F480695
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 784 | 342 | 744 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300025914|Ga0207671_10086786|Ga0207671_100867862 |
| Length | 431 |
| Sequence | VILAPGLSGKGKTLLTGAKVQYFRYNNLNGRALYVVFVMILKPLEINRKKNHNHRLMLKRMRGRCRNPLLLFGLLFSCFSASAQFTKYSNEFLNIGAGARGMSMAGAQVASVSDGTAGYWNPAALADIRNAPQLNLMHAEYYAGIGKYDFGNLVLPMKDNKRTLGITVLRFAVDDIPNTIFLVQPDGTVNFDNIKTFSSADYAFIFSLAQRADLSRGRKFNFGVNAKVIYRKAGDFATAWGFGFDAAAQLIGDRWKLGVVAKDVTTTFNAWSYSIDQQMREVFYMTQNEIPTKSTELTAPQLILGGSYNFRLSKKLNLLAEADLDATFDGRRNTVVSTNPISIDPKLGLELSFKDVFFVRAGINNFQKALDDKDTTNQKKIWIYQPSVGAGFKVGDVEIDYAFTNLANQSYPLYTHVFSLRIDMKRKEKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 4 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 5 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 6 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 7 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 8 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 9 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 10 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 11 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 12 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 13 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 14 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 15 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 16 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 17 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 18 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 19 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 20 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 21 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 22 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 23 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 24 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 25 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 26 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 27 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 28 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 29 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 30 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 31 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 32 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 33 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 34 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 35 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 36 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 37 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 38 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 39 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 40 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 41 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 44 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 47 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 77 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 92 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 93 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 94 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 146 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 225 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 237 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 278 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 279 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 280 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 281 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 282 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 307 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 308 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 309 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 313 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 315 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 316 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 317 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 328 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 335 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 336 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 337 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 340 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 341 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 342 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.77 |
| Metatranscriptomes | 0.13 |
| Isolates | 5.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 2.04 |
| Nodule | 0.13 |
| Rhizoplane | 0.89 |
| Rhizosphere | 91.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_6871026 | 2162886011 | Bacteria | 1942 |
| 2 | rootL2_10149466 | 3300003322 | Bacteria | 3190 |
| 3 | rootH1_10068539 | 3300003323 | Bacteria | 5597 |
| 4 | Ga0065714_10069763 | 3300005288 | Bacteria | 4098 |
| 5 | Ga0065714_10071326 | 3300005288 | Bacteria | 3607 |
| 6 | Ga0065704_10015639 | 3300005289 | Bacteria | 1679 |
| 7 | Ga0065704_10071464 | 3300005289 | Bacteria | 11042 |
| 8 | Ga0065704_10075289 | 3300005289 | Bacteria | 5678 |
| 9 | Ga0065704_10089648 | 3300005289 | Bacteria | 2843 |
| 10 | Ga0065712_10003751 | 3300005290 | Bacteria | 5793 |
| 11 | Ga0065712_10110228 | 3300005290 | Bacteria | 1839 |
| 12 | Ga0065715_10094189 | 3300005293 | Bacteria | 4418 |
| 13 | Ga0065707_10120092 | 3300005295 | Bacteria | 2143 |
| 14 | Ga0065707_10120944 | 3300005295 | Bacteria | 2122 |
| 15 | Ga0070658_10000420 | 3300005327 | Bacteria | 36817 |
| 16 | Ga0070676_10002624 | 3300005328 | Bacteria | 9244 |
| 17 | Ga0070676_10045884 | 3300005328 | Bacteria | 2546 |
| 18 | Ga0070683_100022315 | 3300005329 | Bacteria | 5656 |
| 19 | Ga0070690_100011351 | 3300005330 | Bacteria | 5208 |
| 20 | Ga0070670_100019651 | 3300005331 | Bacteria | 5798 |
| 21 | Ga0070670_100037766 | 3300005331 | Bacteria | 4154 |
| 22 | Ga0070670_100081212 | 3300005331 | Bacteria | 2786 |
| 23 | Ga0070670_100102102 | 3300005331 | Unclassified | 2470 |
| 24 | Ga0070670_100208152 | 3300005331 | Unclassified | 1700 |
| 25 | Ga0070677_10015333 | 3300005333 | Bacteria | 2714 |
| 26 | Ga0068869_100002715 | 3300005334 | Bacteria | 10707 |
| 27 | Ga0068869_100016050 | 3300005334 | Bacteria | 5041 |
| 28 | Ga0068869_100020039 | 3300005334 | Bacteria | 4581 |
| 29 | Ga0068869_100090531 | 3300005334 | Bacteria | 2299 |
| 30 | Ga0070666_10011763 | 3300005335 | Bacteria | 5503 |
| 31 | Ga0070666_10037121 | 3300005335 | Bacteria | 3238 |
| 32 | Ga0070682_100101340 | 3300005337 | Unclassified | 1901 |
| 33 | Ga0068868_100000524 | 3300005338 | Bacteria | 25677 |
| 34 | Ga0068868_100000893 | 3300005338 | Bacteria | 20285 |
| 35 | Ga0068868_100003934 | 3300005338 | Bacteria | 10379 |
| 36 | Ga0068868_100023701 | 3300005338 | Bacteria | 4648 |
| 37 | Ga0068868_100055111 | 3300005338 | Bacteria | 3136 |
| 38 | Ga0070689_100002023 | 3300005340 | Bacteria | 13154 |
| 39 | Ga0070689_100015940 | 3300005340 | Bacteria | 5492 |
| 40 | Ga0070689_100226893 | 3300005340 | Bacteria | 1534 |
| 41 | Ga0070689_100287894 | 3300005340 | Bacteria | 1364 |
| 42 | Ga0070687_100034971 | 3300005343 | Unclassified | 2491 |
| 43 | Ga0070661_100000686 | 3300005344 | Bacteria | 24845 |
| 44 | Ga0070661_100007626 | 3300005344 | Bacteria | 7466 |
| 45 | Ga0070668_100000022 | 3300005347 | Bacteria | 96336 |
| 46 | Ga0070668_100017587 | 3300005347 | Bacteria | 5361 |
| 47 | Ga0070668_100022201 | 3300005347 | Bacteria | 4798 |
| 48 | Ga0070668_100135721 | 3300005347 | Bacteria | 1979 |
| 49 | Ga0070668_100180182 | 3300005347 | Unclassified | 1725 |
| 50 | Ga0070668_100346051 | 3300005347 | Bacteria | 1257 |
| 51 | Ga0070669_100001361 | 3300005353 | Bacteria | 17616 |
| 52 | Ga0070669_100019244 | 3300005353 | Bacteria | 4876 |
| 53 | Ga0070669_100022904 | 3300005353 | Bacteria | 4468 |
| 54 | Ga0070675_100003755 | 3300005354 | Bacteria | 11533 |
| 55 | Ga0070675_100026579 | 3300005354 | Bacteria | 4646 |
| 56 | Ga0070675_100162190 | 3300005354 | Bacteria | 1923 |
| 57 | Ga0070675_100237592 | 3300005354 | Unclassified | 1591 |
| 58 | Ga0070671_100037104 | 3300005355 | Bacteria | 4042 |
| 59 | Ga0070671_100098257 | 3300005355 | Bacteria | 2456 |
| 60 | Ga0070671_100140796 | 3300005355 | Bacteria | 2036 |
| 61 | Ga0070674_100253931 | 3300005356 | Unclassified | 1382 |
| 62 | Ga0070673_100000090 | 3300005364 | Bacteria | 39776 |
| 63 | Ga0070673_100002901 | 3300005364 | Bacteria | 10558 |
| 64 | Ga0070673_100020477 | 3300005364 | Bacteria | 4772 |
| 65 | Ga0070673_100033690 | 3300005364 | Bacteria | 3870 |
| 66 | Ga0070673_100040305 | 3300005364 | Bacteria | 3582 |
| 67 | Ga0070673_100050947 | 3300005364 | Bacteria | 3239 |
| 68 | Ga0070688_100001271 | 3300005365 | Bacteria | 12568 |
| 69 | Ga0070688_100024153 | 3300005365 | Bacteria | 3582 |
| 70 | Ga0070659_100022425 | 3300005366 | Bacteria | 4820 |
| 71 | Ga0070659_100081899 | 3300005366 | Bacteria | 2578 |
| 72 | Ga0070667_100001287 | 3300005367 | Bacteria | 22667 |
| 73 | Ga0070667_100003423 | 3300005367 | Bacteria | 13515 |
| 74 | Ga0070667_100029335 | 3300005367 | Bacteria | 4583 |
| 75 | Ga0070667_100038988 | 3300005367 | Bacteria | 3983 |
| 76 | Ga0070667_100043428 | 3300005367 | Bacteria | 3772 |
| 77 | Ga0070667_100131886 | 3300005367 | Bacteria | 2181 |
| 78 | Ga0070667_100133168 | 3300005367 | Unclassified | 2171 |
| 79 | Ga0070701_10022436 | 3300005438 | Bacteria | 3027 |
| 80 | Ga0070700_100075668 | 3300005441 | Bacteria | 2160 |
| 81 | Ga0070700_100095103 | 3300005441 | Unclassified | 1952 |
| 82 | Ga0070678_100035043 | 3300005456 | Bacteria | 3501 |
| 83 | Ga0070678_100080138 | 3300005456 | Bacteria | 2472 |
| 84 | Ga0070678_100135429 | 3300005456 | Bacteria | 1963 |
| 85 | Ga0070662_100002459 | 3300005457 | Bacteria | 11410 |
| 86 | Ga0070662_100004469 | 3300005457 | Bacteria | 8851 |
| 87 | Ga0070662_100047909 | 3300005457 | Bacteria | 3077 |
| 88 | Ga0070662_100187733 | 3300005457 | Unclassified | 1632 |
| 89 | Ga0070681_10011658 | 3300005458 | Bacteria | 8704 |
| 90 | Ga0070681_10054584 | 3300005458 | Bacteria | 3982 |
| 91 | Ga0068867_100002488 | 3300005459 | Bacteria | 12960 |
| 92 | Ga0068867_100007461 | 3300005459 | Bacteria | 7732 |
| 93 | Ga0068867_100050830 | 3300005459 | Bacteria | 3056 |
| 94 | Ga0070685_10025882 | 3300005466 | Bacteria | 3232 |
| 95 | Ga0070685_10140189 | 3300005466 | Bacteria | 1521 |
| 96 | Ga0070698_100001058 | 3300005471 | Bacteria | 30280 |
| 97 | Ga0070698_100005689 | 3300005471 | Bacteria | 13641 |
| 98 | Ga0070679_100161191 | 3300005530 | Bacteria | 2217 |
| 99 | Ga0070684_100000433 | 3300005535 | Bacteria | 28743 |
| 100 | Ga0070684_100000979 | 3300005535 | Bacteria | 20363 |
| 101 | Ga0070684_100011218 | 3300005535 | Bacteria | 7134 |
| 102 | Ga0070684_100080878 | 3300005535 | Bacteria | 2875 |
| 103 | Ga0068853_100011415 | 3300005539 | Bacteria | 7217 |
| 104 | Ga0068853_100015986 | 3300005539 | Bacteria | 6170 |
| 105 | Ga0068853_100063391 | 3300005539 | Bacteria | 3201 |
| 106 | Ga0068853_100172128 | 3300005539 | Bacteria | 1960 |
| 107 | Ga0070672_100000149 | 3300005543 | Bacteria | 38128 |
| 108 | Ga0070672_100017178 | 3300005543 | Bacteria | 5203 |
| 109 | Ga0070672_100123302 | 3300005543 | Bacteria | 2123 |
| 110 | Ga0070686_100052602 | 3300005544 | Bacteria | 2597 |
| 111 | Ga0070693_100108878 | 3300005547 | Unclassified | 1701 |
| 112 | Ga0070665_100001508 | 3300005548 | Bacteria | 27075 |
| 113 | Ga0070665_100024189 | 3300005548 | Bacteria | 6117 |
| 114 | Ga0070665_100044734 | 3300005548 | Bacteria | 4446 |
| 115 | Ga0068855_100342844 | 3300005563 | Unclassified | 1647 |
| 116 | Ga0070664_100138697 | 3300005564 | Bacteria | 2140 |
| 117 | Ga0068857_100012899 | 3300005577 | Bacteria | 7282 |
| 118 | Ga0068857_100019215 | 3300005577 | Bacteria | 5998 |
| 119 | Ga0068857_100049520 | 3300005577 | Unclassified | 3727 |
| 120 | Ga0068857_100060623 | 3300005577 | Bacteria | 3360 |
| 121 | Ga0068857_100218327 | 3300005577 | Bacteria | 1741 |
| 122 | Ga0068854_100010925 | 3300005578 | Bacteria | 5890 |
| 123 | Ga0068854_100041891 | 3300005578 | Bacteria | 3237 |
| 124 | Ga0068854_100049439 | 3300005578 | Unclassified | 3003 |
| 125 | Ga0068854_100063703 | 3300005578 | Bacteria | 2677 |
| 126 | Ga0068854_100187242 | 3300005578 | Bacteria | 1620 |
| 127 | Ga0068856_100139980 | 3300005614 | Bacteria | 2427 |
| 128 | Ga0068852_100001894 | 3300005616 | Bacteria | 14234 |
| 129 | Ga0068852_100009530 | 3300005616 | Bacteria | 7217 |
| 130 | Ga0068852_100017015 | 3300005616 | Bacteria | 5693 |
| 131 | Ga0068852_100034896 | 3300005616 | Bacteria | 4189 |
| 132 | Ga0068852_100115467 | 3300005616 | Bacteria | 2448 |
| 133 | Ga0068852_100150484 | 3300005616 | Bacteria | 2164 |
| 134 | Ga0068852_100242897 | 3300005616 | Unclassified | 1722 |
| 135 | Ga0068859_100000035 | 3300005617 | Bacteria | 169846 |
| 136 | Ga0068859_100003497 | 3300005617 | Bacteria | 15991 |
| 137 | Ga0068859_100030064 | 3300005617 | Bacteria | 5451 |
| 138 | Ga0068859_100034072 | 3300005617 | Bacteria | 5112 |
| 139 | Ga0068859_100088698 | 3300005617 | Bacteria | 3142 |
| 140 | Ga0068859_100131156 | 3300005617 | Unclassified | 2578 |
| 141 | Ga0068859_100165913 | 3300005617 | Bacteria | 2288 |
| 142 | Ga0068864_100000404 | 3300005618 | Bacteria | 37446 |
| 143 | Ga0068864_100003043 | 3300005618 | Bacteria | 13845 |
| 144 | Ga0068864_100003513 | 3300005618 | Bacteria | 12958 |
| 145 | Ga0068864_100009090 | 3300005618 | Bacteria | 8190 |
| 146 | Ga0068864_100013085 | 3300005618 | Bacteria | 6873 |
| 147 | Ga0068864_100025792 | 3300005618 | Bacteria | 4955 |
| 148 | Ga0068864_100062189 | 3300005618 | Bacteria | 3234 |
| 149 | Ga0068866_10074699 | 3300005718 | Unclassified | 1803 |
| 150 | Ga0068861_100021699 | 3300005719 | Bacteria | 4617 |
| 151 | Ga0068861_100024652 | 3300005719 | Bacteria | 4354 |
| 152 | Ga0068861_100038509 | 3300005719 | Bacteria | 3561 |
| 153 | Ga0068851_10001594 | 3300005834 | Bacteria | 9956 |
| 154 | Ga0068851_10068330 | 3300005834 | Bacteria | 1834 |
| 155 | Ga0068870_10001231 | 3300005840 | Bacteria | 10291 |
| 156 | Ga0068870_10035171 | 3300005840 | Bacteria | 2569 |
| 157 | Ga0068863_100000216 | 3300005841 | Bacteria | 61837 |
| 158 | Ga0068863_100004976 | 3300005841 | Bacteria | 13098 |
| 159 | Ga0068863_100021283 | 3300005841 | Bacteria | 6190 |
| 160 | Ga0068863_100056490 | 3300005841 | Bacteria | 3716 |
| 161 | Ga0068858_100001050 | 3300005842 | Bacteria | 28529 |
| 162 | Ga0068858_100002128 | 3300005842 | Bacteria | 20066 |
| 163 | Ga0068858_100049193 | 3300005842 | Unclassified | 3904 |
| 164 | Ga0068858_100314484 | 3300005842 | Unclassified | 1496 |
| 165 | Ga0068860_100000241 | 3300005843 | Bacteria | 83429 |
| 166 | Ga0068860_100005982 | 3300005843 | Bacteria | 12246 |
| 167 | Ga0068860_100028010 | 3300005843 | Bacteria | 5424 |
| 168 | Ga0068860_100034397 | 3300005843 | Bacteria | 4860 |
| 169 | Ga0068860_100046288 | 3300005843 | Bacteria | 4148 |
| 170 | Ga0068860_100082463 | 3300005843 | Bacteria | 3058 |
| 171 | Ga0068860_100139036 | 3300005843 | Unclassified | 2333 |
| 172 | Ga0068862_100011534 | 3300005844 | Bacteria | 7292 |
| 173 | Ga0070715_10070645 | 3300006163 | Unclassified | 1559 |
| 174 | Ga0075366_10000644 | 3300006195 | Bacteria | 16450 |
| 175 | Ga0097621_100000622 | 3300006237 | Bacteria | 25041 |
| 176 | Ga0097621_100002197 | 3300006237 | Bacteria | 13363 |
| 177 | Ga0097621_100009119 | 3300006237 | Bacteria | 7190 |
| 178 | Ga0097621_100012799 | 3300006237 | Bacteria | 6232 |
| 179 | Ga0097621_100036764 | 3300006237 | Bacteria | 3919 |
| 180 | Ga0097621_100145813 | 3300006237 | Unclassified | 2027 |
| 181 | Ga0097621_100364317 | 3300006237 | Unclassified | 1288 |
| 182 | Ga0068871_100000381 | 3300006358 | Bacteria | 31089 |
| 183 | Ga0068871_100006299 | 3300006358 | Bacteria | 8381 |
| 184 | Ga0068871_100042419 | 3300006358 | Bacteria | 3652 |
| 185 | Ga0068871_100082226 | 3300006358 | Bacteria | 2670 |
| 186 | Ga0068871_100106785 | 3300006358 | Bacteria | 2351 |
| 187 | Ga0068871_100222176 | 3300006358 | Bacteria | 1637 |
| 188 | Ga0075428_100007201 | 3300006844 | Bacteria | 12321 |
| 189 | Ga0075428_100085955 | 3300006844 | Unclassified | 3430 |
| 190 | Ga0075430_100005834 | 3300006846 | Bacteria | 10391 |
| 191 | Ga0075430_100111490 | 3300006846 | Bacteria | 2281 |
| 192 | Ga0075431_100013571 | 3300006847 | Bacteria | 8234 |
| 193 | Ga0075431_100064466 | 3300006847 | Bacteria | 3783 |
| 194 | Ga0075431_100167818 | 3300006847 | Bacteria | 2256 |
| 195 | Ga0075429_100046275 | 3300006880 | Bacteria | 3786 |
| 196 | Ga0075429_100102421 | 3300006880 | Bacteria | 2499 |
| 197 | Ga0068865_100002023 | 3300006881 | Bacteria | 11967 |
| 198 | Ga0068865_100164726 | 3300006881 | Bacteria | 1694 |
| 199 | Ga0068865_100252093 | 3300006881 | Bacteria | 1393 |
| 200 | Ga0097620_100000035 | 3300006931 | Bacteria | 169846 |
| 201 | Ga0097620_100003497 | 3300006931 | Bacteria | 15991 |
| 202 | Ga0097620_100030063 | 3300006931 | Bacteria | 5451 |
| 203 | Ga0097620_100034071 | 3300006931 | Bacteria | 5112 |
| 204 | Ga0097620_100088699 | 3300006931 | Bacteria | 3142 |
| 205 | Ga0097620_100131153 | 3300006931 | Unclassified | 2578 |
| 206 | Ga0097620_100165908 | 3300006931 | Bacteria | 2288 |
| 207 | Ga0105244_10000018 | 3300009036 | Bacteria | 244992 |
| 208 | Ga0105250_10067518 | 3300009092 | Bacteria | 1443 |
| 209 | Ga0105240_10000283 | 3300009093 | Bacteria | 99553 |
| 210 | Ga0105240_10000533 | 3300009093 | Bacteria | 70305 |
| 211 | Ga0105240_10002479 | 3300009093 | Bacteria | 29666 |
| 212 | Ga0105240_10009104 | 3300009093 | Bacteria | 14096 |
| 213 | Ga0105240_10016989 | 3300009093 | Bacteria | 9829 |
| 214 | Ga0105240_10063781 | 3300009093 | Bacteria | 4581 |
| 215 | Ga0105240_10071812 | 3300009093 | Unclassified | 4280 |
| 216 | Ga0105240_10162660 | 3300009093 | Bacteria | 2650 |
| 217 | Ga0111539_10022334 | 3300009094 | Bacteria | 7775 |
| 218 | Ga0111539_10047195 | 3300009094 | Bacteria | 5149 |
| 219 | Ga0105245_10140027 | 3300009098 | Unclassified | 2277 |
| 220 | Ga0105247_10002595 | 3300009101 | Bacteria | 12225 |
| 221 | Ga0105247_10007389 | 3300009101 | Bacteria | 6745 |
| 222 | Ga0105247_10065814 | 3300009101 | Bacteria | 2255 |
| 223 | Ga0105247_10083036 | 3300009101 | Unclassified | 2023 |
| 224 | Ga0114129_10032885 | 3300009147 | Bacteria | 7328 |
| 225 | Ga0114129_10063339 | 3300009147 | Bacteria | 5164 |
| 226 | Ga0114129_10675106 | 3300009147 | Bacteria | 1331 |
| 227 | Ga0105243_10000089 | 3300009148 | Bacteria | 103761 |
| 228 | Ga0105241_10000409 | 3300009174 | Bacteria | 32453 |
| 229 | Ga0105241_10001664 | 3300009174 | Bacteria | 16930 |
| 230 | Ga0105241_10002106 | 3300009174 | Bacteria | 15030 |
| 231 | Ga0105241_10168800 | 3300009174 | Bacteria | 1806 |
| 232 | Ga0105241_10354329 | 3300009174 | Bacteria | 1275 |
| 233 | Ga0105242_10012123 | 3300009176 | Bacteria | 6631 |
| 234 | Ga0105242_10013557 | 3300009176 | Bacteria | 6306 |
| 235 | Ga0105242_10013970 | 3300009176 | Bacteria | 6213 |
| 236 | Ga0105242_10033000 | 3300009176 | Bacteria | 4143 |
| 237 | Ga0105242_10044138 | 3300009176 | Bacteria | 3609 |
| 238 | Ga0105242_10445244 | 3300009176 | Bacteria | 1220 |
| 239 | Ga0105248_10131762 | 3300009177 | Bacteria | 2820 |
| 240 | Ga0105248_10242548 | 3300009177 | Unclassified | 2029 |
| 241 | Ga0105237_10000982 | 3300009545 | Bacteria | 38268 |
| 242 | Ga0105237_10001411 | 3300009545 | Bacteria | 31753 |
| 243 | Ga0105237_10020423 | 3300009545 | Bacteria | 6828 |
| 244 | Ga0105237_10041939 | 3300009545 | Bacteria | 4615 |
| 245 | Ga0105237_10078482 | 3300009545 | Unclassified | 3291 |
| 246 | Ga0105238_10412573 | 3300009551 | Unclassified | 1344 |
| 247 | Ga0105249_10001211 | 3300009553 | Bacteria | 22772 |
| 248 | Ga0105249_10001250 | 3300009553 | Bacteria | 22317 |
| 249 | Ga0105249_10001889 | 3300009553 | Bacteria | 18128 |
| 250 | Ga0105249_10006996 | 3300009553 | Bacteria | 9844 |
| 251 | Ga0105249_10007483 | 3300009553 | Bacteria | 9528 |
| 252 | Ga0105249_10008699 | 3300009553 | Bacteria | 8849 |
| 253 | Ga0105249_10196054 | 3300009553 | Unclassified | 1974 |
| 254 | Ga0105249_10283979 | 3300009553 | Bacteria | 1654 |
| 255 | Ga0105239_10001651 | 3300010375 | Bacteria | 29415 |
| 256 | Ga0105239_10001753 | 3300010375 | Bacteria | 28602 |
| 257 | Ga0105239_10048467 | 3300010375 | Bacteria | 4659 |
| 258 | Ga0105239_10071327 | 3300010375 | Bacteria | 3817 |
| 259 | Ga0105239_10324178 | 3300010375 | Unclassified | 1737 |
| 260 | Ga0105246_10328224 | 3300011119 | Unclassified | 1246 |
| 261 | Ga0157373_10000067 | 3300013100 | Bacteria | 92618 |
| 262 | Ga0157373_10002372 | 3300013100 | Bacteria | 14308 |
| 263 | Ga0157371_10000036 | 3300013102 | Bacteria | 215191 |
| 264 | Ga0157371_10016957 | 3300013102 | Bacteria | 5424 |
| 265 | Ga0157371_10029931 | 3300013102 | Bacteria | 3930 |
| 266 | Ga0157371_10047136 | 3300013102 | Bacteria | 3064 |
| 267 | Ga0157371_10070705 | 3300013102 | Bacteria | 2471 |
| 268 | Ga0157371_10122235 | 3300013102 | Bacteria | 1851 |
| 269 | Ga0157370_10000702 | 3300013104 | Bacteria | 41838 |
| 270 | Ga0157370_10001141 | 3300013104 | Bacteria | 33176 |
| 271 | Ga0157370_10003524 | 3300013104 | Bacteria | 18349 |
| 272 | Ga0157370_10013588 | 3300013104 | Bacteria | 8378 |
| 273 | Ga0157369_10000153 | 3300013105 | Bacteria | 97572 |
| 274 | Ga0157369_10270351 | 3300013105 | Bacteria | 1771 |
| 275 | Ga0157369_10275279 | 3300013105 | Bacteria | 1753 |
| 276 | Ga0157369_10322953 | 3300013105 | Bacteria | 1604 |
| 277 | Ga0157374_10000467 | 3300013296 | Bacteria | 36724 |
| 278 | Ga0157374_10018403 | 3300013296 | Bacteria | 6163 |
| 279 | Ga0157374_10020382 | 3300013296 | Bacteria | 5882 |
| 280 | Ga0157374_10042988 | 3300013296 | Bacteria | 4172 |
| 281 | Ga0157374_10057595 | 3300013296 | Bacteria | 3630 |
| 282 | Ga0157374_10166629 | 3300013296 | Bacteria | 2147 |
| 283 | Ga0157374_10183585 | 3300013296 | Bacteria | 2045 |
| 284 | Ga0157378_10002438 | 3300013297 | Bacteria | 16544 |
| 285 | Ga0157378_10020674 | 3300013297 | Bacteria | 5790 |
| 286 | Ga0157378_10037019 | 3300013297 | Bacteria | 4320 |
| 287 | Ga0157378_10056227 | 3300013297 | Bacteria | 3506 |
| 288 | Ga0157378_10078824 | 3300013297 | Bacteria | 2973 |
| 289 | Ga0157378_10095245 | 3300013297 | Bacteria | 2711 |
| 290 | Ga0157378_10210785 | 3300013297 | Unclassified | 1842 |
| 291 | Ga0163162_10000216 | 3300013306 | Bacteria | 52917 |
| 292 | Ga0163162_10000573 | 3300013306 | Bacteria | 34029 |
| 293 | Ga0163162_10000715 | 3300013306 | Bacteria | 30803 |
| 294 | Ga0163162_10000750 | 3300013306 | Bacteria | 30227 |
| 295 | Ga0163162_10001117 | 3300013306 | Bacteria | 24935 |
| 296 | Ga0163162_10006485 | 3300013306 | Bacteria | 11330 |
| 297 | Ga0163162_10011005 | 3300013306 | Bacteria | 8810 |
| 298 | Ga0163162_10039646 | 3300013306 | Bacteria | 4708 |
| 299 | Ga0163162_10143626 | 3300013306 | Bacteria | 2501 |
| 300 | Ga0163162_10264828 | 3300013306 | Bacteria | 1850 |
| 301 | Ga0157372_10000644 | 3300013307 | Bacteria | 38351 |
| 302 | Ga0157372_10012213 | 3300013307 | Bacteria | 9149 |
| 303 | Ga0157372_10051368 | 3300013307 | Bacteria | 4588 |
| 304 | Ga0157372_10055124 | 3300013307 | Bacteria | 4438 |
| 305 | Ga0157372_10315974 | 3300013307 | Bacteria | 1819 |
| 306 | Ga0157372_10587001 | 3300013307 | Bacteria | 1299 |
| 307 | Ga0157375_10000073 | 3300013308 | Bacteria | 105972 |
| 308 | Ga0157375_10001328 | 3300013308 | Bacteria | 21305 |
| 309 | Ga0157375_10002045 | 3300013308 | Bacteria | 17406 |
| 310 | Ga0157375_10010656 | 3300013308 | Bacteria | 8095 |
| 311 | Ga0157375_10015188 | 3300013308 | Bacteria | 6890 |
| 312 | Ga0157375_10036795 | 3300013308 | Bacteria | 4686 |
| 313 | Ga0157375_10068627 | 3300013308 | Bacteria | 3548 |
| 314 | Ga0157375_10078529 | 3300013308 | Bacteria | 3334 |
| 315 | Ga0163163_10000198 | 3300014325 | Bacteria | 62120 |
| 316 | Ga0163163_10003562 | 3300014325 | Bacteria | 13222 |
| 317 | Ga0163163_10003589 | 3300014325 | Bacteria | 13185 |
| 318 | Ga0163163_10279695 | 3300014325 | Bacteria | 1720 |
| 319 | Ga0157380_10000746 | 3300014326 | Bacteria | 20287 |
| 320 | Ga0157380_10014447 | 3300014326 | Bacteria | 5776 |
| 321 | Ga0157380_10073825 | 3300014326 | Bacteria | 2767 |
| 322 | Ga0182008_10000016 | 3300014497 | Bacteria | 241246 |
| 323 | Ga0157377_10002780 | 3300014745 | Bacteria | 7797 |
| 324 | Ga0157377_10006792 | 3300014745 | Bacteria | 5481 |
| 325 | Ga0157379_10000068 | 3300014968 | Bacteria | 65388 |
| 326 | Ga0157379_10006544 | 3300014968 | Bacteria | 10048 |
| 327 | Ga0157379_10070411 | 3300014968 | Bacteria | 3129 |
| 328 | Ga0157379_10082415 | 3300014968 | Bacteria | 2882 |
| 329 | Ga0157379_10085934 | 3300014968 | Bacteria | 2820 |
| 330 | Ga0157379_10275745 | 3300014968 | Bacteria | 1530 |
| 331 | Ga0157376_10000719 | 3300014969 | Bacteria | 21414 |
| 332 | Ga0157376_10000743 | 3300014969 | Bacteria | 21197 |
| 333 | Ga0157376_10003045 | 3300014969 | Bacteria | 11485 |
| 334 | Ga0157376_10004097 | 3300014969 | Bacteria | 10092 |
| 335 | Ga0157376_10277759 | 3300014969 | Bacteria | 1576 |
| 336 | Ga0182006_1000079 | 3300015261 | Bacteria | 122553 |
| 337 | Ga0163161_10005480 | 3300017792 | Bacteria | 8809 |
| 338 | Ga0163161_10006663 | 3300017792 | Bacteria | 7993 |
| 339 | Ga0163161_10008498 | 3300017792 | Bacteria | 7110 |
| 340 | Ga0163161_10016255 | 3300017792 | Bacteria | 5193 |
| 341 | Ga0163161_10048335 | 3300017792 | Unclassified | 3072 |
| 342 | Ga0163161_10156670 | 3300017792 | Bacteria | 1734 |
| 343 | Ga0213876_10016049 | 3300021384 | Bacteria | 3961 |
| 344 | Ga0209675_1000159 | 3300025291 | Bacteria | 87316 |
| 345 | Ga0207656_10002932 | 3300025321 | Bacteria | 5821 |
| 346 | Ga0207696_1039073 | 3300025711 | Bacteria | 1398 |
| 347 | Ga0207655_1000058 | 3300025728 | Bacteria | 267656 |
| 348 | Ga0207682_10032510 | 3300025893 | Bacteria | 2097 |
| 349 | Ga0207642_10074905 | 3300025899 | Unclassified | 1624 |
| 350 | Ga0207710_10002918 | 3300025900 | Bacteria | 7769 |
| 351 | Ga0207710_10059521 | 3300025900 | Unclassified | 1729 |
| 352 | Ga0207688_10004641 | 3300025901 | Bacteria | 7487 |
| 353 | Ga0207680_10000049 | 3300025903 | Bacteria | 57625 |
| 354 | Ga0207680_10082876 | 3300025903 | Unclassified | 2020 |
| 355 | Ga0207647_10001371 | 3300025904 | Bacteria | 18715 |
| 356 | Ga0207647_10016648 | 3300025904 | Bacteria | 5014 |
| 357 | Ga0207645_10004561 | 3300025907 | Bacteria | 10226 |
| 358 | Ga0207645_10006815 | 3300025907 | Bacteria | 8154 |
| 359 | Ga0207645_10011044 | 3300025907 | Bacteria | 6181 |
| 360 | Ga0207643_10002391 | 3300025908 | Bacteria | 10176 |
| 361 | Ga0207643_10023285 | 3300025908 | Bacteria | 3415 |
| 362 | Ga0207643_10042590 | 3300025908 | Bacteria | 2560 |
| 363 | Ga0207643_10061636 | 3300025908 | Bacteria | 2142 |
| 364 | Ga0207705_10015209 | 3300025909 | Bacteria | 5528 |
| 365 | Ga0207654_10002542 | 3300025911 | Bacteria | 9256 |
| 366 | Ga0207654_10008473 | 3300025911 | Bacteria | 5201 |
| 367 | Ga0207654_10031825 | 3300025911 | Bacteria | 2909 |
| 368 | Ga0207707_10000508 | 3300025912 | Bacteria | 39968 |
| 369 | Ga0207707_10042220 | 3300025912 | Bacteria | 3982 |
| 370 | Ga0207695_10000632 | 3300025913 | Bacteria | 70471 |
| 371 | Ga0207695_10002023 | 3300025913 | Bacteria | 31171 |
| 372 | Ga0207695_10003728 | 3300025913 | Bacteria | 21215 |
| 373 | Ga0207695_10028321 | 3300025913 | Bacteria | 6217 |
| 374 | Ga0207695_10040957 | 3300025913 | Bacteria | 4961 |
| 375 | Ga0207671_10001126 | 3300025914 | Bacteria | 32182 |
| 376 | Ga0207671_10004179 | 3300025914 | Bacteria | 13946 |
| 377 | Ga0207671_10062160 | 3300025914 | Unclassified | 2772 |
| 378 | Ga0207671_10086786 | 3300025914 | Bacteria | 2352 |
| 379 | Ga0207671_10112435 | 3300025914 | Bacteria | 2073 |
| 380 | Ga0207671_10126102 | 3300025914 | Unclassified | 1961 |
| 381 | Ga0207660_10002757 | 3300025917 | Bacteria | 11512 |
| 382 | Ga0207662_10048976 | 3300025918 | Unclassified | 2505 |
| 383 | Ga0207662_10067885 | 3300025918 | Bacteria | 2152 |
| 384 | Ga0207657_10044566 | 3300025919 | Bacteria | 3898 |
| 385 | Ga0207649_10001711 | 3300025920 | Bacteria | 12613 |
| 386 | Ga0207649_10032408 | 3300025920 | Bacteria | 3115 |
| 387 | Ga0207649_10080371 | 3300025920 | Unclassified | 2108 |
| 388 | Ga0207652_10001607 | 3300025921 | Bacteria | 19870 |
| 389 | Ga0207652_10183771 | 3300025921 | Bacteria | 1879 |
| 390 | Ga0207681_10003164 | 3300025923 | Bacteria | 10335 |
| 391 | Ga0207681_10020575 | 3300025923 | Bacteria | 4184 |
| 392 | Ga0207650_10001678 | 3300025925 | Bacteria | 15729 |
| 393 | Ga0207650_10017509 | 3300025925 | Bacteria | 5019 |
| 394 | Ga0207650_10069980 | 3300025925 | Bacteria | 2637 |
| 395 | Ga0207650_10085597 | 3300025925 | Bacteria | 2399 |
| 396 | Ga0207659_10012954 | 3300025926 | Bacteria | 5326 |
| 397 | Ga0207659_10051000 | 3300025926 | Bacteria | 2941 |
| 398 | Ga0207659_10060538 | 3300025926 | Bacteria | 2725 |
| 399 | Ga0207659_10129856 | 3300025926 | Bacteria | 1943 |
| 400 | Ga0207659_10148537 | 3300025926 | Unclassified | 1828 |
| 401 | Ga0207644_10101857 | 3300025931 | Bacteria | 2159 |
| 402 | Ga0207644_10128783 | 3300025931 | Bacteria | 1935 |
| 403 | Ga0207690_10022219 | 3300025932 | Unclassified | 3944 |
| 404 | Ga0207706_10002489 | 3300025933 | Bacteria | 17951 |
| 405 | Ga0207706_10011208 | 3300025933 | Bacteria | 8174 |
| 406 | Ga0207706_10013718 | 3300025933 | Bacteria | 7353 |
| 407 | Ga0207706_10019228 | 3300025933 | Bacteria | 6142 |
| 408 | Ga0207706_10025520 | 3300025933 | Bacteria | 5295 |
| 409 | Ga0207706_10038722 | 3300025933 | Bacteria | 4229 |
| 410 | Ga0207706_10066786 | 3300025933 | Unclassified | 3165 |
| 411 | Ga0207686_10000957 | 3300025934 | Bacteria | 17232 |
| 412 | Ga0207686_10027589 | 3300025934 | Bacteria | 3327 |
| 413 | Ga0207686_10046499 | 3300025934 | Bacteria | 2677 |
| 414 | Ga0207709_10000136 | 3300025935 | Bacteria | 106728 |
| 415 | Ga0207670_10007585 | 3300025936 | Bacteria | 6064 |
| 416 | Ga0207670_10014800 | 3300025936 | Bacteria | 4643 |
| 417 | Ga0207669_10023202 | 3300025937 | Bacteria | 3310 |
| 418 | Ga0207669_10026967 | 3300025937 | Bacteria | 3135 |
| 419 | Ga0207669_10058491 | 3300025937 | Bacteria | 2352 |
| 420 | Ga0207704_10014960 | 3300025938 | Bacteria | 3939 |
| 421 | Ga0207691_10000113 | 3300025940 | Bacteria | 72765 |
| 422 | Ga0207691_10006449 | 3300025940 | Bacteria | 11331 |
| 423 | Ga0207691_10012590 | 3300025940 | Bacteria | 8109 |
| 424 | Ga0207691_10058596 | 3300025940 | Bacteria | 3503 |
| 425 | Ga0207691_10075497 | 3300025940 | Bacteria | 3039 |
| 426 | Ga0207691_10104587 | 3300025940 | Bacteria | 2523 |
| 427 | Ga0207691_10168417 | 3300025940 | Bacteria | 1919 |
| 428 | Ga0207691_10171201 | 3300025940 | Bacteria | 1902 |
| 429 | Ga0207691_10233963 | 3300025940 | Bacteria | 1590 |
| 430 | Ga0207689_10001700 | 3300025942 | Bacteria | 20878 |
| 431 | Ga0207689_10006964 | 3300025942 | Bacteria | 9941 |
| 432 | Ga0207689_10007318 | 3300025942 | Bacteria | 9686 |
| 433 | Ga0207689_10009324 | 3300025942 | Bacteria | 8484 |
| 434 | Ga0207689_10010988 | 3300025942 | Bacteria | 7784 |
| 435 | Ga0207689_10025569 | 3300025942 | Bacteria | 4947 |
| 436 | Ga0207689_10036067 | 3300025942 | Bacteria | 4106 |
| 437 | Ga0207689_10051709 | 3300025942 | Bacteria | 3387 |
| 438 | Ga0207689_10094720 | 3300025942 | Bacteria | 2452 |
| 439 | Ga0207689_10100140 | 3300025942 | Bacteria | 2381 |
| 440 | Ga0207689_10119221 | 3300025942 | Bacteria | 2171 |
| 441 | Ga0207661_10008012 | 3300025944 | Bacteria | 7530 |
| 442 | Ga0207661_10018301 | 3300025944 | Bacteria | 5204 |
| 443 | Ga0207679_10046793 | 3300025945 | Bacteria | 3138 |
| 444 | Ga0207679_10089928 | 3300025945 | Bacteria | 2371 |
| 445 | Ga0207679_10292740 | 3300025945 | Unclassified | 1400 |
| 446 | Ga0207667_10001859 | 3300025949 | Bacteria | 26535 |
| 447 | Ga0207667_10108051 | 3300025949 | Bacteria | 2870 |
| 448 | Ga0207667_10293843 | 3300025949 | Unclassified | 1660 |
| 449 | Ga0207667_10349110 | 3300025949 | Bacteria | 1509 |
| 450 | Ga0207667_10376757 | 3300025949 | Unclassified | 1446 |
| 451 | Ga0207651_10000313 | 3300025960 | Bacteria | 20839 |
| 452 | Ga0207651_10018844 | 3300025960 | Bacteria | 4120 |
| 453 | Ga0207651_10024772 | 3300025960 | Bacteria | 3718 |
| 454 | Ga0207651_10304138 | 3300025960 | Unclassified | 1327 |
| 455 | Ga0207712_10001108 | 3300025961 | Bacteria | 18819 |
| 456 | Ga0207712_10003924 | 3300025961 | Bacteria | 9396 |
| 457 | Ga0207712_10003997 | 3300025961 | Bacteria | 9306 |
| 458 | Ga0207712_10017543 | 3300025961 | Unclassified | 4651 |
| 459 | Ga0207712_10098500 | 3300025961 | Bacteria | 2168 |
| 460 | Ga0207712_10161304 | 3300025961 | Unclassified | 1743 |
| 461 | Ga0207668_10005826 | 3300025972 | Bacteria | 7258 |
| 462 | Ga0207668_10006568 | 3300025972 | Bacteria | 6875 |
| 463 | Ga0207668_10033964 | 3300025972 | Bacteria | 3383 |
| 464 | Ga0207668_10039980 | 3300025972 | Bacteria | 3161 |
| 465 | Ga0207668_10083349 | 3300025972 | Bacteria | 2326 |
| 466 | Ga0207668_10096016 | 3300025972 | Bacteria | 2190 |
| 467 | Ga0207640_10011687 | 3300025981 | Bacteria | 4977 |
| 468 | Ga0207640_10026322 | 3300025981 | Bacteria | 3530 |
| 469 | Ga0207640_10114839 | 3300025981 | Bacteria | 1917 |
| 470 | Ga0207658_10001468 | 3300025986 | Bacteria | 18385 |
| 471 | Ga0207658_10008605 | 3300025986 | Bacteria | 6944 |
| 472 | Ga0207658_10019093 | 3300025986 | Bacteria | 4741 |
| 473 | Ga0207658_10047273 | 3300025986 | Bacteria | 3149 |
| 474 | Ga0207658_10320060 | 3300025986 | Bacteria | 1342 |
| 475 | Ga0207677_10001071 | 3300026023 | Bacteria | 14919 |
| 476 | Ga0207677_10003542 | 3300026023 | Bacteria | 8271 |
| 477 | Ga0207677_10014262 | 3300026023 | Bacteria | 4635 |
| 478 | Ga0207677_10115800 | 3300026023 | Bacteria | 2006 |
| 479 | Ga0207703_10000316 | 3300026035 | Bacteria | 52401 |
| 480 | Ga0207703_10003752 | 3300026035 | Bacteria | 12645 |
| 481 | Ga0207703_10085260 | 3300026035 | Unclassified | 2643 |
| 482 | Ga0207639_10016281 | 3300026041 | Bacteria | 5257 |
| 483 | Ga0207639_10023282 | 3300026041 | Bacteria | 4471 |
| 484 | Ga0207639_10069185 | 3300026041 | Unclassified | 2754 |
| 485 | Ga0207639_10079273 | 3300026041 | Bacteria | 2595 |
| 486 | Ga0207639_10172543 | 3300026041 | Bacteria | 1833 |
| 487 | Ga0207639_10177206 | 3300026041 | Bacteria | 1810 |
| 488 | Ga0207639_10295584 | 3300026041 | Bacteria | 1430 |
| 489 | Ga0207708_10109127 | 3300026075 | Bacteria | 2147 |
| 490 | Ga0207702_10395026 | 3300026078 | Unclassified | 1332 |
| 491 | Ga0207641_10000043 | 3300026088 | Bacteria | 186340 |
| 492 | Ga0207641_10008056 | 3300026088 | Bacteria | 8731 |
| 493 | Ga0207641_10019872 | 3300026088 | Bacteria | 5511 |
| 494 | Ga0207641_10034018 | 3300026088 | Bacteria | 4236 |
| 495 | Ga0207641_10149779 | 3300026088 | Bacteria | 2112 |
| 496 | Ga0207648_10002914 | 3300026089 | Bacteria | 18110 |
| 497 | Ga0207648_10005321 | 3300026089 | Bacteria | 12980 |
| 498 | Ga0207648_10019640 | 3300026089 | Bacteria | 6098 |
| 499 | Ga0207648_10034780 | 3300026089 | Bacteria | 4441 |
| 500 | Ga0207648_10129402 | 3300026089 | Bacteria | 2222 |
| 501 | Ga0207648_10368613 | 3300026089 | Unclassified | 1297 |
| 502 | Ga0207676_10001587 | 3300026095 | Bacteria | 16726 |
| 503 | Ga0207676_10002542 | 3300026095 | Bacteria | 13025 |
| 504 | Ga0207676_10004515 | 3300026095 | Bacteria | 9844 |
| 505 | Ga0207676_10005296 | 3300026095 | Bacteria | 9136 |
| 506 | Ga0207676_10070729 | 3300026095 | Bacteria | 2799 |
| 507 | Ga0207676_10080892 | 3300026095 | Bacteria | 2638 |
| 508 | Ga0207676_10086172 | 3300026095 | Bacteria | 2565 |
| 509 | Ga0207676_10119192 | 3300026095 | Bacteria | 2222 |
| 510 | Ga0207674_10003090 | 3300026116 | Bacteria | 20578 |
| 511 | Ga0207674_10014288 | 3300026116 | Bacteria | 8774 |
| 512 | Ga0207674_10034583 | 3300026116 | Bacteria | 5280 |
| 513 | Ga0207674_10037559 | 3300026116 | Bacteria | 5036 |
| 514 | Ga0207674_10048075 | 3300026116 | Bacteria | 4369 |
| 515 | Ga0207674_10143834 | 3300026116 | Unclassified | 2344 |
| 516 | Ga0207674_10244073 | 3300026116 | Bacteria | 1743 |
| 517 | Ga0207674_10287226 | 3300026116 | Bacteria | 1593 |
| 518 | Ga0207674_10414143 | 3300026116 | Unclassified | 1302 |
| 519 | Ga0207675_100007098 | 3300026118 | Bacteria | 10587 |
| 520 | Ga0207675_100016213 | 3300026118 | Bacteria | 6956 |
| 521 | Ga0207675_100027432 | 3300026118 | Bacteria | 5304 |
| 522 | Ga0207675_100039964 | 3300026118 | Bacteria | 4377 |
| 523 | Ga0207675_100042272 | 3300026118 | Bacteria | 4254 |
| 524 | Ga0207675_100145111 | 3300026118 | Bacteria | 2256 |
| 525 | Ga0207675_100155714 | 3300026118 | Unclassified | 2177 |
| 526 | Ga0207683_10014909 | 3300026121 | Bacteria | 6616 |
| 527 | Ga0207683_10051899 | 3300026121 | Bacteria | 3593 |
| 528 | Ga0207683_10108668 | 3300026121 | Bacteria | 2482 |
| 529 | Ga0207683_10187855 | 3300026121 | Unclassified | 1875 |
| 530 | Ga0207683_10394655 | 3300026121 | Bacteria | 1272 |
| 531 | Ga0207698_10017399 | 3300026142 | Bacteria | 4875 |
| 532 | Ga0207698_10063382 | 3300026142 | Bacteria | 2892 |
| 533 | Ga0207698_10109750 | 3300026142 | Bacteria | 2309 |
| 534 | Ga0207698_10126739 | 3300026142 | Bacteria | 2173 |
| 535 | Ga0268266_10000102 | 3300028379 | Bacteria | 179754 |
| 536 | Ga0268266_10006375 | 3300028379 | Bacteria | 10805 |
| 537 | Ga0268266_10063348 | 3300028379 | Bacteria | 3192 |
| 538 | Ga0268266_10278251 | 3300028379 | Bacteria | 1555 |
| 539 | Ga0268265_10022442 | 3300028380 | Bacteria | 4435 |
| 540 | Ga0268264_10000011 | 3300028381 | Bacteria | 580884 |
| 541 | Ga0268264_10002558 | 3300028381 | Bacteria | 15941 |
| 542 | Ga0268264_10003015 | 3300028381 | Bacteria | 14601 |
| 543 | Ga0268264_10007707 | 3300028381 | Bacteria | 8968 |
| 544 | Ga0268264_10012018 | 3300028381 | Bacteria | 7128 |
| 545 | Ga0268264_10049163 | 3300028381 | Bacteria | 3508 |
| 546 | Ga0268264_10217434 | 3300028381 | Unclassified | 1757 |
| 547 | Ga0307517_10005347 | 3300028786 | Bacteria | 19393 |
| 548 | Ga0307515_10000036 | 3300028794 | Bacteria | 332188 |
| 549 | Ga0307511_10007489 | 3300030521 | Bacteria | 10970 |
| 550 | Ga0265327_10000366 | 3300031251 | Bacteria | 85818 |
| 551 | Ga0307509_10153774 | 3300031507 | Bacteria | 2211 |
| 552 | Ga0307516_10022409 | 3300031730 | Bacteria | 6487 |
| 553 | Ga0307412_10000640 | 3300031911 | Bacteria | 20375 |
| 554 | Ga0307412_10001858 | 3300031911 | Bacteria | 11683 |
| 555 | Ga0307412_10002518 | 3300031911 | Bacteria | 10189 |
| 556 | Ga0307416_100000020 | 3300032002 | Bacteria | 192862 |
| 557 | Ga0307414_10000041 | 3300032004 | Bacteria | 144783 |
| 558 | Ga0307411_10212178 | 3300032005 | Bacteria | 1496 |
| 559 | Ga0307510_10000119 | 3300033180 | Bacteria | 62835 |
| 560 | Ga0373924_0004327 | 3300035410 | Bacteria | 4955 |
| 561 | Ga0373937_0006203 | 3300036401 | Bacteria | 10298 |
| 562 | Ga0373937_0158894 | 3300036401 | Unclassified | 2119 |
| 563 | Ga0395905_0077497 | 3300037471 | Bacteria | 3115 |
| 564 | Ga0395905_0120705 | 3300037471 | Bacteria | 2464 |
| 565 | Ga0436365_1726582 | 3300039437 | Bacteria | 12978 |
| 566 | Ga0436361_0978887 | 3300039447 | Bacteria | 2398 |
| 567 | Ga0439436_0005145 | 3300041404 | Bacteria | 4010 |
| 568 | Ga0439439_0005639 | 3300041406 | Bacteria | 2867 |
| 569 | Ga0439465_0000489 | 3300041413 | Bacteria | 11781 |
| 570 | Ga0451853_0979218 | 3300041512 | Bacteria | 1522 |
| 571 | Ga0439431_0009943 | 3300041997 | Bacteria | 2154 |
| 572 | Ga0439445_0000605 | 3300042004 | Bacteria | 7352 |
| 573 | Ga0439457_003897 | 3300042014 | Bacteria | 3993 |
| 574 | Ga0450897_000436 | 3300042128 | Bacteria | 2288 |
| 575 | Ga0439434_0020291 | 3300042435 | Bacteria | 1995 |
| 576 | Ga0439444_0006971 | 3300042437 | Unclassified | 1723 |
| 577 | Ga0451577_0020626 | 3300042876 | Bacteria | 6045 |
| 578 | Ga0451577_0127521 | 3300042876 | Bacteria | 2281 |
| 579 | Ga0451577_0182934 | 3300042876 | Unclassified | 1890 |
| 580 | Ga0466969_0000666 | 3300044656 | Bacteria | 18679 |
| 581 | Ga0466972_0000182 | 3300044658 | Bacteria | 48545 |
| 582 | Ga0466972_0001943 | 3300044658 | Bacteria | 10144 |
| 583 | Ga0466966_0000030 | 3300044684 | Bacteria | 103300 |
| 584 | Ga0466961_0047451 | 3300044693 | Bacteria | 2746 |
| 585 | Ga0453684_0019544 | 3300044712 | Bacteria | 10301 |
| 586 | Ga0453684_0143615 | 3300044712 | Unclassified | 2846 |
| 587 | Ga0453684_0482226 | 3300044712 | Bacteria | 1375 |
| 588 | Ga0466957_0002003 | 3300044842 | Bacteria | 10844 |
| 589 | Ga0466957_0008313 | 3300044842 | Bacteria | 5900 |
| 590 | Ga0466959_0000009 | 3300045049 | Bacteria | 176964 |
| 591 | Ga0466959_0008643 | 3300045049 | Bacteria | 7207 |
| 592 | Ga0466958_0021588 | 3300045836 | Unclassified | 3765 |
| 593 | Ga0495627_000029 | 3300046453 | Bacteria | 232349 |
| 594 | Ga0495627_007357 | 3300046453 | Bacteria | 4226 |
| 595 | Ga0495590_0003729 | 3300046457 | Bacteria | 6201 |
| 596 | Ga0495638_0041347 | 3300046460 | Bacteria | 2917 |
| 597 | Ga0495638_0074526 | 3300046460 | Bacteria | 2070 |
| 598 | Ga0495580_0085514 | 3300046472 | Unclassified | 2197 |
| 599 | Ga0495582_0014360 | 3300046473 | Bacteria | 4354 |
| 600 | Ga0495639_0055812 | 3300046475 | Bacteria | 1802 |
| 601 | Ga0495606_0003913 | 3300046507 | Bacteria | 15321 |
| 602 | Ga0495606_0050092 | 3300046507 | Bacteria | 2734 |
| 603 | Ga0495606_0107711 | 3300046507 | Bacteria | 1685 |
| 604 | Ga0495608_0055996 | 3300046511 | Bacteria | 2605 |
| 605 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 606 | Ga0495630_0083819 | 3300046517 | Bacteria | 2407 |
| 607 | Ga0495632_0006192 | 3300046519 | Bacteria | 7746 |
| 608 | Ga0495643_0022766 | 3300046522 | Bacteria | 3568 |
| 609 | Ga0495648_0004169 | 3300046524 | Bacteria | 12432 |
| 610 | Ga0495663_0000243 | 3300046525 | Bacteria | 21677 |
| 611 | Ga0495663_0003226 | 3300046525 | Bacteria | 4743 |
| 612 | Ga0495654_0000008 | 3300046530 | Bacteria | 398340 |
| 613 | Ga0495586_0084249 | 3300046535 | Bacteria | 1750 |
| 614 | Ga0495587_0101986 | 3300046536 | Bacteria | 1653 |
| 615 | Ga0495609_0000010 | 3300046538 | Bacteria | 342605 |
| 616 | Ga0495633_0000163 | 3300046558 | Bacteria | 87285 |
| 617 | Ga0495633_0003132 | 3300046558 | Bacteria | 11208 |
| 618 | Ga0495667_0089845 | 3300046559 | Unclassified | 1991 |
| 619 | Ga0495668_0042839 | 3300046616 | Bacteria | 2519 |
| 620 | Ga0495611_0000196 | 3300046648 | Bacteria | 42876 |
| 621 | Ga0495611_0020777 | 3300046648 | Bacteria | 2830 |
| 622 | Ga0495625_0009153 | 3300046660 | Bacteria | 8328 |
| 623 | Ga0495625_0043787 | 3300046660 | Unclassified | 3244 |
| 624 | Ga0495625_0168790 | 3300046660 | Bacteria | 1462 |
| 625 | Ga0495635_0048931 | 3300046663 | Bacteria | 2914 |
| 626 | Ga0495657_0034896 | 3300046675 | Bacteria | 3491 |
| 627 | Ga0495613_0127420 | 3300046689 | Unclassified | 1825 |
| 628 | Ga0495670_0061833 | 3300046691 | Unclassified | 1883 |
| 629 | Ga0495672_0042755 | 3300047320 | Bacteria | 2730 |
| 630 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 631 | Ga0495675_0094841 | 3300047444 | Bacteria | 1871 |
| 632 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 633 | Ga0495686_0000153 | 3300047472 | Bacteria | 133256 |
| 634 | Ga0495686_0009346 | 3300047472 | Bacteria | 7069 |
| 635 | Ga0496100_0012425 | 3300048903 | Bacteria | 4882 |
| 636 | Ga0496102_0008085 | 3300048905 | Bacteria | 8999 |
| 637 | Ga0496108_0127744 | 3300048911 | Bacteria | 2184 |
| 638 | Ga0496109_0141592 | 3300048912 | Bacteria | 2249 |
| 639 | Ga0496110_0060307 | 3300048913 | Bacteria | 3345 |
| 640 | Ga0496113_0068299 | 3300048916 | Bacteria | 2697 |
| 641 | Ga0496115_0136596 | 3300048918 | Bacteria | 2022 |
| 642 | Ga0496116_0000037 | 3300048919 | Bacteria | 374675 |
| 643 | Ga0496117_0000086 | 3300048920 | Bacteria | 212331 |
| 644 | Ga0496117_0155628 | 3300048920 | Bacteria | 1346 |
| 645 | Ga0496118_0000284 | 3300048921 | Bacteria | 88966 |
| 646 | Ga0496118_0040654 | 3300048921 | Bacteria | 3694 |
| 647 | Ga0496119_0000037 | 3300048922 | Bacteria | 210912 |
| 648 | Ga0496121_0109943 | 3300048924 | Bacteria | 2104 |
| 649 | Ga0496122_0000389 | 3300048925 | Bacteria | 93538 |
| 650 | Ga0496122_0000489 | 3300048925 | Bacteria | 82241 |
| 651 | Ga0496122_0004673 | 3300048925 | Bacteria | 16820 |
| 652 | Ga0496122_0013915 | 3300048925 | Bacteria | 7825 |
| 653 | Ga0496122_0019795 | 3300048925 | Bacteria | 6129 |
| 654 | Ga0496123_0000739 | 3300048926 | Bacteria | 52947 |
| 655 | Ga0496123_0008923 | 3300048926 | Bacteria | 9117 |
| 656 | Ga0496123_0050450 | 3300048926 | Bacteria | 2780 |
| 657 | Ga0496124_0006053 | 3300048927 | Bacteria | 13321 |
| 658 | Ga0496125_0000685 | 3300048928 | Bacteria | 56407 |
| 659 | Ga0496125_0009248 | 3300048928 | Bacteria | 10176 |
| 660 | Ga0496125_0011751 | 3300048928 | Bacteria | 8727 |
| 661 | Ga0496126_0002873 | 3300048929 | Bacteria | 22479 |
| 662 | Ga0501335_002129 | 3300049551 | Bacteria | 1585 |
| 663 | Ga0501031_0004536 | 3300049568 | Bacteria | 9001 |
| 664 | Ga0501032_0031441 | 3300049569 | Bacteria | 3640 |
| 665 | Ga0501032_0046480 | 3300049569 | Bacteria | 2934 |
| 666 | Ga0501034_0003582 | 3300049571 | Bacteria | 17631 |
| 667 | Ga0501034_0040999 | 3300049571 | Bacteria | 4684 |
| 668 | Ga0501036_0000630 | 3300049572 | Bacteria | 25708 |
| 669 | Ga0501036_0001356 | 3300049572 | Bacteria | 18774 |
| 670 | Ga0501037_0007477 | 3300049573 | Bacteria | 7994 |
| 671 | Ga0501037_0083250 | 3300049573 | Unclassified | 2318 |
| 672 | Ga0501038_0052718 | 3300049574 | Bacteria | 3506 |
| 673 | Ga0501039_0004101 | 3300049575 | Bacteria | 10964 |
| 674 | Ga0501043_0013189 | 3300049579 | Bacteria | 6464 |
| 675 | Ga0501043_0174971 | 3300049579 | Bacteria | 1674 |
| 676 | Ga0501046_0002967 | 3300049580 | Bacteria | 15697 |
| 677 | Ga0501047_0004450 | 3300049581 | Bacteria | 13194 |
| 678 | Ga0501047_0020430 | 3300049581 | Bacteria | 6359 |
| 679 | Ga0501047_0063759 | 3300049581 | Bacteria | 3555 |
| 680 | Ga0501047_0130519 | 3300049581 | Bacteria | 2393 |
| 681 | Ga0501047_0178622 | 3300049581 | Bacteria | 1990 |
| 682 | Ga0501048_0035393 | 3300049582 | Bacteria | 3595 |
| 683 | Ga0501067_0009302 | 3300049583 | Bacteria | 5444 |
| 684 | Ga0501068_0051628 | 3300049584 | Bacteria | 2488 |
| 685 | Ga0501068_0213893 | 3300049584 | Unclassified | 1224 |
| 686 | Ga0501069_0006684 | 3300049585 | Bacteria | 6038 |
| 687 | Ga0501070_0297125 | 3300049586 | Bacteria | 1316 |
| 688 | Ga0501073_0004829 | 3300049589 | Bacteria | 10114 |
| 689 | Ga0501073_0058380 | 3300049589 | Bacteria | 2696 |
| 690 | Ga0501074_0010705 | 3300049590 | Bacteria | 6660 |
| 691 | Ga0501074_0174662 | 3300049590 | Bacteria | 1533 |
| 692 | Ga0501076_0195832 | 3300049592 | Bacteria | 1650 |
| 693 | Ga0501202_000050 | 3300049652 | Bacteria | 12265 |
| 694 | Ga0501207_000735 | 3300049654 | Unclassified | 3857 |
| 695 | Ga0501217_000079 | 3300049661 | Bacteria | 11818 |
| 696 | Ga0501223_000157 | 3300049663 | Bacteria | 17995 |
| 697 | Ga0501235_000643 | 3300049669 | Bacteria | 7040 |
| 698 | Ga0501251_000677 | 3300049681 | Unclassified | 3065 |
| 699 | Ga0501257_010955 | 3300049686 | Bacteria | 2063 |
| 700 | Ga0501257_019869 | 3300049686 | Unclassified | 1573 |
| 701 | Ga0501259_000566 | 3300049688 | Bacteria | 5904 |
| 702 | Ga0501261_000336 | 3300049690 | Bacteria | 6351 |
| 703 | Ga0501219_000158 | 3300049703 | Bacteria | 12365 |
| 704 | Ga0501221_000123 | 3300049704 | Bacteria | 9752 |
| 705 | Ga0501225_0000570 | 3300049705 | Bacteria | 11554 |
| 706 | Ga0501234_001234 | 3300049707 | Bacteria | 4017 |
| 707 | Ga0501245_000180 | 3300049708 | Bacteria | 7000 |
| 708 | Ga0501079_0028834 | 3300049741 | Bacteria | 4261 |
| 709 | Ga0501080_0015066 | 3300049742 | Bacteria | 7125 |
| 710 | Ga0501083_0007396 | 3300049744 | Bacteria | 7790 |
| 711 | Ga0501241_000009 | 3300049758 | Bacteria | 128695 |
| 712 | Ga0501241_006951 | 3300049758 | Bacteria | 2078 |
| 713 | Ga0501269_000196 | 3300049766 | Bacteria | 18180 |
| 714 | Ga0501035_0032120 | 3300049822 | Bacteria | 4778 |
| 715 | Ga0501035_0045457 | 3300049822 | Bacteria | 3951 |
| 716 | Ga0501035_0345990 | 3300049822 | Bacteria | 1245 |
| 717 | Ga0501044_0018446 | 3300049823 | Bacteria | 7476 |
| 718 | Ga0501284_00050 | 3300050005 | Bacteria | 43535 |
| 719 | nmdc:mga05p37_230156_c1 | 3300050507 | Bacteria | 2234 |
| 720 | nmdc:mga09592_18509_c1 | 3300050508 | Bacteria | 5713 |
| 721 | nmdc:mga09592_201507_c1 | 3300050508 | Bacteria | 1724 |
| 722 | nmdc:mga09592_220978_c1 | 3300050508 | Bacteria | 1641 |
| 723 | nmdc:mga0qj67_104414_c1 | 3300050509 | Bacteria | 2286 |
| 724 | nmdc:mga0qj67_15330_c1 | 3300050509 | Bacteria | 5804 |
| 725 | nmdc:mga06r32_13190_c1 | 3300050510 | Bacteria | 7487 |
| 726 | nmdc:mga06r32_290716_c1 | 3300050510 | Unclassified | 1621 |
| 727 | nmdc:mga06r32_71915_c1 | 3300050510 | Bacteria | 3348 |
| 728 | nmdc:mga08y16_126848_c1 | 3300050511 | Bacteria | 2654 |
| 729 | nmdc:mga08y16_242178_c1 | 3300050511 | Unclassified | 1864 |
| 730 | Ga0500578_0000529 | 3300053086 | Bacteria | 46403 |
| 731 | Ga0500646_0007214 | 3300053090 | Bacteria | 2836 |
| 732 | Ga0500646_0011254 | 3300053090 | Bacteria | 2299 |
| 733 | Ga0500583_0000016 | 3300053092 | Bacteria | 144540 |
| 734 | Ga0500583_0000708 | 3300053092 | Bacteria | 9699 |
| 735 | Ga0500583_0002224 | 3300053092 | Bacteria | 5763 |
| 736 | Ga0500652_013545 | 3300053131 | Bacteria | 2891 |
| 737 | Ga0500568_0002668 | 3300053139 | Bacteria | 10352 |
| 738 | Ga0500568_0011028 | 3300053139 | Bacteria | 4209 |
| 739 | Ga0500588_0017851 | 3300053146 | Bacteria | 1860 |
| 740 | Ga0500604_0001737 | 3300053151 | Bacteria | 6092 |
| 741 | Ga0500622_0014731 | 3300053156 | Bacteria | 4192 |
| 742 | Ga0500636_0071166 | 3300053177 | Bacteria | 2017 |
| 743 | Ga0500636_0083176 | 3300053177 | Bacteria | 1842 |
| 744 | Ga0501084_0065623 | 3300054114 | Bacteria | 3037 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10275279 | Ga0157369_102752793 | 294 |
| 2 | 3300049551 | Ga0501335_002129 | Ga0501335_002129_14_931 | 300 |
| 3 | 3300053151 | Ga0500604_0001737 | Ga0500604_0001737_2679_3821 | 321 |
| 4 | 3300048905 | Ga0496102_0008085 | Ga0496102_0008085_3513_4595 | 342 |
| 5 | 3300048916 | Ga0496113_0068299 | Ga0496113_0068299_65_1147 | 342 |
| 6 | 3300048919 | Ga0496116_0000037 | Ga0496116_0000037_3186_4268 | 342 |
| 7 | 3300048920 | Ga0496117_0000086 | Ga0496117_0000086_3667_4749 | 342 |
| 8 | 3300048921 | Ga0496118_0000284 | Ga0496118_0000284_84219_85301 | 342 |
| 9 | 3300048922 | Ga0496119_0000037 | Ga0496119_0000037_3723_4805 | 342 |
| 10 | 3300048924 | Ga0496121_0109943 | Ga0496121_0109943_726_1808 | 342 |
| 11 | 3300048925 | Ga0496122_0013915 | Ga0496122_0013915_3723_4805 | 342 |
| 12 | 3300048926 | Ga0496123_0000739 | Ga0496123_0000739_3723_4805 | 342 |
| 13 | 3300048927 | Ga0496124_0006053 | Ga0496124_0006053_9082_10164 | 342 |
| 14 | 3300048928 | Ga0496125_0011751 | Ga0496125_0011751_3695_4777 | 342 |
| 15 | 3300049571 | Ga0501034_0040999 | Ga0501034_0040999_2083_3120 | 345 |
| 16 | 3300049586 | Ga0501070_0297125 | Ga0501070_0297125_125_1162 | 345 |
| 17 | 3300049822 | Ga0501035_0045457 | Ga0501035_0045457_2278_3315 | 345 |
| 18 | 3300046616 | Ga0495668_0042839 | Ga0495668_0042839_1027_2169 | 347 |
| 19 | 3300005347 | Ga0070668_100346051 | Ga0070668_1003460511 | 348 |
| 20 | 3300013104 | Ga0157370_10013588 | Ga0157370_100135882 | 348 |
| 21 | 3300025291 | Ga0209675_1000159 | Ga0209675_100015972 | 348 |
| 22 | 3300025972 | Ga0207668_10083349 | Ga0207668_100833493 | 348 |
| 23 | 3300048925 | Ga0496122_0004673 | Ga0496122_0004673_9833_10915 | 348 |
| 24 | 3300048926 | Ga0496123_0050450 | Ga0496123_0050450_1276_2358 | 348 |
| 25 | 3300048928 | Ga0496125_0000685 | Ga0496125_0000685_45389_46471 | 348 |
| 26 | iso_pu_bacteria | 2585428115 | 2587942597 | 348 |
| 27 | iso_pu_bacteria | 2889290771 | 2889293605 | 348 |
| 28 | iso_pu_bacteria | 2905999023 | 2906002841 | 348 |
| 29 | iso_pu_bacteria | 2984572630 | 2984574641 | 348 |
| 30 | iso_pu_bacteria | 2984606641 | 2984608092 | 348 |
| 31 | iso_pu_bacteria | 2511231000 | 2511234416 | 349 |
| 32 | iso_pu_bacteria | 2523533629 | 2524006767 | 349 |
| 33 | iso_pu_bacteria | 2582581278 | 2585142357 | 349 |
| 34 | iso_pu_bacteria | 2582581281 | 2585159919 | 349 |
| 35 | iso_pu_bacteria | 2582581282 | 2585164134 | 349 |
| 36 | iso_pu_bacteria | 2582581873 | 2585426725 | 349 |
| 37 | iso_pu_bacteria | 2585428045 | 2587680713 | 349 |
| 38 | iso_pu_bacteria | 2585428060 | 2587748832 | 349 |
| 39 | iso_pu_bacteria | 2585428061 | 2587752731 | 349 |
| 40 | iso_pu_bacteria | 2585428095 | 2587868558 | 349 |
| 41 | iso_pu_bacteria | 2585428182 | 2588211834 | 349 |
| 42 | iso_pu_bacteria | 2585428183 | 2588216499 | 349 |
| 43 | iso_pu_bacteria | 2585428184 | 2588217695 | 349 |
| 44 | iso_pu_bacteria | 2585428185 | 2588225869 | 349 |
| 45 | iso_pu_bacteria | 2585428187 | 2588230933 | 349 |
| 46 | iso_pu_bacteria | 2588253712 | 2588447768 | 349 |
| 47 | iso_pu_bacteria | 2588254255 | 2590603689 | 349 |
| 48 | iso_pu_bacteria | 2588254257 | 2590610413 | 349 |
| 49 | iso_pu_bacteria | 2728369107 | 2729202550 | 349 |
| 50 | iso_pu_bacteria | 2739367874 | 2740060636 | 349 |
| 51 | iso_pu_bacteria | 2751185877 | 2753675034 | 349 |
| 52 | iso_pu_bacteria | 2765235839 | 2765575903 | 349 |
| 53 | iso_pu_bacteria | 2772190705 | 2772606621 | 349 |
| 54 | iso_pu_bacteria | 2775506739 | 2775674140 | 349 |
| 55 | iso_pu_bacteria | 2816332188 | 2816875611 | 349 |
| 56 | iso_pu_bacteria | 2842083920 | 2842087776 | 349 |
| 57 | iso_pu_bacteria | 2871720351 | 2871724837 | 349 |
| 58 | iso_pu_bacteria | 2919097161 | 2919099903 | 349 |
| 59 | iso_pu_bacteria | 2919399522 | 2919403574 | 349 |
| 60 | iso_pu_bacteria | 2945924605 | 2945928718 | 349 |
| 61 | iso_pu_bacteria | 2946019816 | 2946019833 | 349 |
| 62 | iso_pu_bacteria | 2977243572 | 2977247570 | 349 |
| 63 | iso_pu_bacteria | 2993372514 | 2993374894 | 349 |
| 64 | iso_pu_bacteria | 2993480792 | 2993481749 | 349 |
| 65 | 3300005530 | Ga0070679_100161191 | Ga0070679_1001611912 | 351 |
| 66 | 3300037471 | Ga0395905_0120705 | Ga0395905_0120705_1161_2222 | 351 |
| 67 | 3300046660 | Ga0495625_0043787 | Ga0495625_0043787_2176_3234 | 351 |
| 68 | 3300053146 | Ga0500588_0017851 | Ga0500588_0017851_430_1488 | 351 |
| 69 | 3300005288 | Ga0065714_10069763 | Ga0065714_100697633 | 352 |
| 70 | 3300005289 | Ga0065704_10071464 | Ga0065704_100714644 | 352 |
| 71 | 3300005289 | Ga0065704_10075289 | Ga0065704_100752894 | 352 |
| 72 | 3300005289 | Ga0065704_10089648 | Ga0065704_100896482 | 352 |
| 73 | 3300005329 | Ga0070683_100022315 | Ga0070683_1000223156 | 352 |
| 74 | 3300005347 | Ga0070668_100022201 | Ga0070668_1000222013 | 352 |
| 75 | 3300005535 | Ga0070684_100000979 | Ga0070684_1000009794 | 352 |
| 76 | 3300009036 | Ga0105244_10000018 | Ga0105244_100000185 | 352 |
| 77 | 3300009092 | Ga0105250_10067518 | Ga0105250_100675181 | 352 |
| 78 | 3300009098 | Ga0105245_10140027 | Ga0105245_101400272 | 352 |
| 79 | 3300009101 | Ga0105247_10083036 | Ga0105247_100830361 | 352 |
| 80 | 3300009148 | Ga0105243_10000089 | Ga0105243_1000008991 | 352 |
| 81 | 3300009177 | Ga0105248_10242548 | Ga0105248_102425482 | 352 |
| 82 | 3300009545 | Ga0105237_10078482 | Ga0105237_100784822 | 352 |
| 83 | 3300010375 | Ga0105239_10324178 | Ga0105239_103241781 | 352 |
| 84 | 3300013100 | Ga0157373_10000067 | Ga0157373_1000006786 | 352 |
| 85 | 3300013102 | Ga0157371_10000036 | Ga0157371_1000003652 | 352 |
| 86 | 3300013102 | Ga0157371_10029931 | Ga0157371_100299313 | 352 |
| 87 | 3300013104 | Ga0157370_10001141 | Ga0157370_1000114120 | 352 |
| 88 | 3300013105 | Ga0157369_10000153 | Ga0157369_1000015353 | 352 |
| 89 | 3300013296 | Ga0157374_10000467 | Ga0157374_100004671 | 352 |
| 90 | 3300013297 | Ga0157378_10020674 | Ga0157378_100206742 | 352 |
| 91 | 3300013306 | Ga0163162_10000750 | Ga0163162_100007506 | 352 |
| 92 | 3300013308 | Ga0157375_10001328 | Ga0157375_1000132815 | 352 |
| 93 | 3300013308 | Ga0157375_10002045 | Ga0157375_100020459 | 352 |
| 94 | 3300014325 | Ga0163163_10003562 | Ga0163163_100035624 | 352 |
| 95 | 3300014497 | Ga0182008_10000016 | Ga0182008_100000164 | 352 |
| 96 | 3300014968 | Ga0157379_10000068 | Ga0157379_1000006832 | 352 |
| 97 | 3300014969 | Ga0157376_10000743 | Ga0157376_100007435 | 352 |
| 98 | 3300015261 | Ga0182006_1000079 | Ga0182006_1000079119 | 352 |
| 99 | 3300017792 | Ga0163161_10005480 | Ga0163161_100054805 | 352 |
| 100 | 3300025711 | Ga0207696_1039073 | Ga0207696_10390731 | 352 |
| 101 | 3300025728 | Ga0207655_1000058 | Ga0207655_1000058261 | 352 |
| 102 | 3300025935 | Ga0207709_10000136 | Ga0207709_1000013695 | 352 |
| 103 | 3300025944 | Ga0207661_10018301 | Ga0207661_100183012 | 352 |
| 104 | 3300031911 | Ga0307412_10000640 | Ga0307412_1000064014 | 352 |
| 105 | 3300031911 | Ga0307412_10001858 | Ga0307412_100018584 | 352 |
| 106 | 3300031911 | Ga0307412_10002518 | Ga0307412_100025186 | 352 |
| 107 | 3300032002 | Ga0307416_100000020 | Ga0307416_100000020194 | 352 |
| 108 | 3300032004 | Ga0307414_10000041 | Ga0307414_10000041133 | 352 |
| 109 | 3300039447 | Ga0436361_0978887 | Ga0436361_0978887_775_1857 | 352 |
| 110 | 3300041413 | Ga0439465_0000489 | Ga0439465_0000489_6530_7612 | 352 |
| 111 | 3300042004 | Ga0439445_0000605 | Ga0439445_0000605_3067_4149 | 352 |
| 112 | 3300046453 | Ga0495627_000029 | Ga0495627_000029_4164_5246 | 352 |
| 113 | 3300046453 | Ga0495627_007357 | Ga0495627_007357_1676_2758 | 352 |
| 114 | 3300046457 | Ga0495590_0003729 | Ga0495590_0003729_3343_4425 | 352 |
| 115 | 3300046460 | Ga0495638_0074526 | Ga0495638_0074526_760_1842 | 352 |
| 116 | 3300046507 | Ga0495606_0003913 | Ga0495606_0003913_12801_13883 | 352 |
| 117 | 3300046507 | Ga0495606_0050092 | Ga0495606_0050092_685_1767 | 352 |
| 118 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_5955_7037 | 352 |
| 119 | 3300046519 | Ga0495632_0006192 | Ga0495632_0006192_4307_5389 | 352 |
| 120 | 3300046522 | Ga0495643_0022766 | Ga0495643_0022766_469_1551 | 352 |
| 121 | 3300046525 | Ga0495663_0000243 | Ga0495663_0000243_16292_17374 | 352 |
| 122 | 3300046525 | Ga0495663_0003226 | Ga0495663_0003226_2942_4024 | 352 |
| 123 | 3300046530 | Ga0495654_0000008 | Ga0495654_0000008_393012_394094 | 352 |
| 124 | 3300046538 | Ga0495609_0000010 | Ga0495609_0000010_4092_5174 | 352 |
| 125 | 3300046558 | Ga0495633_0000163 | Ga0495633_0000163_82321_83403 | 352 |
| 126 | 3300046558 | Ga0495633_0003132 | Ga0495633_0003132_3967_5049 | 352 |
| 127 | 3300046660 | Ga0495625_0009153 | Ga0495625_0009153_7046_8128 | 352 |
| 128 | 3300047472 | Ga0495686_0000153 | Ga0495686_0000153_6271_7353 | 352 |
| 129 | 3300047472 | Ga0495686_0009346 | Ga0495686_0009346_919_2001 | 352 |
| 130 | 3300048911 | Ga0496108_0127744 | Ga0496108_0127744_706_1764 | 352 |
| 131 | 3300048912 | Ga0496109_0141592 | Ga0496109_0141592_78_1136 | 352 |
| 132 | 3300048920 | Ga0496117_0155628 | Ga0496117_0155628_238_1320 | 352 |
| 133 | 3300048921 | Ga0496118_0040654 | Ga0496118_0040654_454_1536 | 352 |
| 134 | 3300048925 | Ga0496122_0000389 | Ga0496122_0000389_88172_89254 | 352 |
| 135 | 3300048925 | Ga0496122_0000489 | Ga0496122_0000489_76586_77668 | 352 |
| 136 | 3300048925 | Ga0496122_0019795 | Ga0496122_0019795_1269_2351 | 352 |
| 137 | 3300048926 | Ga0496123_0008923 | Ga0496123_0008923_612_1694 | 352 |
| 138 | 3300048928 | Ga0496125_0009248 | Ga0496125_0009248_3087_4169 | 352 |
| 139 | 3300048929 | Ga0496126_0002873 | Ga0496126_0002873_17303_18385 | 352 |
| 140 | 3300049758 | Ga0501241_000009 | Ga0501241_000009_3149_4231 | 352 |
| 141 | 3300049766 | Ga0501269_000196 | Ga0501269_000196_6166_7248 | 352 |
| 142 | 3300046473 | Ga0495582_0014360 | Ga0495582_0014360_1777_2838 | 353 |
| 143 | 3300046475 | Ga0495639_0055812 | Ga0495639_0055812_311_1372 | 353 |
| 144 | 3300046517 | Ga0495630_0083819 | Ga0495630_0083819_882_1943 | 353 |
| 145 | 3300046535 | Ga0495586_0084249 | Ga0495586_0084249_343_1404 | 353 |
| 146 | 3300046536 | Ga0495587_0101986 | Ga0495587_0101986_341_1402 | 353 |
| 147 | 3300041512 | Ga0451853_0979218 | Ga0451853_0979218_443_1510 | 355 |
| 148 | 3300005616 | Ga0068852_100150484 | Ga0068852_1001504842 | 356 |
| 149 | 3300009094 | Ga0111539_10022334 | Ga0111539_100223342 | 356 |
| 150 | 3300053177 | Ga0500636_0083176 | Ga0500636_0083176_683_1753 | 356 |
| 151 | 3300005335 | Ga0070666_10037121 | Ga0070666_100371212 | 357 |
| 152 | 3300005343 | Ga0070687_100034971 | Ga0070687_1000349712 | 357 |
| 153 | 3300005356 | Ga0070674_100253931 | Ga0070674_1002539311 | 357 |
| 154 | 3300005364 | Ga0070673_100040305 | Ga0070673_1000403053 | 357 |
| 155 | 3300005367 | Ga0070667_100133168 | Ga0070667_1001331682 | 357 |
| 156 | 3300005441 | Ga0070700_100095103 | Ga0070700_1000951032 | 357 |
| 157 | 3300005544 | Ga0070686_100052602 | Ga0070686_1000526021 | 357 |
| 158 | 3300025918 | Ga0207662_10048976 | Ga0207662_100489762 | 357 |
| 159 | 3300025920 | Ga0207649_10080371 | Ga0207649_100803712 | 357 |
| 160 | 3300025926 | Ga0207659_10148537 | Ga0207659_101485372 | 357 |
| 161 | 3300025937 | Ga0207669_10058491 | Ga0207669_100584912 | 357 |
| 162 | 3300026089 | Ga0207648_10129402 | Ga0207648_101294022 | 357 |
| 163 | 3300044656 | Ga0466969_0000666 | Ga0466969_0000666_863_1942 | 357 |
| 164 | 3300044684 | Ga0466966_0000030 | Ga0466966_0000030_80968_82047 | 357 |
| 165 | 3300045049 | Ga0466959_0000009 | Ga0466959_0000009_151241_152320 | 357 |
| 166 | 3300049581 | Ga0501047_0178622 | Ga0501047_0178622_159_1235 | 357 |
| 167 | 3300005456 | Ga0070678_100080138 | Ga0070678_1000801382 | 358 |
| 168 | 3300026121 | Ga0207683_10051899 | Ga0207683_100518993 | 358 |
| 169 | 3300049703 | Ga0501219_000158 | Ga0501219_000158_9134_10240 | 359 |
| 170 | 3300049758 | Ga0501241_006951 | Ga0501241_006951_113_1249 | 359 |
| 171 | 3300050005 | Ga0501284_00050 | Ga0501284_00050_16030_17136 | 359 |
| 172 | 3300005616 | Ga0068852_100115467 | Ga0068852_1001154672 | 360 |
| 173 | 3300009093 | Ga0105240_10000283 | Ga0105240_1000028311 | 360 |
| 174 | 3300009093 | Ga0105240_10162660 | Ga0105240_101626601 | 360 |
| 175 | 3300009147 | Ga0114129_10032885 | Ga0114129_100328854 | 360 |
| 176 | 3300009174 | Ga0105241_10000409 | Ga0105241_1000040925 | 360 |
| 177 | 3300009174 | Ga0105241_10354329 | Ga0105241_103543291 | 360 |
| 178 | 3300009551 | Ga0105238_10412573 | Ga0105238_104125732 | 360 |
| 179 | 3300013104 | Ga0157370_10000702 | Ga0157370_1000070237 | 360 |
| 180 | 3300013297 | Ga0157378_10095245 | Ga0157378_100952452 | 360 |
| 181 | 3300013306 | Ga0163162_10039646 | Ga0163162_100396462 | 360 |
| 182 | 3300026142 | Ga0207698_10063382 | Ga0207698_100633822 | 360 |
| 183 | 3300042014 | Ga0439457_003897 | Ga0439457_003897_941_2044 | 360 |
| 184 | 3300042435 | Ga0439434_0020291 | Ga0439434_0020291_63_1166 | 360 |
| 185 | 3300046460 | Ga0495638_0041347 | Ga0495638_0041347_679_1794 | 360 |
| 186 | 3300046524 | Ga0495648_0004169 | Ga0495648_0004169_1031_2146 | 360 |
| 187 | 3300046648 | Ga0495611_0020777 | Ga0495611_0020777_27_1142 | 360 |
| 188 | 3300046660 | Ga0495625_0168790 | Ga0495625_0168790_230_1345 | 360 |
| 189 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_932584_933690 | 360 |
| 190 | 3300050507 | nmdc:mga05p37_230156_c1 | nmdc:mga05p37_230156_c1_473_1585 | 360 |
| 191 | 3300053092 | Ga0500583_0000708 | Ga0500583_0000708_6118_7233 | 360 |
| 192 | 3300053139 | Ga0500568_0011028 | Ga0500568_0011028_1761_2876 | 360 |
| 193 | 3300053156 | Ga0500622_0014731 | Ga0500622_0014731_1203_2318 | 360 |
| 194 | 3300005331 | Ga0070670_100102102 | Ga0070670_1001021023 | 361 |
| 195 | 3300005577 | Ga0068857_100049520 | Ga0068857_1000495202 | 361 |
| 196 | 3300005617 | Ga0068859_100088698 | Ga0068859_1000886982 | 361 |
| 197 | 3300006931 | Ga0097620_100088699 | Ga0097620_1000886992 | 361 |
| 198 | 3300026116 | Ga0207674_10034583 | Ga0207674_100345832 | 361 |
| 199 | 3300028786 | Ga0307517_10005347 | Ga0307517_100053477 | 361 |
| 200 | 3300046648 | Ga0495611_0000196 | Ga0495611_0000196_9619_10728 | 362 |
| 201 | 3300053139 | Ga0500568_0002668 | Ga0500568_0002668_4476_5603 | 362 |
| 202 | iso_pu_bacteria | 2738541278 | 2738731075 | 362 |
| 203 | 3300005337 | Ga0070682_100101340 | Ga0070682_1001013402 | 363 |
| 204 | 3300026116 | Ga0207674_10143834 | Ga0207674_101438342 | 363 |
| 205 | 3300005288 | Ga0065714_10071326 | Ga0065714_100713264 | 364 |
| 206 | 3300009093 | Ga0105240_10016989 | Ga0105240_100169893 | 364 |
| 207 | 3300013100 | Ga0157373_10002372 | Ga0157373_1000237211 | 364 |
| 208 | 3300013102 | Ga0157371_10070705 | Ga0157371_100707052 | 364 |
| 209 | 3300013306 | Ga0163162_10264828 | Ga0163162_102648282 | 364 |
| 210 | 3300014968 | Ga0157379_10085934 | Ga0157379_100859342 | 364 |
| 211 | 3300017792 | Ga0163161_10156670 | Ga0163161_101566701 | 364 |
| 212 | 3300021384 | Ga0213876_10016049 | Ga0213876_100160491 | 364 |
| 213 | 3300025921 | Ga0207652_10183771 | Ga0207652_101837712 | 364 |
| 214 | 3300031251 | Ga0265327_10000366 | Ga0265327_100003665 | 364 |
| 215 | 3300049573 | Ga0501037_0083250 | Ga0501037_0083250_91_1218 | 364 |
| 216 | 3300005331 | Ga0070670_100081212 | Ga0070670_1000812121 | 365 |
| 217 | 3300005338 | Ga0068868_100003934 | Ga0068868_1000039342 | 365 |
| 218 | 3300005367 | Ga0070667_100003423 | Ga0070667_1000034234 | 365 |
| 219 | 3300005466 | Ga0070685_10140189 | Ga0070685_101401891 | 365 |
| 220 | 3300005617 | Ga0068859_100030064 | Ga0068859_1000300642 | 365 |
| 221 | 3300005841 | Ga0068863_100021283 | Ga0068863_1000212834 | 365 |
| 222 | 3300005843 | Ga0068860_100000241 | Ga0068860_10000024158 | 365 |
| 223 | 3300005843 | Ga0068860_100034397 | Ga0068860_1000343972 | 365 |
| 224 | 3300006880 | Ga0075429_100046275 | Ga0075429_1000462752 | 365 |
| 225 | 3300006881 | Ga0068865_100164726 | Ga0068865_1001647261 | 365 |
| 226 | 3300006931 | Ga0097620_100030063 | Ga0097620_1000300632 | 365 |
| 227 | 3300009094 | Ga0111539_10047195 | Ga0111539_100471952 | 365 |
| 228 | 3300013296 | Ga0157374_10018403 | Ga0157374_100184034 | 365 |
| 229 | 3300013297 | Ga0157378_10002438 | Ga0157378_100024388 | 365 |
| 230 | 3300013297 | Ga0157378_10078824 | Ga0157378_100788242 | 365 |
| 231 | 3300013306 | Ga0163162_10000216 | Ga0163162_1000021633 | 365 |
| 232 | 3300025937 | Ga0207669_10026967 | Ga0207669_100269672 | 365 |
| 233 | 3300025986 | Ga0207658_10008605 | Ga0207658_100086052 | 365 |
| 234 | 3300026023 | Ga0207677_10001071 | Ga0207677_100010715 | 365 |
| 235 | 3300026088 | Ga0207641_10008056 | Ga0207641_100080563 | 365 |
| 236 | 3300026118 | Ga0207675_100145111 | Ga0207675_1001451112 | 365 |
| 237 | 3300028381 | Ga0268264_10000011 | Ga0268264_10000011374 | 365 |
| 238 | 3300028381 | Ga0268264_10002558 | Ga0268264_100025585 | 365 |
| 239 | 3300041997 | Ga0439431_0009943 | Ga0439431_0009943_138_1241 | 365 |
| 240 | 3300042128 | Ga0450897_000436 | Ga0450897_000436_105_1208 | 365 |
| 241 | 3300049569 | Ga0501032_0031441 | Ga0501032_0031441_548_1654 | 365 |
| 242 | 3300049573 | Ga0501037_0007477 | Ga0501037_0007477_2816_3922 | 365 |
| 243 | 3300049822 | Ga0501035_0032120 | Ga0501035_0032120_1875_2981 | 365 |
| 244 | 3300050508 | nmdc:mga09592_220978_c1 | nmdc:mga09592_220978_c1_521_1627 | 365 |
| 245 | 3300050511 | nmdc:mga08y16_126848_c1 | nmdc:mga08y16_126848_c1_845_1951 | 365 |
| 246 | 3300005290 | Ga0065712_10110228 | Ga0065712_101102282 | 366 |
| 247 | 3300005340 | Ga0070689_100226893 | Ga0070689_1002268931 | 366 |
| 248 | 3300005347 | Ga0070668_100180182 | Ga0070668_1001801822 | 366 |
| 249 | 3300005355 | Ga0070671_100037104 | Ga0070671_1000371042 | 366 |
| 250 | 3300005367 | Ga0070667_100131886 | Ga0070667_1001318862 | 366 |
| 251 | 3300005539 | Ga0068853_100172128 | Ga0068853_1001721282 | 366 |
| 252 | 3300005578 | Ga0068854_100049439 | Ga0068854_1000494391 | 366 |
| 253 | 3300005616 | Ga0068852_100017015 | Ga0068852_1000170153 | 366 |
| 254 | 3300005617 | Ga0068859_100000035 | Ga0068859_100000035107 | 366 |
| 255 | 3300005618 | Ga0068864_100003043 | Ga0068864_1000030433 | 366 |
| 256 | 3300005841 | Ga0068863_100004976 | Ga0068863_1000049763 | 366 |
| 257 | 3300005842 | Ga0068858_100002128 | Ga0068858_1000021284 | 366 |
| 258 | 3300005843 | Ga0068860_100005982 | Ga0068860_1000059823 | 366 |
| 259 | 3300005843 | Ga0068860_100046288 | Ga0068860_1000462883 | 366 |
| 260 | 3300006237 | Ga0097621_100009119 | Ga0097621_1000091193 | 366 |
| 261 | 3300006358 | Ga0068871_100222176 | Ga0068871_1002221761 | 366 |
| 262 | 3300006847 | Ga0075431_100013571 | Ga0075431_1000135713 | 366 |
| 263 | 3300006881 | Ga0068865_100252093 | Ga0068865_1002520931 | 366 |
| 264 | 3300006931 | Ga0097620_100000035 | Ga0097620_100000035107 | 366 |
| 265 | 3300009093 | Ga0105240_10063781 | Ga0105240_100637812 | 366 |
| 266 | 3300009093 | Ga0105240_10071812 | Ga0105240_100718122 | 366 |
| 267 | 3300009101 | Ga0105247_10007389 | Ga0105247_100073892 | 366 |
| 268 | 3300009147 | Ga0114129_10063339 | Ga0114129_100633394 | 366 |
| 269 | 3300009174 | Ga0105241_10002106 | Ga0105241_100021063 | 366 |
| 270 | 3300009545 | Ga0105237_10000982 | Ga0105237_1000098220 | 366 |
| 271 | 3300009545 | Ga0105237_10020423 | Ga0105237_100204233 | 366 |
| 272 | 3300009553 | Ga0105249_10001250 | Ga0105249_1000125011 | 366 |
| 273 | 3300010375 | Ga0105239_10071327 | Ga0105239_100713271 | 366 |
| 274 | 3300011119 | Ga0105246_10328224 | Ga0105246_103282241 | 366 |
| 275 | 3300013105 | Ga0157369_10270351 | Ga0157369_102703511 | 366 |
| 276 | 3300013296 | Ga0157374_10166629 | Ga0157374_101666292 | 366 |
| 277 | 3300013306 | Ga0163162_10000573 | Ga0163162_1000057318 | 366 |
| 278 | 3300013307 | Ga0157372_10315974 | Ga0157372_103159742 | 366 |
| 279 | 3300013308 | Ga0157375_10036795 | Ga0157375_100367952 | 366 |
| 280 | 3300014326 | Ga0157380_10000746 | Ga0157380_100007463 | 366 |
| 281 | 3300014968 | Ga0157379_10082415 | Ga0157379_100824152 | 366 |
| 282 | 3300014969 | Ga0157376_10004097 | Ga0157376_100040972 | 366 |
| 283 | 3300017792 | Ga0163161_10048335 | Ga0163161_100483353 | 366 |
| 284 | 3300025900 | Ga0207710_10059521 | Ga0207710_100595212 | 366 |
| 285 | 3300025903 | Ga0207680_10000049 | Ga0207680_1000004939 | 366 |
| 286 | 3300025911 | Ga0207654_10002542 | Ga0207654_100025422 | 366 |
| 287 | 3300025911 | Ga0207654_10031825 | Ga0207654_100318252 | 366 |
| 288 | 3300025913 | Ga0207695_10003728 | Ga0207695_100037287 | 366 |
| 289 | 3300025913 | Ga0207695_10028321 | Ga0207695_100283212 | 366 |
| 290 | 3300025914 | Ga0207671_10001126 | Ga0207671_1000112619 | 366 |
| 291 | 3300025914 | Ga0207671_10004179 | Ga0207671_100041793 | 366 |
| 292 | 3300025914 | Ga0207671_10062160 | Ga0207671_100621602 | 366 |
| 293 | 3300025914 | Ga0207671_10086786 | Ga0207671_100867862 | 366 |
| 294 | 3300025925 | Ga0207650_10017509 | Ga0207650_100175092 | 366 |
| 295 | 3300025926 | Ga0207659_10060538 | Ga0207659_100605382 | 366 |
| 296 | 3300025931 | Ga0207644_10101857 | Ga0207644_101018572 | 366 |
| 297 | 3300025937 | Ga0207669_10023202 | Ga0207669_100232022 | 366 |
| 298 | 3300025940 | Ga0207691_10006449 | Ga0207691_100064497 | 366 |
| 299 | 3300025940 | Ga0207691_10233963 | Ga0207691_102339632 | 366 |
| 300 | 3300025942 | Ga0207689_10001700 | Ga0207689_100017006 | 366 |
| 301 | 3300025949 | Ga0207667_10001859 | Ga0207667_1000185925 | 366 |
| 302 | 3300025949 | Ga0207667_10349110 | Ga0207667_103491102 | 366 |
| 303 | 3300025961 | Ga0207712_10003997 | Ga0207712_100039972 | 366 |
| 304 | 3300025972 | Ga0207668_10006568 | Ga0207668_100065682 | 366 |
| 305 | 3300025986 | Ga0207658_10019093 | Ga0207658_100190933 | 366 |
| 306 | 3300026035 | Ga0207703_10003752 | Ga0207703_100037523 | 366 |
| 307 | 3300026041 | Ga0207639_10172543 | Ga0207639_101725431 | 366 |
| 308 | 3300026078 | Ga0207702_10395026 | Ga0207702_103950261 | 366 |
| 309 | 3300026088 | Ga0207641_10000043 | Ga0207641_1000004386 | 366 |
| 310 | 3300026095 | Ga0207676_10004515 | Ga0207676_100045153 | 366 |
| 311 | 3300026142 | Ga0207698_10017399 | Ga0207698_100173992 | 366 |
| 312 | 3300028379 | Ga0268266_10000102 | Ga0268266_10000102106 | 366 |
| 313 | 3300028381 | Ga0268264_10007707 | Ga0268264_100077077 | 366 |
| 314 | 3300028381 | Ga0268264_10012018 | Ga0268264_100120186 | 366 |
| 315 | 3300028794 | Ga0307515_10000036 | Ga0307515_1000003671 | 366 |
| 316 | 3300031507 | Ga0307509_10153774 | Ga0307509_101537742 | 366 |
| 317 | 3300033180 | Ga0307510_10000119 | Ga0307510_1000011926 | 366 |
| 318 | 3300041404 | Ga0439436_0005145 | Ga0439436_0005145_686_1795 | 366 |
| 319 | 3300041406 | Ga0439439_0005639 | Ga0439439_0005639_1660_2769 | 366 |
| 320 | 3300042876 | Ga0451577_0127521 | Ga0451577_0127521_505_1656 | 366 |
| 321 | 3300042876 | Ga0451577_0182934 | Ga0451577_0182934_377_1489 | 366 |
| 322 | 3300044658 | Ga0466972_0000182 | Ga0466972_0000182_13410_14519 | 366 |
| 323 | 3300044658 | Ga0466972_0001943 | Ga0466972_0001943_2183_3349 | 366 |
| 324 | 3300044842 | Ga0466957_0008313 | Ga0466957_0008313_2284_3393 | 366 |
| 325 | 3300046507 | Ga0495606_0107711 | Ga0495606_0107711_103_1287 | 366 |
| 326 | 3300047320 | Ga0495672_0042755 | Ga0495672_0042755_1293_2399 | 366 |
| 327 | 3300049579 | Ga0501043_0174971 | Ga0501043_0174971_70_1179 | 366 |
| 328 | 3300049581 | Ga0501047_0020430 | Ga0501047_0020430_978_2087 | 366 |
| 329 | 3300049581 | Ga0501047_0130519 | Ga0501047_0130519_230_1339 | 366 |
| 330 | 3300050510 | nmdc:mga06r32_13190_c1 | nmdc:mga06r32_13190_c1_1601_2710 | 366 |
| 331 | 3300050511 | nmdc:mga08y16_242178_c1 | nmdc:mga08y16_242178_c1_696_1805 | 366 |
| 332 | 3300053086 | Ga0500578_0000529 | Ga0500578_0000529_13054_14163 | 366 |
| 333 | 3300053092 | Ga0500583_0000016 | Ga0500583_0000016_26439_27548 | 366 |
| 334 | 3300053092 | Ga0500583_0002224 | Ga0500583_0002224_4392_5501 | 366 |
| 335 | 3300053131 | Ga0500652_013545 | Ga0500652_013545_649_1758 | 366 |
| 336 | 3300053177 | Ga0500636_0071166 | Ga0500636_0071166_689_1798 | 366 |
| 337 | 3300003323 | rootH1_10068539 | rootH1_100685392 | 367 |
| 338 | 3300005367 | Ga0070667_100029335 | Ga0070667_1000293352 | 367 |
| 339 | 3300005456 | Ga0070678_100135429 | Ga0070678_1001354292 | 367 |
| 340 | 3300005458 | Ga0070681_10054584 | Ga0070681_100545842 | 367 |
| 341 | 3300005539 | Ga0068853_100011415 | Ga0068853_1000114154 | 367 |
| 342 | 3300005577 | Ga0068857_100060623 | Ga0068857_1000606232 | 367 |
| 343 | 3300005614 | Ga0068856_100139980 | Ga0068856_1001399802 | 367 |
| 344 | 3300006237 | Ga0097621_100002197 | Ga0097621_1000021972 | 367 |
| 345 | 3300006358 | Ga0068871_100042419 | Ga0068871_1000424192 | 367 |
| 346 | 3300009093 | Ga0105240_10000533 | Ga0105240_1000053322 | 367 |
| 347 | 3300009093 | Ga0105240_10002479 | Ga0105240_1000247921 | 367 |
| 348 | 3300009174 | Ga0105241_10168800 | Ga0105241_101688001 | 367 |
| 349 | 3300009545 | Ga0105237_10041939 | Ga0105237_100419392 | 367 |
| 350 | 3300010375 | Ga0105239_10001651 | Ga0105239_1000165118 | 367 |
| 351 | 3300010375 | Ga0105239_10001753 | Ga0105239_100017537 | 367 |
| 352 | 3300013105 | Ga0157369_10322953 | Ga0157369_103229532 | 367 |
| 353 | 3300013297 | Ga0157378_10056227 | Ga0157378_100562272 | 367 |
| 354 | 3300013306 | Ga0163162_10006485 | Ga0163162_100064855 | 367 |
| 355 | 3300013308 | Ga0157375_10000073 | Ga0157375_1000007375 | 367 |
| 356 | 3300014968 | Ga0157379_10070411 | Ga0157379_100704112 | 367 |
| 357 | 3300014969 | Ga0157376_10003045 | Ga0157376_100030452 | 367 |
| 358 | 3300014969 | Ga0157376_10277759 | Ga0157376_102777592 | 367 |
| 359 | 3300017792 | Ga0163161_10008498 | Ga0163161_100084982 | 367 |
| 360 | 3300025903 | Ga0207680_10082876 | Ga0207680_100828762 | 367 |
| 361 | 3300025912 | Ga0207707_10042220 | Ga0207707_100422202 | 367 |
| 362 | 3300025913 | Ga0207695_10000632 | Ga0207695_1000063229 | 367 |
| 363 | 3300025913 | Ga0207695_10002023 | Ga0207695_100020238 | 367 |
| 364 | 3300025914 | Ga0207671_10112435 | Ga0207671_101124352 | 367 |
| 365 | 3300025940 | Ga0207691_10075497 | Ga0207691_100754972 | 367 |
| 366 | 3300026041 | Ga0207639_10023282 | Ga0207639_100232822 | 367 |
| 367 | 3300026116 | Ga0207674_10037559 | Ga0207674_100375592 | 367 |
| 368 | 3300026116 | Ga0207674_10287226 | Ga0207674_102872262 | 367 |
| 369 | 3300026121 | Ga0207683_10108668 | Ga0207683_101086682 | 367 |
| 370 | 3300026142 | Ga0207698_10126739 | Ga0207698_101267392 | 367 |
| 371 | 3300030521 | Ga0307511_10007489 | Ga0307511_100074896 | 367 |
| 372 | 3300031730 | Ga0307516_10022409 | Ga0307516_100224092 | 367 |
| 373 | 3300042876 | Ga0451577_0020626 | Ga0451577_0020626_1889_3001 | 367 |
| 374 | 3300044712 | Ga0453684_0482226 | Ga0453684_0482226_143_1255 | 367 |
| 375 | 3300044842 | Ga0466957_0002003 | Ga0466957_0002003_6800_7912 | 367 |
| 376 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_64798_65934 | 367 |
| 377 | 3300048903 | Ga0496100_0012425 | Ga0496100_0012425_3469_4587 | 367 |
| 378 | 3300053090 | Ga0500646_0007214 | Ga0500646_0007214_681_1799 | 367 |
| 379 | 3300053090 | Ga0500646_0011254 | Ga0500646_0011254_529_1641 | 367 |
| 380 | 3300005563 | Ga0068855_100342844 | Ga0068855_1003428442 | 368 |
| 381 | 3300006237 | Ga0097621_100364317 | Ga0097621_1003643171 | 368 |
| 382 | 3300009545 | Ga0105237_10001411 | Ga0105237_1000141113 | 368 |
| 383 | 3300013307 | Ga0157372_10000644 | Ga0157372_100006441 | 368 |
| 384 | 3300014969 | Ga0157376_10000719 | Ga0157376_100007192 | 368 |
| 385 | 3300025949 | Ga0207667_10293843 | Ga0207667_102938432 | 368 |
| 386 | 3300044693 | Ga0466961_0047451 | Ga0466961_0047451_440_1573 | 368 |
| 387 | 3300045049 | Ga0466959_0008643 | Ga0466959_0008643_2894_4027 | 368 |
| 388 | 3300045836 | Ga0466958_0021588 | Ga0466958_0021588_206_1339 | 368 |
| 389 | 3300003322 | rootL2_10149466 | rootL2_101494662 | 369 |
| 390 | 3300005327 | Ga0070658_10000420 | Ga0070658_1000042021 | 369 |
| 391 | 3300005328 | Ga0070676_10002624 | Ga0070676_100026242 | 369 |
| 392 | 3300005328 | Ga0070676_10045884 | Ga0070676_100458842 | 369 |
| 393 | 3300005331 | Ga0070670_100208152 | Ga0070670_1002081522 | 369 |
| 394 | 3300005333 | Ga0070677_10015333 | Ga0070677_100153332 | 369 |
| 395 | 3300005334 | Ga0068869_100016050 | Ga0068869_1000160502 | 369 |
| 396 | 3300005335 | Ga0070666_10011763 | Ga0070666_100117632 | 369 |
| 397 | 3300005338 | Ga0068868_100000893 | Ga0068868_1000008931 | 369 |
| 398 | 3300005338 | Ga0068868_100023701 | Ga0068868_1000237012 | 369 |
| 399 | 3300005340 | Ga0070689_100287894 | Ga0070689_1002878941 | 369 |
| 400 | 3300005347 | Ga0070668_100000022 | Ga0070668_10000002238 | 369 |
| 401 | 3300005353 | Ga0070669_100022904 | Ga0070669_1000229042 | 369 |
| 402 | 3300005354 | Ga0070675_100237592 | Ga0070675_1002375922 | 369 |
| 403 | 3300005364 | Ga0070673_100000090 | Ga0070673_10000009023 | 369 |
| 404 | 3300005364 | Ga0070673_100050947 | Ga0070673_1000509472 | 369 |
| 405 | 3300005366 | Ga0070659_100081899 | Ga0070659_1000818992 | 369 |
| 406 | 3300005367 | Ga0070667_100001287 | Ga0070667_1000012875 | 369 |
| 407 | 3300005367 | Ga0070667_100043428 | Ga0070667_1000434283 | 369 |
| 408 | 3300005458 | Ga0070681_10011658 | Ga0070681_100116583 | 369 |
| 409 | 3300005459 | Ga0068867_100002488 | Ga0068867_10000248812 | 369 |
| 410 | 3300005539 | Ga0068853_100015986 | Ga0068853_1000159862 | 369 |
| 411 | 3300005539 | Ga0068853_100063391 | Ga0068853_1000633912 | 369 |
| 412 | 3300005543 | Ga0070672_100000149 | Ga0070672_10000014919 | 369 |
| 413 | 3300005543 | Ga0070672_100017178 | Ga0070672_1000171782 | 369 |
| 414 | 3300005548 | Ga0070665_100001508 | Ga0070665_1000015089 | 369 |
| 415 | 3300005548 | Ga0070665_100024189 | Ga0070665_1000241893 | 369 |
| 416 | 3300005578 | Ga0068854_100063703 | Ga0068854_1000637032 | 369 |
| 417 | 3300005618 | Ga0068864_100000404 | Ga0068864_10000040421 | 369 |
| 418 | 3300005834 | Ga0068851_10001594 | Ga0068851_100015944 | 369 |
| 419 | 3300005834 | Ga0068851_10068330 | Ga0068851_100683302 | 369 |
| 420 | 3300005841 | Ga0068863_100000216 | Ga0068863_10000021641 | 369 |
| 421 | 3300005842 | Ga0068858_100001050 | Ga0068858_10000105022 | 369 |
| 422 | 3300005843 | Ga0068860_100028010 | Ga0068860_1000280102 | 369 |
| 423 | 3300006237 | Ga0097621_100000622 | Ga0097621_1000006223 | 369 |
| 424 | 3300006237 | Ga0097621_100036764 | Ga0097621_1000367642 | 369 |
| 425 | 3300006358 | Ga0068871_100000381 | Ga0068871_10000038114 | 369 |
| 426 | 3300006358 | Ga0068871_100106785 | Ga0068871_1001067852 | 369 |
| 427 | 3300006881 | Ga0068865_100002023 | Ga0068865_1000020236 | 369 |
| 428 | 3300009093 | Ga0105240_10009104 | Ga0105240_1000910412 | 369 |
| 429 | 3300009174 | Ga0105241_10001664 | Ga0105241_100016642 | 369 |
| 430 | 3300009176 | Ga0105242_10013970 | Ga0105242_100139705 | 369 |
| 431 | 3300009176 | Ga0105242_10033000 | Ga0105242_100330002 | 369 |
| 432 | 3300013104 | Ga0157370_10003524 | Ga0157370_1000352424 | 369 |
| 433 | 3300013297 | Ga0157378_10037019 | Ga0157378_100370192 | 369 |
| 434 | 3300013306 | Ga0163162_10143626 | Ga0163162_101436262 | 369 |
| 435 | 3300014325 | Ga0163163_10003589 | Ga0163163_100035892 | 369 |
| 436 | 3300014968 | Ga0157379_10275745 | Ga0157379_102757452 | 369 |
| 437 | 3300017792 | Ga0163161_10016255 | Ga0163161_100162552 | 369 |
| 438 | 3300025321 | Ga0207656_10002932 | Ga0207656_100029322 | 369 |
| 439 | 3300025901 | Ga0207688_10004641 | Ga0207688_100046414 | 369 |
| 440 | 3300025907 | Ga0207645_10004561 | Ga0207645_100045614 | 369 |
| 441 | 3300025907 | Ga0207645_10006815 | Ga0207645_100068155 | 369 |
| 442 | 3300025908 | Ga0207643_10023285 | Ga0207643_100232852 | 369 |
| 443 | 3300025909 | Ga0207705_10015209 | Ga0207705_100152095 | 369 |
| 444 | 3300025911 | Ga0207654_10008473 | Ga0207654_100084735 | 369 |
| 445 | 3300025912 | Ga0207707_10000508 | Ga0207707_1000050811 | 369 |
| 446 | 3300025913 | Ga0207695_10040957 | Ga0207695_100409574 | 369 |
| 447 | 3300025917 | Ga0207660_10002757 | Ga0207660_100027574 | 369 |
| 448 | 3300025921 | Ga0207652_10001607 | Ga0207652_100016074 | 369 |
| 449 | 3300025925 | Ga0207650_10001678 | Ga0207650_1000167812 | 369 |
| 450 | 3300025933 | Ga0207706_10025520 | Ga0207706_100255205 | 369 |
| 451 | 3300025933 | Ga0207706_10038722 | Ga0207706_100387222 | 369 |
| 452 | 3300025934 | Ga0207686_10027589 | Ga0207686_100275892 | 369 |
| 453 | 3300025940 | Ga0207691_10000113 | Ga0207691_1000011343 | 369 |
| 454 | 3300025940 | Ga0207691_10012590 | Ga0207691_100125903 | 369 |
| 455 | 3300025942 | Ga0207689_10006964 | Ga0207689_100069642 | 369 |
| 456 | 3300025942 | Ga0207689_10025569 | Ga0207689_100255692 | 369 |
| 457 | 3300025949 | Ga0207667_10108051 | Ga0207667_101080512 | 369 |
| 458 | 3300025960 | Ga0207651_10000313 | Ga0207651_100003132 | 369 |
| 459 | 3300025960 | Ga0207651_10024772 | Ga0207651_100247721 | 369 |
| 460 | 3300025972 | Ga0207668_10005826 | Ga0207668_100058265 | 369 |
| 461 | 3300025981 | Ga0207640_10026322 | Ga0207640_100263222 | 369 |
| 462 | 3300025986 | Ga0207658_10001468 | Ga0207658_100014689 | 369 |
| 463 | 3300026035 | Ga0207703_10000316 | Ga0207703_1000031616 | 369 |
| 464 | 3300026041 | Ga0207639_10016281 | Ga0207639_100162812 | 369 |
| 465 | 3300026041 | Ga0207639_10177206 | Ga0207639_101772062 | 369 |
| 466 | 3300026088 | Ga0207641_10019872 | Ga0207641_100198723 | 369 |
| 467 | 3300026089 | Ga0207648_10002914 | Ga0207648_1000291413 | 369 |
| 468 | 3300026089 | Ga0207648_10034780 | Ga0207648_100347802 | 369 |
| 469 | 3300026095 | Ga0207676_10001587 | Ga0207676_1000158714 | 369 |
| 470 | 3300026118 | Ga0207675_100007098 | Ga0207675_1000070983 | 369 |
| 471 | 3300026118 | Ga0207675_100027432 | Ga0207675_1000274322 | 369 |
| 472 | 3300026121 | Ga0207683_10014909 | Ga0207683_100149093 | 369 |
| 473 | 3300028379 | Ga0268266_10006375 | Ga0268266_100063753 | 369 |
| 474 | 3300028381 | Ga0268264_10003015 | Ga0268264_100030151 | 369 |
| 475 | 3300028381 | Ga0268264_10049163 | Ga0268264_100491632 | 369 |
| 476 | 3300036401 | Ga0373937_0158894 | Ga0373937_0158894_508_1653 | 369 |
| 477 | 3300044712 | Ga0453684_0019544 | Ga0453684_0019544_8095_9204 | 369 |
| 478 | 3300046691 | Ga0495670_0061833 | Ga0495670_0061833_560_1705 | 369 |
| 479 | 3300049582 | Ga0501048_0035393 | Ga0501048_0035393_2366_3511 | 369 |
| 480 | 3300049584 | Ga0501068_0213893 | Ga0501068_0213893_64_1209 | 369 |
| 481 | 3300049585 | Ga0501069_0006684 | Ga0501069_0006684_4258_5403 | 369 |
| 482 | 3300049589 | Ga0501073_0058380 | Ga0501073_0058380_1189_2334 | 369 |
| 483 | 3300049590 | Ga0501074_0174662 | Ga0501074_0174662_201_1346 | 369 |
| 484 | 3300049592 | Ga0501076_0195832 | Ga0501076_0195832_169_1314 | 369 |
| 485 | 3300049741 | Ga0501079_0028834 | Ga0501079_0028834_1511_2656 | 369 |
| 486 | 3300054114 | Ga0501084_0065623 | Ga0501084_0065623_1218_2363 | 369 |
| 487 | 3300005331 | Ga0070670_100019651 | Ga0070670_1000196512 | 370 |
| 488 | 3300005338 | Ga0068868_100055111 | Ga0068868_1000551113 | 370 |
| 489 | 3300005353 | Ga0070669_100019244 | Ga0070669_1000192444 | 370 |
| 490 | 3300005535 | Ga0070684_100011218 | Ga0070684_1000112187 | 370 |
| 491 | 3300005616 | Ga0068852_100009530 | Ga0068852_1000095302 | 370 |
| 492 | 3300005618 | Ga0068864_100013085 | Ga0068864_1000130855 | 370 |
| 493 | 3300005618 | Ga0068864_100025792 | Ga0068864_1000257922 | 370 |
| 494 | 3300005719 | Ga0068861_100024652 | Ga0068861_1000246522 | 370 |
| 495 | 3300005843 | Ga0068860_100082463 | Ga0068860_1000824632 | 370 |
| 496 | 3300006237 | Ga0097621_100012799 | Ga0097621_1000127992 | 370 |
| 497 | 3300006358 | Ga0068871_100006299 | Ga0068871_1000062997 | 370 |
| 498 | 3300009101 | Ga0105247_10002595 | Ga0105247_100025953 | 370 |
| 499 | 3300009176 | Ga0105242_10044138 | Ga0105242_100441382 | 370 |
| 500 | 3300009553 | Ga0105249_10001211 | Ga0105249_1000121110 | 370 |
| 501 | 3300009553 | Ga0105249_10006996 | Ga0105249_100069962 | 370 |
| 502 | 3300009553 | Ga0105249_10196054 | Ga0105249_101960542 | 370 |
| 503 | 3300013296 | Ga0157374_10183585 | Ga0157374_101835852 | 370 |
| 504 | 3300013306 | Ga0163162_10000715 | Ga0163162_100007152 | 370 |
| 505 | 3300013307 | Ga0157372_10055124 | Ga0157372_100551242 | 370 |
| 506 | 3300025900 | Ga0207710_10002918 | Ga0207710_100029185 | 370 |
| 507 | 3300025923 | Ga0207681_10020575 | Ga0207681_100205754 | 370 |
| 508 | 3300025942 | Ga0207689_10009324 | Ga0207689_100093244 | 370 |
| 509 | 3300025942 | Ga0207689_10036067 | Ga0207689_100360672 | 370 |
| 510 | 3300025942 | Ga0207689_10100140 | Ga0207689_101001402 | 370 |
| 511 | 3300025945 | Ga0207679_10046793 | Ga0207679_100467932 | 370 |
| 512 | 3300025961 | Ga0207712_10003924 | Ga0207712_100039242 | 370 |
| 513 | 3300025961 | Ga0207712_10017543 | Ga0207712_100175431 | 370 |
| 514 | 3300025972 | Ga0207668_10033964 | Ga0207668_100339642 | 370 |
| 515 | 3300025972 | Ga0207668_10096016 | Ga0207668_100960162 | 370 |
| 516 | 3300026023 | Ga0207677_10115800 | Ga0207677_101158002 | 370 |
| 517 | 3300026035 | Ga0207703_10085260 | Ga0207703_100852602 | 370 |
| 518 | 3300026041 | Ga0207639_10079273 | Ga0207639_100792731 | 370 |
| 519 | 3300026095 | Ga0207676_10005296 | Ga0207676_100052965 | 370 |
| 520 | 3300026095 | Ga0207676_10119192 | Ga0207676_101191921 | 370 |
| 521 | 3300026118 | Ga0207675_100039964 | Ga0207675_1000399643 | 370 |
| 522 | 3300026118 | Ga0207675_100155714 | Ga0207675_1001557142 | 370 |
| 523 | 3300044712 | Ga0453684_0143615 | Ga0453684_0143615_791_1903 | 370 |
| 524 | 3300005289 | Ga0065704_10015639 | Ga0065704_100156392 | 371 |
| 525 | 3300005295 | Ga0065707_10120944 | Ga0065707_101209442 | 371 |
| 526 | 3300005330 | Ga0070690_100011351 | Ga0070690_1000113515 | 371 |
| 527 | 3300005334 | Ga0068869_100002715 | Ga0068869_1000027156 | 371 |
| 528 | 3300005334 | Ga0068869_100090531 | Ga0068869_1000905312 | 371 |
| 529 | 3300005338 | Ga0068868_100000524 | Ga0068868_1000005247 | 371 |
| 530 | 3300005340 | Ga0070689_100002023 | Ga0070689_10000202310 | 371 |
| 531 | 3300005340 | Ga0070689_100015940 | Ga0070689_1000159402 | 371 |
| 532 | 3300005344 | Ga0070661_100000686 | Ga0070661_10000068623 | 371 |
| 533 | 3300005344 | Ga0070661_100007626 | Ga0070661_1000076262 | 371 |
| 534 | 3300005354 | Ga0070675_100026579 | Ga0070675_1000265794 | 371 |
| 535 | 3300005354 | Ga0070675_100162190 | Ga0070675_1001621902 | 371 |
| 536 | 3300005355 | Ga0070671_100098257 | Ga0070671_1000982572 | 371 |
| 537 | 3300005355 | Ga0070671_100140796 | Ga0070671_1001407962 | 371 |
| 538 | 3300005364 | Ga0070673_100020477 | Ga0070673_1000204772 | 371 |
| 539 | 3300005364 | Ga0070673_100033690 | Ga0070673_1000336902 | 371 |
| 540 | 3300005365 | Ga0070688_100024153 | Ga0070688_1000241532 | 371 |
| 541 | 3300005366 | Ga0070659_100022425 | Ga0070659_1000224254 | 371 |
| 542 | 3300005367 | Ga0070667_100038988 | Ga0070667_1000389882 | 371 |
| 543 | 3300005441 | Ga0070700_100075668 | Ga0070700_1000756682 | 371 |
| 544 | 3300005456 | Ga0070678_100035043 | Ga0070678_1000350432 | 371 |
| 545 | 3300005457 | Ga0070662_100002459 | Ga0070662_1000024592 | 371 |
| 546 | 3300005457 | Ga0070662_100004469 | Ga0070662_1000044694 | 371 |
| 547 | 3300005457 | Ga0070662_100187733 | Ga0070662_1001877331 | 371 |
| 548 | 3300005459 | Ga0068867_100050830 | Ga0068867_1000508303 | 371 |
| 549 | 3300005466 | Ga0070685_10025882 | Ga0070685_100258822 | 371 |
| 550 | 3300005471 | Ga0070698_100001058 | Ga0070698_10000105814 | 371 |
| 551 | 3300005471 | Ga0070698_100005689 | Ga0070698_1000056896 | 371 |
| 552 | 3300005535 | Ga0070684_100000433 | Ga0070684_1000004338 | 371 |
| 553 | 3300005535 | Ga0070684_100080878 | Ga0070684_1000808782 | 371 |
| 554 | 3300005547 | Ga0070693_100108878 | Ga0070693_1001088781 | 371 |
| 555 | 3300005548 | Ga0070665_100044734 | Ga0070665_1000447342 | 371 |
| 556 | 3300005577 | Ga0068857_100019215 | Ga0068857_1000192155 | 371 |
| 557 | 3300005578 | Ga0068854_100010925 | Ga0068854_1000109254 | 371 |
| 558 | 3300005578 | Ga0068854_100041891 | Ga0068854_1000418912 | 371 |
| 559 | 3300005616 | Ga0068852_100001894 | Ga0068852_1000018948 | 371 |
| 560 | 3300005616 | Ga0068852_100034896 | Ga0068852_1000348962 | 371 |
| 561 | 3300005616 | Ga0068852_100242897 | Ga0068852_1002428972 | 371 |
| 562 | 3300005617 | Ga0068859_100003497 | Ga0068859_10000349714 | 371 |
| 563 | 3300005617 | Ga0068859_100131156 | Ga0068859_1001311562 | 371 |
| 564 | 3300005618 | Ga0068864_100003513 | Ga0068864_1000035138 | 371 |
| 565 | 3300005618 | Ga0068864_100009090 | Ga0068864_1000090901 | 371 |
| 566 | 3300005618 | Ga0068864_100062189 | Ga0068864_1000621893 | 371 |
| 567 | 3300005718 | Ga0068866_10074699 | Ga0068866_100746992 | 371 |
| 568 | 3300005719 | Ga0068861_100021699 | Ga0068861_1000216992 | 371 |
| 569 | 3300005840 | Ga0068870_10035171 | Ga0068870_100351712 | 371 |
| 570 | 3300005841 | Ga0068863_100056490 | Ga0068863_1000564902 | 371 |
| 571 | 3300005842 | Ga0068858_100049193 | Ga0068858_1000491932 | 371 |
| 572 | 3300005842 | Ga0068858_100314484 | Ga0068858_1003144841 | 371 |
| 573 | 3300005843 | Ga0068860_100139036 | Ga0068860_1001390362 | 371 |
| 574 | 3300006163 | Ga0070715_10070645 | Ga0070715_100706451 | 371 |
| 575 | 3300006195 | Ga0075366_10000644 | Ga0075366_1000064412 | 371 |
| 576 | 3300006237 | Ga0097621_100145813 | Ga0097621_1001458132 | 371 |
| 577 | 3300006358 | Ga0068871_100082226 | Ga0068871_1000822261 | 371 |
| 578 | 3300006844 | Ga0075428_100007201 | Ga0075428_1000072014 | 371 |
| 579 | 3300006844 | Ga0075428_100085955 | Ga0075428_1000859552 | 371 |
| 580 | 3300006846 | Ga0075430_100005834 | Ga0075430_1000058342 | 371 |
| 581 | 3300006846 | Ga0075430_100111490 | Ga0075430_1001114902 | 371 |
| 582 | 3300006847 | Ga0075431_100064466 | Ga0075431_1000644662 | 371 |
| 583 | 3300006847 | Ga0075431_100167818 | Ga0075431_1001678182 | 371 |
| 584 | 3300006880 | Ga0075429_100102421 | Ga0075429_1001024212 | 371 |
| 585 | 3300006931 | Ga0097620_100003497 | Ga0097620_10000349714 | 371 |
| 586 | 3300006931 | Ga0097620_100131153 | Ga0097620_1001311532 | 371 |
| 587 | 3300009101 | Ga0105247_10065814 | Ga0105247_100658142 | 371 |
| 588 | 3300009147 | Ga0114129_10675106 | Ga0114129_106751062 | 371 |
| 589 | 3300009176 | Ga0105242_10013557 | Ga0105242_100135572 | 371 |
| 590 | 3300009176 | Ga0105242_10445244 | Ga0105242_104452442 | 371 |
| 591 | 3300009177 | Ga0105248_10131762 | Ga0105248_101317622 | 371 |
| 592 | 3300009553 | Ga0105249_10001889 | Ga0105249_100018891 | 371 |
| 593 | 3300009553 | Ga0105249_10008699 | Ga0105249_100086996 | 371 |
| 594 | 3300010375 | Ga0105239_10048467 | Ga0105239_100484672 | 371 |
| 595 | 3300013102 | Ga0157371_10016957 | Ga0157371_100169572 | 371 |
| 596 | 3300013102 | Ga0157371_10047136 | Ga0157371_100471363 | 371 |
| 597 | 3300013102 | Ga0157371_10122235 | Ga0157371_101222352 | 371 |
| 598 | 3300013296 | Ga0157374_10020382 | Ga0157374_100203822 | 371 |
| 599 | 3300013296 | Ga0157374_10042988 | Ga0157374_100429882 | 371 |
| 600 | 3300013296 | Ga0157374_10057595 | Ga0157374_100575953 | 371 |
| 601 | 3300013297 | Ga0157378_10210785 | Ga0157378_102107852 | 371 |
| 602 | 3300013306 | Ga0163162_10001117 | Ga0163162_1000111712 | 371 |
| 603 | 3300013306 | Ga0163162_10011005 | Ga0163162_100110052 | 371 |
| 604 | 3300013307 | Ga0157372_10012213 | Ga0157372_100122138 | 371 |
| 605 | 3300013307 | Ga0157372_10051368 | Ga0157372_100513682 | 371 |
| 606 | 3300013308 | Ga0157375_10010656 | Ga0157375_100106565 | 371 |
| 607 | 3300014325 | Ga0163163_10000198 | Ga0163163_1000019839 | 371 |
| 608 | 3300014325 | Ga0163163_10279695 | Ga0163163_102796952 | 371 |
| 609 | 3300014326 | Ga0157380_10073825 | Ga0157380_100738252 | 371 |
| 610 | 3300014745 | Ga0157377_10002780 | Ga0157377_100027802 | 371 |
| 611 | 3300014968 | Ga0157379_10006544 | Ga0157379_100065442 | 371 |
| 612 | 3300017792 | Ga0163161_10006663 | Ga0163161_100066632 | 371 |
| 613 | 3300025893 | Ga0207682_10032510 | Ga0207682_100325102 | 371 |
| 614 | 3300025899 | Ga0207642_10074905 | Ga0207642_100749052 | 371 |
| 615 | 3300025904 | Ga0207647_10001371 | Ga0207647_100013716 | 371 |
| 616 | 3300025904 | Ga0207647_10016648 | Ga0207647_100166482 | 371 |
| 617 | 3300025907 | Ga0207645_10011044 | Ga0207645_100110442 | 371 |
| 618 | 3300025908 | Ga0207643_10042590 | Ga0207643_100425902 | 371 |
| 619 | 3300025908 | Ga0207643_10061636 | Ga0207643_100616362 | 371 |
| 620 | 3300025914 | Ga0207671_10126102 | Ga0207671_101261022 | 371 |
| 621 | 3300025919 | Ga0207657_10044566 | Ga0207657_100445663 | 371 |
| 622 | 3300025920 | Ga0207649_10001711 | Ga0207649_100017116 | 371 |
| 623 | 3300025920 | Ga0207649_10032408 | Ga0207649_100324082 | 371 |
| 624 | 3300025925 | Ga0207650_10069980 | Ga0207650_100699802 | 371 |
| 625 | 3300025925 | Ga0207650_10085597 | Ga0207650_100855972 | 371 |
| 626 | 3300025926 | Ga0207659_10012954 | Ga0207659_100129542 | 371 |
| 627 | 3300025926 | Ga0207659_10051000 | Ga0207659_100510003 | 371 |
| 628 | 3300025926 | Ga0207659_10129856 | Ga0207659_101298562 | 371 |
| 629 | 3300025931 | Ga0207644_10128783 | Ga0207644_101287832 | 371 |
| 630 | 3300025932 | Ga0207690_10022219 | Ga0207690_100222192 | 371 |
| 631 | 3300025933 | Ga0207706_10002489 | Ga0207706_1000248913 | 371 |
| 632 | 3300025933 | Ga0207706_10011208 | Ga0207706_100112082 | 371 |
| 633 | 3300025933 | Ga0207706_10066786 | Ga0207706_100667862 | 371 |
| 634 | 3300025934 | Ga0207686_10000957 | Ga0207686_100009573 | 371 |
| 635 | 3300025934 | Ga0207686_10046499 | Ga0207686_100464992 | 371 |
| 636 | 3300025936 | Ga0207670_10007585 | Ga0207670_100075852 | 371 |
| 637 | 3300025938 | Ga0207704_10014960 | Ga0207704_100149602 | 371 |
| 638 | 3300025940 | Ga0207691_10058596 | Ga0207691_100585963 | 371 |
| 639 | 3300025940 | Ga0207691_10104587 | Ga0207691_101045872 | 371 |
| 640 | 3300025940 | Ga0207691_10171201 | Ga0207691_101712011 | 371 |
| 641 | 3300025942 | Ga0207689_10007318 | Ga0207689_100073184 | 371 |
| 642 | 3300025942 | Ga0207689_10010988 | Ga0207689_100109886 | 371 |
| 643 | 3300025942 | Ga0207689_10094720 | Ga0207689_100947202 | 371 |
| 644 | 3300025944 | Ga0207661_10008012 | Ga0207661_100080121 | 371 |
| 645 | 3300025945 | Ga0207679_10292740 | Ga0207679_102927402 | 371 |
| 646 | 3300025960 | Ga0207651_10018844 | Ga0207651_100188444 | 371 |
| 647 | 3300025960 | Ga0207651_10304138 | Ga0207651_103041381 | 371 |
| 648 | 3300025961 | Ga0207712_10161304 | Ga0207712_101613042 | 371 |
| 649 | 3300025981 | Ga0207640_10011687 | Ga0207640_100116874 | 371 |
| 650 | 3300025986 | Ga0207658_10047273 | Ga0207658_100472732 | 371 |
| 651 | 3300026023 | Ga0207677_10003542 | Ga0207677_100035422 | 371 |
| 652 | 3300026023 | Ga0207677_10014262 | Ga0207677_100142622 | 371 |
| 653 | 3300026041 | Ga0207639_10069185 | Ga0207639_100691852 | 371 |
| 654 | 3300026075 | Ga0207708_10109127 | Ga0207708_101091272 | 371 |
| 655 | 3300026088 | Ga0207641_10149779 | Ga0207641_101497792 | 371 |
| 656 | 3300026089 | Ga0207648_10019640 | Ga0207648_100196402 | 371 |
| 657 | 3300026089 | Ga0207648_10368613 | Ga0207648_103686131 | 371 |
| 658 | 3300026095 | Ga0207676_10002542 | Ga0207676_100025424 | 371 |
| 659 | 3300026095 | Ga0207676_10070729 | Ga0207676_100707293 | 371 |
| 660 | 3300026095 | Ga0207676_10080892 | Ga0207676_100808922 | 371 |
| 661 | 3300026095 | Ga0207676_10086172 | Ga0207676_100861722 | 371 |
| 662 | 3300026116 | Ga0207674_10003090 | Ga0207674_100030908 | 371 |
| 663 | 3300026116 | Ga0207674_10048075 | Ga0207674_100480752 | 371 |
| 664 | 3300026116 | Ga0207674_10414143 | Ga0207674_104141431 | 371 |
| 665 | 3300026118 | Ga0207675_100042272 | Ga0207675_1000422722 | 371 |
| 666 | 3300026121 | Ga0207683_10187855 | Ga0207683_101878551 | 371 |
| 667 | 3300026142 | Ga0207698_10109750 | Ga0207698_101097502 | 371 |
| 668 | 3300028379 | Ga0268266_10063348 | Ga0268266_100633482 | 371 |
| 669 | 3300028379 | Ga0268266_10278251 | Ga0268266_102782511 | 371 |
| 670 | 3300028381 | Ga0268264_10217434 | Ga0268264_102174342 | 371 |
| 671 | 3300032005 | Ga0307411_10212178 | Ga0307411_102121782 | 371 |
| 672 | 3300035410 | Ga0373924_0004327 | Ga0373924_0004327_914_2029 | 371 |
| 673 | 3300036401 | Ga0373937_0006203 | Ga0373937_0006203_3838_4953 | 371 |
| 674 | 3300042437 | Ga0439444_0006971 | Ga0439444_0006971_331_1446 | 371 |
| 675 | 3300046472 | Ga0495580_0085514 | Ga0495580_0085514_572_1687 | 371 |
| 676 | 3300046511 | Ga0495608_0055996 | Ga0495608_0055996_1163_2278 | 371 |
| 677 | 3300046559 | Ga0495667_0089845 | Ga0495667_0089845_235_1350 | 371 |
| 678 | 3300046663 | Ga0495635_0048931 | Ga0495635_0048931_52_1167 | 371 |
| 679 | 3300046675 | Ga0495657_0034896 | Ga0495657_0034896_881_1996 | 371 |
| 680 | 3300046689 | Ga0495613_0127420 | Ga0495613_0127420_173_1288 | 371 |
| 681 | 3300047444 | Ga0495675_0094841 | Ga0495675_0094841_276_1391 | 371 |
| 682 | 3300048913 | Ga0496110_0060307 | Ga0496110_0060307_832_1953 | 371 |
| 683 | 3300048918 | Ga0496115_0136596 | Ga0496115_0136596_119_1288 | 371 |
| 684 | 3300049568 | Ga0501031_0004536 | Ga0501031_0004536_5300_6415 | 371 |
| 685 | 3300049569 | Ga0501032_0046480 | Ga0501032_0046480_1056_2171 | 371 |
| 686 | 3300049571 | Ga0501034_0003582 | Ga0501034_0003582_2700_3815 | 371 |
| 687 | 3300049572 | Ga0501036_0000630 | Ga0501036_0000630_7015_8130 | 371 |
| 688 | 3300049572 | Ga0501036_0001356 | Ga0501036_0001356_4911_6026 | 371 |
| 689 | 3300049574 | Ga0501038_0052718 | Ga0501038_0052718_494_1609 | 371 |
| 690 | 3300049575 | Ga0501039_0004101 | Ga0501039_0004101_9079_10194 | 371 |
| 691 | 3300049579 | Ga0501043_0013189 | Ga0501043_0013189_4168_5283 | 371 |
| 692 | 3300049580 | Ga0501046_0002967 | Ga0501046_0002967_2969_4084 | 371 |
| 693 | 3300049581 | Ga0501047_0004450 | Ga0501047_0004450_4792_5907 | 371 |
| 694 | 3300049581 | Ga0501047_0063759 | Ga0501047_0063759_1609_2724 | 371 |
| 695 | 3300049583 | Ga0501067_0009302 | Ga0501067_0009302_3521_4636 | 371 |
| 696 | 3300049584 | Ga0501068_0051628 | Ga0501068_0051628_199_1314 | 371 |
| 697 | 3300049589 | Ga0501073_0004829 | Ga0501073_0004829_5438_6553 | 371 |
| 698 | 3300049590 | Ga0501074_0010705 | Ga0501074_0010705_5476_6591 | 371 |
| 699 | 3300049686 | Ga0501257_019869 | Ga0501257_019869_109_1227 | 371 |
| 700 | 3300049742 | Ga0501080_0015066 | Ga0501080_0015066_2449_3564 | 371 |
| 701 | 3300049744 | Ga0501083_0007396 | Ga0501083_0007396_1529_2644 | 371 |
| 702 | 3300049822 | Ga0501035_0345990 | Ga0501035_0345990_43_1158 | 371 |
| 703 | 3300049823 | Ga0501044_0018446 | Ga0501044_0018446_2431_3546 | 371 |
| 704 | 3300050508 | nmdc:mga09592_18509_c1 | nmdc:mga09592_18509_c1_4006_5121 | 371 |
| 705 | 3300050508 | nmdc:mga09592_201507_c1 | nmdc:mga09592_201507_c1_351_1508 | 371 |
| 706 | 3300050509 | nmdc:mga0qj67_104414_c1 | nmdc:mga0qj67_104414_c1_870_1985 | 371 |
| 707 | 3300050509 | nmdc:mga0qj67_15330_c1 | nmdc:mga0qj67_15330_c1_447_1604 | 371 |
| 708 | 3300050510 | nmdc:mga06r32_290716_c1 | nmdc:mga06r32_290716_c1_189_1304 | 371 |
| 709 | 3300050510 | nmdc:mga06r32_71915_c1 | nmdc:mga06r32_71915_c1_344_1501 | 371 |
| 710 | 2162886011 | MRS1b_contig_6871026 | MRS1b_0734.00002180 | 372 |
| 711 | 3300005290 | Ga0065712_10003751 | Ga0065712_100037512 | 372 |
| 712 | 3300005293 | Ga0065715_10094189 | Ga0065715_100941892 | 372 |
| 713 | 3300005295 | Ga0065707_10120092 | Ga0065707_101200922 | 372 |
| 714 | 3300005331 | Ga0070670_100037766 | Ga0070670_1000377662 | 372 |
| 715 | 3300005334 | Ga0068869_100020039 | Ga0068869_1000200392 | 372 |
| 716 | 3300005347 | Ga0070668_100017587 | Ga0070668_1000175872 | 372 |
| 717 | 3300005347 | Ga0070668_100135721 | Ga0070668_1001357212 | 372 |
| 718 | 3300005353 | Ga0070669_100001361 | Ga0070669_1000013612 | 372 |
| 719 | 3300005354 | Ga0070675_100003755 | Ga0070675_1000037552 | 372 |
| 720 | 3300005364 | Ga0070673_100002901 | Ga0070673_1000029012 | 372 |
| 721 | 3300005365 | Ga0070688_100001271 | Ga0070688_1000012718 | 372 |
| 722 | 3300005438 | Ga0070701_10022436 | Ga0070701_100224362 | 372 |
| 723 | 3300005457 | Ga0070662_100047909 | Ga0070662_1000479093 | 372 |
| 724 | 3300005459 | Ga0068867_100007461 | Ga0068867_1000074612 | 372 |
| 725 | 3300005543 | Ga0070672_100123302 | Ga0070672_1001233021 | 372 |
| 726 | 3300005564 | Ga0070664_100138697 | Ga0070664_1001386971 | 372 |
| 727 | 3300005577 | Ga0068857_100012899 | Ga0068857_1000128995 | 372 |
| 728 | 3300005577 | Ga0068857_100218327 | Ga0068857_1002183272 | 372 |
| 729 | 3300005578 | Ga0068854_100187242 | Ga0068854_1001872422 | 372 |
| 730 | 3300005617 | Ga0068859_100034072 | Ga0068859_1000340724 | 372 |
| 731 | 3300005617 | Ga0068859_100165913 | Ga0068859_1001659131 | 372 |
| 732 | 3300005719 | Ga0068861_100038509 | Ga0068861_1000385092 | 372 |
| 733 | 3300005840 | Ga0068870_10001231 | Ga0068870_100012312 | 372 |
| 734 | 3300005844 | Ga0068862_100011534 | Ga0068862_1000115342 | 372 |
| 735 | 3300006931 | Ga0097620_100034071 | Ga0097620_1000340714 | 372 |
| 736 | 3300006931 | Ga0097620_100165908 | Ga0097620_1001659081 | 372 |
| 737 | 3300009176 | Ga0105242_10012123 | Ga0105242_100121232 | 372 |
| 738 | 3300009553 | Ga0105249_10007483 | Ga0105249_100074832 | 372 |
| 739 | 3300009553 | Ga0105249_10283979 | Ga0105249_102839791 | 372 |
| 740 | 3300013307 | Ga0157372_10587001 | Ga0157372_105870011 | 372 |
| 741 | 3300013308 | Ga0157375_10015188 | Ga0157375_100151882 | 372 |
| 742 | 3300013308 | Ga0157375_10068627 | Ga0157375_100686271 | 372 |
| 743 | 3300013308 | Ga0157375_10078529 | Ga0157375_100785292 | 372 |
| 744 | 3300014326 | Ga0157380_10014447 | Ga0157380_100144474 | 372 |
| 745 | 3300014745 | Ga0157377_10006792 | Ga0157377_100067922 | 372 |
| 746 | 3300025908 | Ga0207643_10002391 | Ga0207643_100023918 | 372 |
| 747 | 3300025918 | Ga0207662_10067885 | Ga0207662_100678852 | 372 |
| 748 | 3300025923 | Ga0207681_10003164 | Ga0207681_100031648 | 372 |
| 749 | 3300025933 | Ga0207706_10013718 | Ga0207706_100137182 | 372 |
| 750 | 3300025933 | Ga0207706_10019228 | Ga0207706_100192282 | 372 |
| 751 | 3300025936 | Ga0207670_10014800 | Ga0207670_100148003 | 372 |
| 752 | 3300025940 | Ga0207691_10168417 | Ga0207691_101684171 | 372 |
| 753 | 3300025942 | Ga0207689_10051709 | Ga0207689_100517092 | 372 |
| 754 | 3300025942 | Ga0207689_10119221 | Ga0207689_101192212 | 372 |
| 755 | 3300025945 | Ga0207679_10089928 | Ga0207679_100899282 | 372 |
| 756 | 3300025949 | Ga0207667_10376757 | Ga0207667_103767571 | 372 |
| 757 | 3300025961 | Ga0207712_10001108 | Ga0207712_100011085 | 372 |
| 758 | 3300025961 | Ga0207712_10098500 | Ga0207712_100985002 | 372 |
| 759 | 3300025972 | Ga0207668_10039980 | Ga0207668_100399802 | 372 |
| 760 | 3300025981 | Ga0207640_10114839 | Ga0207640_101148391 | 372 |
| 761 | 3300025986 | Ga0207658_10320060 | Ga0207658_103200601 | 372 |
| 762 | 3300026041 | Ga0207639_10295584 | Ga0207639_102955841 | 372 |
| 763 | 3300026088 | Ga0207641_10034018 | Ga0207641_100340181 | 372 |
| 764 | 3300026089 | Ga0207648_10005321 | Ga0207648_100053217 | 372 |
| 765 | 3300026116 | Ga0207674_10014288 | Ga0207674_100142882 | 372 |
| 766 | 3300026116 | Ga0207674_10244073 | Ga0207674_102440732 | 372 |
| 767 | 3300026118 | Ga0207675_100016213 | Ga0207675_1000162132 | 372 |
| 768 | 3300026121 | Ga0207683_10394655 | Ga0207683_103946551 | 372 |
| 769 | 3300028380 | Ga0268265_10022442 | Ga0268265_100224422 | 372 |
| 770 | 3300037471 | Ga0395905_0077497 | Ga0395905_0077497_1767_2957 | 372 |
| 771 | 3300039437 | Ga0436365_1726582 | Ga0436365_1726582_7300_8490 | 372 |
| 772 | 3300049652 | Ga0501202_000050 | Ga0501202_000050_6578_7705 | 372 |
| 773 | 3300049654 | Ga0501207_000735 | Ga0501207_000735_1454_2581 | 372 |
| 774 | 3300049661 | Ga0501217_000079 | Ga0501217_000079_6086_7213 | 372 |
| 775 | 3300049663 | Ga0501223_000157 | Ga0501223_000157_3659_4786 | 372 |
| 776 | 3300049669 | Ga0501235_000643 | Ga0501235_000643_1156_2283 | 372 |
| 777 | 3300049681 | Ga0501251_000677 | Ga0501251_000677_750_1877 | 372 |
| 778 | 3300049686 | Ga0501257_010955 | Ga0501257_010955_238_1365 | 372 |
| 779 | 3300049688 | Ga0501259_000566 | Ga0501259_000566_2517_3644 | 372 |
| 780 | 3300049690 | Ga0501261_000336 | Ga0501261_000336_184_1311 | 372 |
| 781 | 3300049704 | Ga0501221_000123 | Ga0501221_000123_2149_3276 | 372 |
| 782 | 3300049705 | Ga0501225_0000570 | Ga0501225_0000570_2714_3841 | 372 |
| 783 | 3300049707 | Ga0501234_001234 | Ga0501234_001234_1631_2758 | 372 |
| 784 | 3300049708 | Ga0501245_000180 | Ga0501245_000180_1185_2312 | 372 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6h3i-assembly1.cif.gz_F | structural snapshots of the type 9 protein translocon | 0.6741 | 23 | 361 |
| 4fqe-assembly1.cif.gz_A | kdgm porin | 0.674 | 71 | 363 |
| 4fqe-assembly1.cif.gz_A | kdgm porin | 0.6673 | 71 | 363 |
| 6h3i-assembly1.cif.gz_F | structural snapshots of the type 9 protein translocon | 0.6484 | 23 | 361 |
| 4ctd-assembly1.cif.gz_B | x-ray structure of an engineered ompg loop6-deletion | 0.6471 | 67 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.674 | 71 | 363 | 2.40.160.40 |
| 4fqeA00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6673 | 71 | 363 | 2.40.160.40 |
| 4ctdB00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6471 | 67 | 360 | 2.40.160.40 |
| 4ctdB00 | Mainly Beta;Beta Barrel;Porin;monomeric porin ompg | 0.6355 | 67 | 360 | 2.40.160.40 |
| 5ne2A00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.6271 | 325 | 368 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0HC27-F1-model_v4 | PorV/PorQ family protein | 0.9215 | 17 | 366 |
|
| AF-A0A3C0HC27-F1-model_v4 | PorV/PorQ family protein | 0.9114 | 17 | 366 |
|
| AF-A0A4P8RW40-F1-model_v4 | PorV/PorQ family protein | 0.8873 | 17 | 361 |
|
| AF-A0A2D8C3P7-F1-model_v4 | PorV/PorQ family protein | 0.8858 | 17 | 371 |
|
| AF-M7XJP6-F1-model_v4 | DUF5723 domain-containing protein | 0.8829 | 75 | 372 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar