mga06r32_1095084_c1 3300050510 Bacteria 746
726 nmdc:mga06r32_304279_c1 3300050510 Bacteria 1580
727 nmdc:mga06r32_80099_c1 3300050510 Bacteria 3178
728 nmdc:mga08y16_1437882_c1 3300050511 Bacteria 652
729 nmdc:mga08y16_234724_c1 3300050511 Bacteria 1897
730 nmdc:mga08y16_26167_c1 3300050511 Bacteria 6153
731 nmdc:mga08y16_26178_c1 3300050511 Bacteria 6152
732 nmdc:mga08y16_424428_c1 3300050511 Bacteria 1359
733 nmdc:mga08y16_459893_c1 3300050511 Bacteria 1297
734 nmdc:mga08y16_9786_c1 3300050511 Bacteria 10061
735 nmdc:mga0n895_103472_c1 3300050512 Bacteria 2859
736 nmdc:mga0n895_158_c1 3300050512 Bacteria 41550
737 nmdc:mga0n895_41215_c1 3300050512 Bacteria 4488
738 nmdc:mga0n895_539699_c1 3300050512 Bacteria 1173
739 nmdc:mga0n895_795056_c1 3300050512 Bacteria 937
740 nmdc:mga0rr50_175119_c1 3300050513 Bacteria 1751
741 nmdc:mga0rr50_210216_c1 3300050513 Bacteria 1603
742 nmdc:mga0rr50_219_c1 3300050513 Bacteria 30871
743 nmdc:mga0rr50_305846_c1 3300050513 Unclassified 1331
744 nmdc:mga0rr50_6_c1 3300050513 Bacteria 310626
745 nmdc:mga08x19_251_c1 3300050514 Bacteria 40759
746 nmdc:mga08x19_387897_c1 3300050514 Bacteria 979
747 nmdc:mga08x19_65635_c1 3300050514 Bacteria 2358
748 nmdc:mga08x19_79141_c1 3300050514 Bacteria 2155
749 nmdc:mga08x19_9366_c1 3300050514 Bacteria 5863
750 nmdc:mga0a205_100843_c1 3300050515 Bacteria 2786
751 nmdc:mga0a205_13770_c1 3300050515 Bacteria 7539
752 nmdc:mga0a205_339472_c1 3300050515 Bacteria 1371
753 nmdc:mga0a205_431153_c1 3300050515 Bacteria 1180
754 nmdc:mga0a205_58793_c1 3300050515 Bacteria 3713
755 nmdc:mga0a205_887360_c1 3300050515 Unclassified 739
756 Ga0495601_0026905 3300053077 Bacteria 3555
757 Ga0495595_0340562 3300053084 Bacteria 756
758 Ga0495619_0038479 3300053085 Bacteria 3121
759 Ga0495619_0102134 3300053085 Bacteria 1953
760 Ga0500616_0000066 3300053153 Bacteria 237304
761 Ga0501084_0002623 3300054114 Bacteria 14477
762 Ga0501084_0089133 3300054114 Bacteria 2589
763 Ga0501084_0191459 3300054114 Bacteria 1726
764 Ga0501084_0200738 3300054114 Bacteria 1683
765 Ga0501084_0240471 3300054114 Bacteria 1528
766 Ga0501084_0305055 3300054114 Bacteria 1345
767 Ga0501084_0400011 3300054114 Bacteria 1161
768 Ga0501084_0403688 3300054114 Bacteria 1155
769 Ga0501084_0494169 3300054114 Unclassified 1034
770 Ga0501084_0593513 3300054114 Bacteria 936
771 Ga0590074_001961 3300059423 Unclassified 3369
772 Ga0590075_001954 3300059424 Bacteria 4987
773 Ga0590075_071936 3300059424 Bacteria 894
774 Ga0590075_156035 3300059424 Bacteria 602
775 Ga0501082_0016294 3300060353 Bacteria 6398
776 Ga0501082_0085620 3300060353 Bacteria 2718
777 Ga0501082_0675748 3300060353 Bacteria 904
778 Ga0501082_1299493 3300060353 Bacteria 635
779 Ga0501082_1331624 3300060353 Bacteria 627
780 Ga0501082_2033732 3300060353 Bacteria 501
781 Ga0530510_0012576 3300061734 Bacteria 5949
782 Ga0530510_0025118 3300061734 Bacteria 4259
783 Ga0530510_0572144 3300061734 Bacteria 859
784 Ga0530510_0590017 3300061734 Unclassified 845
785 Ga0530510_0834968 3300061734 Bacteria 703
786 Ga0070670_100095257
787 JGI24751J29686_10033137
788 JGI25406J46586_10011969
789 JGI25405J52794_10030776
790 Ga0065704_10243128
791 Ga0065704_10289401
792 Ga0065715_10388329
793 Ga0065715_10535512
794 Ga0065707_10022274
795 Ga0065707_10113799
796 Ga0065707_10145947
797 Ga0070676_10000116
798 Ga0070676_10326497
799 Ga0070683_100037737
800 Ga0070683_100337204
801 Ga0070690_101020716
802 Ga0070670_100026877
803 Ga0070670_100065390
804 Ga0070670_100535372
805 Ga0068869_100012164
806 Ga0068869_100027284
807 Ga0068869_100434672
808 Ga0070680_100003600
809 Ga0070680_100606527
810 Ga0070680_101529360
811 Ga0070682_100002609
812 Ga0070682_100039614
813 Ga0068868_100013271
814 Ga0068868_100058284
815 Ga0068868_100077287
816 Ga0068868_100399613
817 Ga0070660_100002786
818 Ga0070660_101321995
819 Ga0070689_100000005
820 Ga0070689_100054103
821 Ga0070689_100221986
822 Ga0070691_10001345
823 Ga0070691_10080492
824 Ga0070687_100043089
825 Ga0070661_100000595
826 Ga0070692_10001137
827 Ga0070692_10559566
828 Ga0070668_100530057
829 Ga0070668_100779254
830 Ga0070669_100292880
831 Ga0070675_100080705
832 Ga0070675_100217980
833 Ga0070675_100397108
834 Ga0070671_100161799
835 Ga0070674_100047013
836 Ga0070673_100027523
837 Ga0070673_101297551
838 Ga0070688_100962791
839 Ga0070659_100002065
840 Ga0070667_100111184
841 Ga0070667_100193625
842 Ga0070703_10006193
843 Ga0070703_10057078
844 Ga0070713_100726992
845 Ga0070701_10303901
846 Ga0070711_100276910
847 Ga0070711_100356100
848 Ga0070705_100001948
849 Ga0070705_100042433
850 Ga0070700_100214677
851 Ga0070700_100292740
852 Ga0070694_100007021
853 Ga0070694_100013273
854 Ga0070708_100119702
855 Ga0070708_100122271
856 Ga0070663_101469307
857 Ga0070678_100019111
858 Ga0070678_100499322
859 Ga0070678_101147045
860 Ga0070662_100012887
861 Ga0070662_100941998
862 Ga0070681_10005234
863 Ga0070681_10108754
864 Ga0070681_10410937
865 Ga0070681_11346630
866 Ga0068867_100001574
867 Ga0068867_100083342
868 Ga0068867_100206052
869 Ga0068867_100520537
870 Ga0068867_101630028
871 Ga0070706_100018784
872 Ga0070706_100022971
873 Ga0070706_100181685
874 Ga0070706_100255111
875 Ga0070706_100278057
876 Ga0070706_100355982
877 Ga0070707_100097104
878 Ga0070707_100275007
879 Ga0070707_100739498
880 Ga0070707_100784092
881 Ga0070698_100030811
882 Ga0070698_100090616
883 Ga0070698_100094976
884 Ga0070698_100192714
885 Ga0070698_100250391
886 Ga0070698_100268561
887 Ga0070698_101151062
888 Ga0070699_100003176
889 Ga0070699_100011585
890 Ga0070699_100219217
891 Ga0070699_100439846
892 Ga0070679_100005377
893 Ga0070679_100005879
894 Ga0070679_100053938
895 Ga0070679_100090537
896 Ga0070679_100123254
897 Ga0070679_100227341
898 Ga0070684_100121225
899 Ga0070697_100015520
900 Ga0070697_100058966
901 Ga0070697_100131627
902 Ga0070697_100665112
903 Ga0068853_100000603
904 Ga0068853_100000925
905 Ga0070672_100020586
906 Ga0070672_100261643
907 Ga0070672_100266595
908 Ga0070686_100113009
909 Ga0070686_100179940
910 Ga0070695_100000782
911 Ga0070695_100001312
912 Ga0070695_100041415
913 Ga0070695_100151206
914 Ga0070696_100003314
915 Ga0070696_100016434
916 Ga0070696_100152959
917 Ga0070693_100000954
918 Ga0070693_100032258
919 Ga0070693_100367240
920 Ga0070693_100501527
921 Ga0070665_100115542
922 Ga0070665_101761019
923 Ga0070704_100030013
924 Ga0070704_100333509
925 Ga0068855_100000627
926 Ga0068855_100029918
927 Ga0068855_100147347
928 Ga0068855_100195175
929 Ga0068855_100589596
930 Ga0070664_100006124
931 Ga0068857_100013962
932 Ga0068857_100076363
933 Ga0068857_101661536
934 Ga0068854_100008573
935 Ga0068854_100320115
936 Ga0068856_100004610
937 Ga0068856_100353131
938 Ga0070702_100094327
939 Ga0068852_100042562
940 Ga0068852_100105038
941 Ga0068859_100004838
942 Ga0068859_100022047
943 Ga0068859_100039001
944 Ga0068859_100132071
945 Ga0068859_100151480
946 Ga0068859_100265022
947 Ga0068859_100327309
948 Ga0068864_100004649
949 Ga0068864_100869997
950 Ga0068866_10520031
951 Ga0068866_10683780
952 Ga0068861_100003283
953 Ga0068861_100140243
954 Ga0068861_100712613
955 Ga0068851_10654763
956 Ga0068870_10000227
957 Ga0068863_100072165
958 Ga0068863_100324164
959 Ga0068863_101319699
960 Ga0068858_100062823
961 Ga0068858_100364854
962 Ga0068860_100005936
963 Ga0068860_100176333
964 Ga0068860_100429373
965 Ga0068860_100682235
966 Ga0068860_100716862
967 Ga0068860_101658562
968 Ga0068862_100002127
969 Ga0068862_100009978
970 Ga0068862_100904003
971 Ga0068862_100952603
972 Ga0068862_101082140
973 Ga0081455_10001074
974 Ga0081539_10000010
975 Ga0081539_10225612
976 Ga0070715_10011152
977 Ga0070716_100010266
978 Ga0070712_100264025
979 Ga0075367_10092476
980 Ga0075366_10059435
981 Ga0097621_100074992
982 Ga0097621_100332792
983 Ga0097621_101141515
984 Ga0068871_100897122
985 Ga0075428_100031024
986 Ga0075428_100053936
987 Ga0075428_101701918
988 Ga0075430_100029662
989 Ga0075430_100055234
990 Ga0075431_100053436
991 Ga0075431_100234276
992 Ga0075431_100741758
993 Ga0075431_101407002
994 Ga0075433_10192425
995 Ga0075433_10211926
996 Ga0075433_10305494
997 Ga0075433_10456777
998 Ga0075434_100030676
999 Ga0075434_100033031
1000 Ga0075434_100358675
1001 Ga0075434_100440687
1002 Ga0075434_100779832
1003 Ga0075434_101522522
1004 Ga0075429_100173876
1005 Ga0068865_100029112
1006 Ga0068865_100430518
1007 Ga0068865_100635596
1008 Ga0068865_100668915
1009 Ga0075436_100016470
1010 Ga0075436_100036526
1011 Ga0075436_100094477
1012 Ga0075436_100516518
1013 Ga0097620_100004839
1014 Ga0097620_100022047
1015 Ga0097620_100038999
1016 Ga0097620_100132075
1017 Ga0097620_100151466
1018 Ga0097620_100265037
1019 Ga0097620_100327328
1020 Ga0075435_100001498
1021 Ga0075435_100015260
1022 Ga0075435_100025788
1023 Ga0075435_100132296
1024 Ga0075435_100194628
1025 Ga0099794_10008079
1026 Ga0105240_10003114
1027 Ga0111539_10001604
1028 Ga0111539_10006975
1029 Ga0111539_10083486
1030 Ga0111539_10093621
1031 Ga0111539_10153183
1032 Ga0111539_10280809
1033 Ga0111539_10510896
1034 Ga0111539_10538345
1035 Ga0111539_10967678
1036 Ga0105245_10456764
1037 Ga0105245_10516124
1038 Ga0105247_10055573
1039 Ga0105247_10162588
1040 Ga0114129_10031860
1041 Ga0114129_10037341
1042 Ga0114129_10083278
1043 Ga0114129_10086762
1044 Ga0114129_10136598
1045 Ga0114129_10196757
1046 Ga0114129_10323813
1047 Ga0114129_10888622
1048 Ga0105243_10367030
1049 Ga0105243_11101487
1050 Ga0105243_11638987
1051 Ga0105241_10010639
1052 Ga0105241_10628964
1053 Ga0105241_10843664
1054 Ga0105242_10328673
1055 Ga0105242_11890178
1056 Ga0105248_10039376
1057 Ga0105248_10121664
1058 Ga0105248_10160222
1059 Ga0105248_10185930
1060 Ga0105248_10311750
1061 Ga0105248_10513486
1062 Ga0105248_10977856
1063 Ga0105248_11303167
1064 Ga0105248_11474307
1065 Ga0105237_10000040
1066 Ga0105237_10093039
1067 Ga0105237_10150980
1068 Ga0105238_10451051
1069 Ga0105238_11207329
1070 Ga0105238_11215758
1071 Ga0105249_10005756
1072 Ga0105249_10112030
1073 Ga0105249_10397057
1074 Ga0105249_11261113
1075 Ga0105249_11324592
1076 Ga0105239_10086362
1077 Ga0105239_10540119
1078 Ga0105239_11301241
1079 Ga0105246_10011844
1080 Ga0105246_11318468
1081 Ga0157373_10005415
1082 Ga0157371_10020765
1083 Ga0157370_10437294
1084 Ga0157369_10402913
1085 Ga0157374_10051589
1086 Ga0157374_10273822
1087 Ga0163162_10102626
1088 Ga0163162_10429501
1089 Ga0157372_10000148
1090 Ga0157372_10200020
1091 Ga0157372_10480399
1092 Ga0157375_10128990
1093 Ga0157375_12744029
1094 Ga0163163_10037769
1095 Ga0163163_10076314
1096 Ga0163163_10496455
1097 Ga0163163_10875086
1098 Ga0163163_11425356
1099 Ga0157380_10042901
1100 Ga0157380_10403000
1101 Ga0157380_10897112
1102 Ga0157380_11033292
1103 Ga0157380_11347050
1104 Ga0157377_10036545
1105 Ga0157379_10180249
1106 Ga0157379_10486511
1107 Ga0157379_10638446
1108 Ga0157379_10941591
1109 Ga0157376_11131651
1110 Ga0163161_10103670
1111 Ga0206350_11175479
1112 Ga0213875_10136063
1113 Ga0209566_100113
1114 Ga0207656_10149990
1115 Ga0207653_10001375
1116 Ga0207653_10011515
1117 Ga0207642_10287943
1118 Ga0207688_10013253
1119 Ga0207680_10087029
1120 Ga0207645_10019123
1121 Ga0207645_10036883
1122 Ga0207643_10000201
1123 Ga0207705_10036726
1124 Ga0207684_10009320
1125 Ga0207684_10092536
1126 Ga0207684_10153545
1127 Ga0207684_10156209
1128 Ga0207684_10185059
1129 Ga0207654_10005051
1130 Ga0207654_10828328
1131 Ga0207707_10000561
1132 Ga0207707_10207002
1133 Ga0207707_11130413
1134 Ga0207695_10001182
1135 Ga0207671_10000039
1136 Ga0207693_10341899
1137 Ga0207663_10238369
1138 Ga0207660_10003466
1139 Ga0207660_10057223
1140 Ga0207660_10690927
1141 Ga0207662_10445960
1142 Ga0207657_10000005
1143 Ga0207649_10010176
1144 Ga0207652_10010961
1145 Ga0207652_10014631
1146 Ga0207652_10016839
1147 Ga0207652_10184625
1148 Ga0207652_10293463
1149 Ga0207652_10352748
1150 Ga0207652_10486051
1151 Ga0207652_10735530
1152 Ga0207646_10002553
1153 Ga0207646_10031224
1154 Ga0207646_10168283
1155 Ga0207681_10079092
1156 Ga0207681_10127241
1157 Ga0207694_10588859
1158 Ga0207650_10008526
1159 Ga0207650_10315071
1160 Ga0207650_10366209
1161 Ga0207650_10479606
1162 Ga0207650_10787419
1163 Ga0207659_10258622
1164 Ga0207659_10462539
1165 Ga0207659_10552923
1166 Ga0207659_11245634
1167 Ga0207644_10067324
1168 Ga0207644_10326814
1169 Ga0207644_10714471
1170 Ga0207690_10632488
1171 Ga0207706_10008521
1172 Ga0207706_10199863
1173 Ga0207709_10975078
1174 Ga0207709_11179174
1175 Ga0207670_10000004
1176 Ga0207670_10151405
1177 Ga0207670_10263333
1178 Ga0207669_10003835
1179 Ga0207704_10054627
1180 Ga0207704_10067960
1181 Ga0207704_11194654
1182 Ga0207704_11358103
1183 Ga0207665_10004515
1184 Ga0207665_10035908
1185 Ga0207691_10166641
1186 Ga0207691_10747295
1187 Ga0207691_11174836
1188 Ga0207711_10152137
1189 Ga0207711_10185759
1190 Ga0207711_10409834
1191 Ga0207711_10730427
1192 Ga0207689_10000678
1193 Ga0207689_10010516
1194 Ga0207689_10110460
1195 Ga0207689_10966880
1196 Ga0207661_10045003
1197 Ga0207679_10004419
1198 Ga0207679_10011589
1199 Ga0207667_10014361
1200 Ga0207667_10027808
1201 Ga0207667_10106181
1202 Ga0207667_10328878
1203 Ga0207667_10797148
1204 Ga0207651_10079300
1205 Ga0207651_10097716
1206 Ga0207712_10059410
1207 Ga0207712_10667819
1208 Ga0207668_10465797
1209 Ga0207640_10002202
1210 Ga0207658_10027014
1211 Ga0207658_10211276
1212 Ga0207677_10634995
1213 Ga0207677_11402659
1214 Ga0207703_10010646
1215 Ga0207703_10124678
1216 Ga0207703_10525748
1217 Ga0207703_10852126
1218 Ga0207639_10002490
1219 Ga0207639_10010521
1220 Ga0207678_10026942
1221 Ga0207678_10101030
1222 Ga0207708_10009307
1223 Ga0207708_10062122
1224 Ga0207708_10232245
1225 Ga0207708_10293301
1226 Ga0207702_10000289
1227 Ga0207702_10046848
1228 Ga0207702_10063460
1229 Ga0207702_10786272
1230 Ga0207641_10072955
1231 Ga0207648_10001316
1232 Ga0207648_10043522
1233 Ga0207648_10424145
1234 Ga0207648_10600180
1235 Ga0207648_10793161
1236 Ga0207648_11003390
1237 Ga0207676_10008622
1238 Ga0207676_10299489
1239 Ga0207676_10479501
1240 Ga0207676_10957645
1241 Ga0207676_11593713
1242 Ga0207674_10001075
1243 Ga0207674_10037328
1244 Ga0207674_10453218
1245 Ga0207675_100010746
1246 Ga0207675_100038517
1247 Ga0207675_100185497
1248 Ga0207675_100241675
1249 Ga0207675_100605146
1250 Ga0207675_100742634
1251 Ga0207683_10054811
1252 Ga0207683_10175570
1253 Ga0207683_10498229
1254 Ga0207698_10071663
1255 Ga0207698_10073638
1256 Ga0207698_10131004
1257 Ga0207698_10185905
1258 Ga0209983_1005805
1259 Ga0209588_1052203
1260 Ga0207428_10032336
1261 Ga0207428_10553252
1262 Ga0207428_10636096
1263 Ga0268266_10235226
1264 Ga0268266_11364451
1265 Ga0268265_10005037
1266 Ga0268265_10010872
1267 Ga0268264_10008494
1268 Ga0268264_10158264
1269 Ga0268264_10158969
1270 Ga0268264_10234730
1271 Ga0268264_10639884
1272 Ga0265320_10044074
1273 Ga0307408_100148427
1274 Ga0265313_10046661
1275 Ga0307516_10527954
1276 Ga0307405_10100936
1277 Ga0307413_10744306
1278 Ga0307410_10234288
1279 Ga0307407_10065944
1280 Ga0307409_100187082
1281 Ga0307409_100268355
1282 Ga0307416_100073165
1283 Ga0307416_101304650
1284 Ga0307414_10193507
1285 Ga0307411_10387424
1286 Ga0307415_100128368
1287 Ga0307415_100140703
1288 Ga0307415_100858344
1289 Ga0373930_0001639
1290 Ga0373948_0074837
1291 Ga0373950_0001031
1292 Ga0373959_0001115
1293 Ga0373938_0000914
1294 Ga0373928_0003628
1295 Ga0373929_0001665
1296 Ga0373934_0115168
1297 Ga0373940_0004299
1298 Ga0373940_0006487
1299 Ga0373949_0000482
1300 Ga0373949_0005201
1301 Ga0373951_0000509
1302 Ga0373951_0010217
1303 Ga0373951_0065366
1304 Ga0373952_0014451
1305 Ga0373923_0028698
1306 Ga0373932_0002843
1307 Ga0373939_0005030
1308 Ga0373939_0076336
1309 Ga0373941_0001206
1310 Ga0373953_0086417
1311 Ga0373953_0118379
1312 Ga0373954_0134318
1313 Ga0373960_0000552
1314 Ga0373955_0100978
1315 Ga0373942_0008937
1316 Ga0373942_0011913
1317 Ga0373961_0001603
1318 Ga0373961_0023602
1319 Ga0373961_0088559
1320 Ga0373962_0004201
1321 Ga0373924_0050682
1322 Ga0373931_0000488
1323 Ga0373931_0032930
1324 Ga0373931_0055407
1325 Ga0373931_0551115
1326 Ga0373927_0182306
1327 Ga0373927_0528411
1328 Ga0373933_0049763
1329 Ga0373933_0113038
1330 Ga0373933_0357086
1331 Ga0373947_0042088
1332 Ga0373937_0040801
1333 Ga0373937_0559275
1334 Ga0395900_0000485
1335 Ga0395898_0003712
1336 Ga0395905_0355187
1337 Ga0436364_1475068
1338 Ga0395901_0000955
1339 Ga0436365_1541254
1340 Ga0439453_0016004
1341 Ga0451802_0754946
1342 Ga0439437_022828
1343 Ga0439441_036251
1344 Ga0439445_0128279
1345 Ga0439448_0000314
1346 Ga0439455_0016428
1347 Ga0450914_002276
1348 Ga0450923_053332
1349 Ga0450895_000988
1350 Ga0450896_004993
1351 Ga0439458_0048664
1352 Ga0439435_0015232
1353 Ga0439459_0000763
1354 Ga0450918_007589
1355 Ga0450918_017873
1356 Ga0451577_0012391
1357 Ga0451577_0015526
1358 Ga0451577_0027101
1359 Ga0451577_0693085
1360 Ga0451577_0988725
1361 Ga0453683_0406611
1362 Ga0466961_0258037
1363 Ga0453684_0022865
1364 Ga0453684_0082683
1365 Ga0466959_0033178
1366 Ga0451576_0035736
1367 Ga0451576_0058352
1368 Ga0451576_0064706
1369 Ga0451576_0364055
1370 Ga0466967_0730821
1371 Ga0495592_0253084
1372 Ga0495651_0058050
1373 Ga0495580_0291523
1374 Ga0495630_0022262
1375 Ga0495634_0223501
1376 Ga0495634_0589607
1377 Ga0495588_0535166
1378 Ga0495600_0105339
1379 Ga0495600_0598707
1380 Ga0495604_0811462
1381 Ga0495675_0094849
1382 Ga0495602_0182915
1383 Ga0495614_0333818
1384 Ga0496101_0956667
1385 Ga0496101_1215061
1386 Ga0496102_0065394
1387 Ga0496102_0085417
1388 Ga0496102_0202891
1389 Ga0496103_0619727
1390 Ga0496104_0050840
1391 Ga0496104_0358750
1392 Ga0496105_0140273
1393 Ga0496106_0053400
1394 Ga0496106_0146619
1395 Ga0496107_0042044
1396 Ga0496108_0165239
1397 Ga0496108_0293395
1398 Ga0496108_0379688
1399 Ga0496109_0108023
1400 Ga0496109_0748594
1401 Ga0496110_0011509
1402 Ga0496110_0261416
1403 Ga0496110_0759918
1404 Ga0496111_0072756
1405 Ga0496111_0412001
1406 Ga0496112_0001306
1407 Ga0496112_0023029
1408 Ga0496112_0028656
1409 Ga0496112_0406825
1410 Ga0496113_0095242
1411 Ga0496114_0162630
1412 Ga0496114_0853623
1413 Ga0501031_0509609
1414 Ga0501031_0628927
1415 Ga0501033_0373044
1416 Ga0501036_0207168
1417 Ga0501036_0280085
1418 Ga0501038_0009126
1419 Ga0501038_0070565
1420 Ga0501039_0045800
1421 Ga0501039_0643183
1422 Ga0501040_0008330
1423 Ga0501040_0224968
1424 Ga0501040_0231674
1425 Ga0501040_0745294
1426 Ga0501041_0004181
1427 Ga0501041_0454454
1428 Ga0501041_0505237
1429 Ga0501042_0027645
1430 Ga0501042_0062349
1431 Ga0501042_0176575
1432 Ga0501042_0852336
1433 Ga0501043_0066202
1434 Ga0501043_0067553
1435 Ga0501043_0327726
1436 Ga0501043_0625353
1437 Ga0501043_0937968
1438 Ga0501046_0015837
1439 Ga0501046_0096514
1440 Ga0501047_0020514
1441 Ga0501048_0203160
1442 Ga0501048_0311765
1443 Ga0501048_0386040
1444 Ga0501048_1115478
1445 Ga0501048_1156147
1446 Ga0501067_0375835
1447 Ga0501067_0711375
1448 Ga0501068_0028718
1449 Ga0501068_0258413
1450 Ga0501069_0708169
1451 Ga0501071_0025398
1452 Ga0501071_0390251
1453 Ga0501071_0531301
1454 Ga0501071_0634778
1455 Ga0501072_0030881
1456 Ga0501072_0312020
1457 Ga0501072_0324741
1458 Ga0501072_0376170
1459 Ga0501072_0400625
1460 Ga0501073_0201819
1461 Ga0501073_0262797
1462 Ga0501074_0078824
1463 Ga0501074_0105423
1464 Ga0501075_0008635
1465 Ga0501075_0020920
1466 Ga0501075_0149024
1467 Ga0501075_0295038
1468 Ga0501075_0510602
1469 Ga0501076_0028259
1470 Ga0501076_0295095
1471 Ga0501076_0422307
1472 Ga0501077_0102006
1473 Ga0501077_0256567
1474 Ga0501225_0102158
1475 Ga0501079_0006324
1476 Ga0501079_0035674
1477 Ga0501079_0477609
1478 Ga0501080_0026615
1479 Ga0501080_0102479
1480 Ga0501080_0208969
1481 Ga0501080_0691270
1482 Ga0501081_0023964
1483 Ga0501081_0040930
1484 Ga0501081_0170341
1485 Ga0501081_0342235
1486 Ga0501081_0358549
1487 Ga0501035_0799665
1488 Ga0501044_0137803
1489 Ga0501045_0006677
1490 Ga0501045_0104171
1491 Ga0501045_0130147
1492 Ga0501045_0220175
1493 Ga0501045_0310645
1494 Ga0501045_0991686
1495 nmdc:mga00v17_451533_c1
1496 nmdc:mga0yw44_111537_c1
1497 nmdc:mga06z11_276669_c1
1498 nmdc:mga05p37_124414_c1
1499 nmdc:mga05p37_152205_c1
1500 nmdc:mga05p37_1555452_c1
1501 nmdc:mga05p37_169328_c1
1502 nmdc:mga05p37_20424_c2
1503 nmdc:mga05p37_277489_c1
1504 nmdc:mga05p37_470254_c1
1505 nmdc:mga05p37_57010_c1
1506 nmdc:mga05p37_73637_c1
1507 nmdc:mga09592_158499_c1
1508 nmdc:mga09592_18192_c1
1509 nmdc:mga0qj67_51124_c1
1510 nmdc:mga06r32_1095084_c1
1511 nmdc:mga06r32_304279_c1
1512 nmdc:mga06r32_80099_c1
1513 nmdc:mga08y16_1437882_c1
1514 nmdc:mga08y16_234724_c1
1515 nmdc:mga08y16_26167_c1
1516 nmdc:mga08y16_26178_c1
1517 nmdc:mga08y16_424428_c1
1518 nmdc:mga08y16_459893_c1
1519 nmdc:mga08y16_9786_c1
1520 nmdc:mga0n895_103472_c1
1521 nmdc:mga0n895_158_c1
1522 nmdc:mga0n895_41215_c1
1523 nmdc:mga0n895_539699_c1
1524 nmdc:mga0n895_795056_c1
1525 nmdc:mga0rr50_175119_c1
1526 nmdc:mga0rr50_210216_c1
1527 nmdc:mga0rr50_219_c1
1528 nmdc:mga0rr50_305846_c1
1529 nmdc:mga0rr50_6_c1
1530 nmdc:mga08x19_251_c1
1531 nmdc:mga08x19_387897_c1
1532 nmdc:mga08x19_65635_c1
1533 nmdc:mga08x19_79141_c1
1534 nmdc:mga08x19_9366_c1
1535 nmdc:mga0a205_100843_c1
1536 nmdc:mga0a205_13770_c1
1537 nmdc:mga0a205_339472_c1
1538 nmdc:mga0a205_431153_c1
1539 nmdc:mga0a205_58793_c1
1540 nmdc:mga0a205_887360_c1
1541 Ga0495601_0026905
1542 Ga0495595_0340562
1543 Ga0495619_0038479
1544 Ga0495619_0102134
1545 Ga0500616_0000066
1546 Ga0501084_0002623
1547 Ga0501084_0089133
1548 Ga0501084_0191459
1549 Ga0501084_0200738
1550 Ga0501084_0240471
1551 Ga0501084_0305055
1552 Ga0501084_0400011
1553 Ga0501084_0403688
1554 Ga0501084_0494169
1555 Ga0501084_0593513
1556 Ga0590074_001961
1557 Ga0590075_001954
1558 Ga0590075_071936
1559 Ga0590075_156035
1560 Ga0501082_0016294
1561 Ga0501082_0085620
1562 Ga0501082_0675748
1563 Ga0501082_1299493
1564 Ga0501082_1331624
1565 Ga0501082_2033732
1566 Ga0530510_0012576
1567 Ga0530510_0025118
1568 Ga0530510_0572144
1569 Ga0530510_0590017
1570 Ga0530510_0834968

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

45

188

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9607 9 165
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.948 9 161
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9433 9 161
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9317 9 165
3iwt-assembly1.cif.gz_A structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii 0.9245 11 165
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9519 9 156 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9394 9 165 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9336 9 165 3.40.980.10
2pjkA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9242 11 165 3.40.980.10
af_Q57631_3_163_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9157 9 163 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A495D611-F1-model_v4 deleted 0.988 13 153
AF-A0A7C3W447-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9873 12 165 GO:0005829
GO:0006777
AF-A0A2D4WKG4-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9872 12 152 GO:0005829
GO:0006777
AF-A0A1V2JBU5-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.987 12 153 GO:0005829
GO:0006777
AF-U9VPG3-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.987 11 129 GO:0005829
GO:0006777

Map