F480695

General Info

Members Datasets Scaffolds Average Seq Length
784 342 744 372

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10086786|Ga0207671_100867862
Length 431
Sequence VILAPGLSGKGKTLLTGAKVQYFRYNNLNGRALYVVFVMILKPLEINRKKNHNHRLMLKRMRGRCRNPLLLFGLLFSCFSASAQFTKYSNEFLNIGAGARGMSMAGAQVASVSDGTAGYWNPAALADIRNAPQLNLMHAEYYAGIGKYDFGNLVLPMKDNKRTLGITVLRFAVDDIPNTIFLVQPDGTVNFDNIKTFSSADYAFIFSLAQRADLSRGRKFNFGVNAKVIYRKAGDFATAWGFGFDAAAQLIGDRWKLGVVAKDVTTTFNAWSYSIDQQMREVFYMTQNEIPTKSTELTAPQLILGGSYNFRLSKKLNLLAEADLDATFDGRRNTVVSTNPISIDPKLGLELSFKDVFFVRAGINNFQKALDDKDTTNQKKIWIYQPSVGAGFKVGDVEIDYAFTNLANQSYPLYTHVFSLRIDMKRKEKKK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
8 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
9 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
10 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
11 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
12 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
13 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
14 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
15 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
16 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
17 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
18 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
19 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
20 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
21 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
22 2738541278 Niastella sp. CF465 Isolate Unclassified
23 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
24 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
25 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
26 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
27 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
28 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
29 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
30 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
31 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
32 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
33 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
34 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
35 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
36 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
37 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
38 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
39 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
40 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
41 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
61 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
146 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
221 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
222 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
253 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
266 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
267 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
278 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
282 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
307 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
308 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
309 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
310 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
311 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
312 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
313 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
314 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
315 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
316 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
317 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
318 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
319 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
324 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
328 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
334 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
335 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
336 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
339 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
340 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
341 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 0.13
Isolates 5.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 2.04
Nodule 0.13
Rhizoplane 0.89
Rhizosphere 91.71
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6871026 2162886011 Bacteria 1942
2 rootL2_10149466 3300003322 Bacteria 3190
3 rootH1_10068539 3300003323 Bacteria 5597
4 Ga0065714_10069763 3300005288 Bacteria 4098
5 Ga0065714_10071326 3300005288 Bacteria 3607
6 Ga0065704_10015639 3300005289 Bacteria 1679
7 Ga0065704_10071464 3300005289 Bacteria 11042
8 Ga0065704_10075289 3300005289 Bacteria 5678
9 Ga0065704_10089648 3300005289 Bacteria 2843
10 Ga0065712_10003751 3300005290 Bacteria 5793
11 Ga0065712_10110228 3300005290 Bacteria 1839
12 Ga0065715_10094189 3300005293 Bacteria 4418
13 Ga0065707_10120092 3300005295 Bacteria 2143
14 Ga0065707_10120944 3300005295 Bacteria 2122
15 Ga0070658_10000420 3300005327 Bacteria 36817
16 Ga0070676_10002624 3300005328 Bacteria 9244
17 Ga0070676_10045884 3300005328 Bacteria 2546
18 Ga0070683_100022315 3300005329 Bacteria 5656
19 Ga0070690_100011351 3300005330 Bacteria 5208
20 Ga0070670_100019651 3300005331 Bacteria 5798
21 Ga0070670_100037766 3300005331 Bacteria 4154
22 Ga0070670_100081212 3300005331 Bacteria 2786
23 Ga0070670_100102102 3300005331 Unclassified 2470
24 Ga0070670_100208152 3300005331 Unclassified 1700
25 Ga0070677_10015333 3300005333 Bacteria 2714
26 Ga0068869_100002715 3300005334 Bacteria 10707
27 Ga0068869_100016050 3300005334 Bacteria 5041
28 Ga0068869_100020039 3300005334 Bacteria 4581
29 Ga0068869_100090531 3300005334 Bacteria 2299
30 Ga0070666_10011763 3300005335 Bacteria 5503
31 Ga0070666_10037121 3300005335 Bacteria 3238
32 Ga0070682_100101340 3300005337 Unclassified 1901
33 Ga0068868_100000524 3300005338 Bacteria 25677
34 Ga0068868_100000893 3300005338 Bacteria 20285
35 Ga0068868_100003934 3300005338 Bacteria 10379
36 Ga0068868_100023701 3300005338 Bacteria 4648
37 Ga0068868_100055111 3300005338 Bacteria 3136
38 Ga0070689_100002023 3300005340 Bacteria 13154
39 Ga0070689_100015940 3300005340 Bacteria 5492
40 Ga0070689_100226893 3300005340 Bacteria 1534
41 Ga0070689_100287894 3300005340 Bacteria 1364
42 Ga0070687_100034971 3300005343 Unclassified 2491
43 Ga0070661_100000686 3300005344 Bacteria 24845
44 Ga0070661_100007626 3300005344 Bacteria 7466
45 Ga0070668_100000022 3300005347 Bacteria 96336
46 Ga0070668_100017587 3300005347 Bacteria 5361
47 Ga0070668_100022201 3300005347 Bacteria 4798
48 Ga0070668_100135721 3300005347 Bacteria 1979
49 Ga0070668_100180182 3300005347 Unclassified 1725
50 Ga0070668_100346051 3300005347 Bacteria 1257
51 Ga0070669_100001361 3300005353 Bacteria 17616
52 Ga0070669_100019244 3300005353 Bacteria 4876
53 Ga0070669_100022904 3300005353 Bacteria 4468
54 Ga0070675_100003755 3300005354 Bacteria 11533
55 Ga0070675_100026579 3300005354 Bacteria 4646
56 Ga0070675_100162190 3300005354 Bacteria 1923
57 Ga0070675_100237592 3300005354 Unclassified 1591
58 Ga0070671_100037104 3300005355 Bacteria 4042
59 Ga0070671_100098257 3300005355 Bacteria 2456
60 Ga0070671_100140796 3300005355 Bacteria 2036
61 Ga0070674_100253931 3300005356 Unclassified 1382
62 Ga0070673_100000090 3300005364 Bacteria 39776
63 Ga0070673_100002901 3300005364 Bacteria 10558
64 Ga0070673_100020477 3300005364 Bacteria 4772
65 Ga0070673_100033690 3300005364 Bacteria 3870
66 Ga0070673_100040305 3300005364 Bacteria 3582
67 Ga0070673_100050947 3300005364 Bacteria 3239
68 Ga0070688_100001271 3300005365 Bacteria 12568
69 Ga0070688_100024153 3300005365 Bacteria 3582
70 Ga0070659_100022425 3300005366 Bacteria 4820
71 Ga0070659_100081899 3300005366 Bacteria 2578
72 Ga0070667_100001287 3300005367 Bacteria 22667
73 Ga0070667_100003423 3300005367 Bacteria 13515
74 Ga0070667_100029335 3300005367 Bacteria 4583
75 Ga0070667_100038988 3300005367 Bacteria 3983
76 Ga0070667_100043428 3300005367 Bacteria 3772
77 Ga0070667_100131886 3300005367 Bacteria 2181
78 Ga0070667_100133168 3300005367 Unclassified 2171
79 Ga0070701_10022436 3300005438 Bacteria 3027
80 Ga0070700_100075668 3300005441 Bacteria 2160
81 Ga0070700_100095103 3300005441 Unclassified 1952
82 Ga0070678_100035043 3300005456 Bacteria 3501
83 Ga0070678_100080138 3300005456 Bacteria 2472
84 Ga0070678_100135429 3300005456 Bacteria 1963
85 Ga0070662_100002459 3300005457 Bacteria 11410
86 Ga0070662_100004469 3300005457 Bacteria 8851
87 Ga0070662_100047909 3300005457 Bacteria 3077
88 Ga0070662_100187733 3300005457 Unclassified 1632
89 Ga0070681_10011658 3300005458 Bacteria 8704
90 Ga0070681_10054584 3300005458 Bacteria 3982
91 Ga0068867_100002488 3300005459 Bacteria 12960
92 Ga0068867_100007461 3300005459 Bacteria 7732
93 Ga0068867_100050830 3300005459 Bacteria 3056
94 Ga0070685_10025882 3300005466 Bacteria 3232
95 Ga0070685_10140189 3300005466 Bacteria 1521
96 Ga0070698_100001058 3300005471 Bacteria 30280
97 Ga0070698_100005689 3300005471 Bacteria 13641
98 Ga0070679_100161191 3300005530 Bacteria 2217
99 Ga0070684_100000433 3300005535 Bacteria 28743
100 Ga0070684_100000979 3300005535 Bacteria 20363
101 Ga0070684_100011218 3300005535 Bacteria 7134
102 Ga0070684_100080878 3300005535 Bacteria 2875
103 Ga0068853_100011415 3300005539 Bacteria 7217
104 Ga0068853_100015986 3300005539 Bacteria 6170
105 Ga0068853_100063391 3300005539 Bacteria 3201
106 Ga0068853_100172128 3300005539 Bacteria 1960
107 Ga0070672_100000149 3300005543 Bacteria 38128
108 Ga0070672_100017178 3300005543 Bacteria 5203
109 Ga0070672_100123302 3300005543 Bacteria 2123
110 Ga0070686_100052602 3300005544 Bacteria 2597
111 Ga0070693_100108878 3300005547 Unclassified 1701
112 Ga0070665_100001508 3300005548 Bacteria 27075
113 Ga0070665_100024189 3300005548 Bacteria 6117
114 Ga0070665_100044734 3300005548 Bacteria 4446
115 Ga0068855_100342844 3300005563 Unclassified 1647
116 Ga0070664_100138697 3300005564 Bacteria 2140
117 Ga0068857_100012899 3300005577 Bacteria 7282
118 Ga0068857_100019215 3300005577 Bacteria 5998
119 Ga0068857_100049520 3300005577 Unclassified 3727
120 Ga0068857_100060623 3300005577 Bacteria 3360
121 Ga0068857_100218327 3300005577 Bacteria 1741
122 Ga0068854_100010925 3300005578 Bacteria 5890
123 Ga0068854_100041891 3300005578 Bacteria 3237
124 Ga0068854_100049439 3300005578 Unclassified 3003
125 Ga0068854_100063703 3300005578 Bacteria 2677
126 Ga0068854_100187242 3300005578 Bacteria 1620
127 Ga0068856_100139980 3300005614 Bacteria 2427
128 Ga0068852_100001894 3300005616 Bacteria 14234
129 Ga0068852_100009530 3300005616 Bacteria 7217
130 Ga0068852_100017015 3300005616 Bacteria 5693
131 Ga0068852_100034896 3300005616 Bacteria 4189
132 Ga0068852_100115467 3300005616 Bacteria 2448
133 Ga0068852_100150484 3300005616 Bacteria 2164
134 Ga0068852_100242897 3300005616 Unclassified 1722
135 Ga0068859_100000035 3300005617 Bacteria 169846
136 Ga0068859_100003497 3300005617 Bacteria 15991
137 Ga0068859_100030064 3300005617 Bacteria 5451
138 Ga0068859_100034072 3300005617 Bacteria 5112
139 Ga0068859_100088698 3300005617 Bacteria 3142
140 Ga0068859_100131156 3300005617 Unclassified 2578
141 Ga0068859_100165913 3300005617 Bacteria 2288
142 Ga0068864_100000404 3300005618 Bacteria 37446
143 Ga0068864_100003043 3300005618 Bacteria 13845
144 Ga0068864_100003513 3300005618 Bacteria 12958
145 Ga0068864_100009090 3300005618 Bacteria 8190
146 Ga0068864_100013085 3300005618 Bacteria 6873
147 Ga0068864_100025792 3300005618 Bacteria 4955
148 Ga0068864_100062189 3300005618 Bacteria 3234
149 Ga0068866_10074699 3300005718 Unclassified 1803
150 Ga0068861_100021699 3300005719 Bacteria 4617
151 Ga0068861_100024652 3300005719 Bacteria 4354
152 Ga0068861_100038509 3300005719 Bacteria 3561
153 Ga0068851_10001594 3300005834 Bacteria 9956
154 Ga0068851_10068330 3300005834 Bacteria 1834
155 Ga0068870_10001231 3300005840 Bacteria 10291
156 Ga0068870_10035171 3300005840 Bacteria 2569
157 Ga0068863_100000216 3300005841 Bacteria 61837
158 Ga0068863_100004976 3300005841 Bacteria 13098
159 Ga0068863_100021283 3300005841 Bacteria 6190
160 Ga0068863_100056490 3300005841 Bacteria 3716
161 Ga0068858_100001050 3300005842 Bacteria 28529
162 Ga0068858_100002128 3300005842 Bacteria 20066
163 Ga0068858_100049193 3300005842 Unclassified 3904
164 Ga0068858_100314484 3300005842 Unclassified 1496
165 Ga0068860_100000241 3300005843 Bacteria 83429
166 Ga0068860_100005982 3300005843 Bacteria 12246
167 Ga0068860_100028010 3300005843 Bacteria 5424
168 Ga0068860_100034397 3300005843 Bacteria 4860
169 Ga0068860_100046288 3300005843 Bacteria 4148
170 Ga0068860_100082463 3300005843 Bacteria 3058
171 Ga0068860_100139036 3300005843 Unclassified 2333
172 Ga0068862_100011534 3300005844 Bacteria 7292
173 Ga0070715_10070645 3300006163 Unclassified 1559
174 Ga0075366_10000644 3300006195 Bacteria 16450
175 Ga0097621_100000622 3300006237 Bacteria 25041
176 Ga0097621_100002197 3300006237 Bacteria 13363
177 Ga0097621_100009119 3300006237 Bacteria 7190
178 Ga0097621_100012799 3300006237 Bacteria 6232
179 Ga0097621_100036764 3300006237 Bacteria 3919
180 Ga0097621_100145813 3300006237 Unclassified 2027
181 Ga0097621_100364317 3300006237 Unclassified 1288
182 Ga0068871_100000381 3300006358 Bacteria 31089
183 Ga0068871_100006299 3300006358 Bacteria 8381
184 Ga0068871_100042419 3300006358 Bacteria 3652
185 Ga0068871_100082226 3300006358 Bacteria 2670
186 Ga0068871_100106785 3300006358 Bacteria 2351
187 Ga0068871_100222176 3300006358 Bacteria 1637
188 Ga0075428_100007201 3300006844 Bacteria 12321
189 Ga0075428_100085955 3300006844 Unclassified 3430
190 Ga0075430_100005834 3300006846 Bacteria 10391
191 Ga0075430_100111490 3300006846 Bacteria 2281
192 Ga0075431_100013571 3300006847 Bacteria 8234
193 Ga0075431_100064466 3300006847 Bacteria 3783
194 Ga0075431_100167818 3300006847 Bacteria 2256
195 Ga0075429_100046275 3300006880 Bacteria 3786
196 Ga0075429_100102421 3300006880 Bacteria 2499
197 Ga0068865_100002023 3300006881 Bacteria 11967
198 Ga0068865_100164726 3300006881 Bacteria 1694
199 Ga0068865_100252093 3300006881 Bacteria 1393
200 Ga0097620_100000035 3300006931 Bacteria 169846
201 Ga0097620_100003497 3300006931 Bacteria 15991
202 Ga0097620_100030063 3300006931 Bacteria 5451
203 Ga0097620_100034071 3300006931 Bacteria 5112
204 Ga0097620_100088699 3300006931 Bacteria 3142
205 Ga0097620_100131153 3300006931 Unclassified 2578
206 Ga0097620_100165908 3300006931 Bacteria 2288
207 Ga0105244_10000018 3300009036 Bacteria 244992
208 Ga0105250_10067518 3300009092 Bacteria 1443
209 Ga0105240_10000283 3300009093 Bacteria 99553
210 Ga0105240_10000533 3300009093 Bacteria 70305
211 Ga0105240_10002479 3300009093 Bacteria 29666
212 Ga0105240_10009104 3300009093 Bacteria 14096
213 Ga0105240_10016989 3300009093 Bacteria 9829
214 Ga0105240_10063781 3300009093 Bacteria 4581
215 Ga0105240_10071812 3300009093 Unclassified 4280
216 Ga0105240_10162660 3300009093 Bacteria 2650
217 Ga0111539_10022334 3300009094 Bacteria 7775
218 Ga0111539_10047195 3300009094 Bacteria 5149
219 Ga0105245_10140027 3300009098 Unclassified 2277
220 Ga0105247_10002595 3300009101 Bacteria 12225
221 Ga0105247_10007389 3300009101 Bacteria 6745
222 Ga0105247_10065814 3300009101 Bacteria 2255
223 Ga0105247_10083036 3300009101 Unclassified 2023
224 Ga0114129_10032885 3300009147 Bacteria 7328
225 Ga0114129_10063339 3300009147 Bacteria 5164
226 Ga0114129_10675106 3300009147 Bacteria 1331
227 Ga0105243_10000089 3300009148 Bacteria 103761
228 Ga0105241_10000409 3300009174 Bacteria 32453
229 Ga0105241_10001664 3300009174 Bacteria 16930
230 Ga0105241_10002106 3300009174 Bacteria 15030
231 Ga0105241_10168800 3300009174 Bacteria 1806
232 Ga0105241_10354329 3300009174 Bacteria 1275
233 Ga0105242_10012123 3300009176 Bacteria 6631
234 Ga0105242_10013557 3300009176 Bacteria 6306
235 Ga0105242_10013970 3300009176 Bacteria 6213
236 Ga0105242_10033000 3300009176 Bacteria 4143
237 Ga0105242_10044138 3300009176 Bacteria 3609
238 Ga0105242_10445244 3300009176 Bacteria 1220
239 Ga0105248_10131762 3300009177 Bacteria 2820
240 Ga0105248_10242548 3300009177 Unclassified 2029
241 Ga0105237_10000982 3300009545 Bacteria 38268
242 Ga0105237_10001411 3300009545 Bacteria 31753
243 Ga0105237_10020423 3300009545 Bacteria 6828
244 Ga0105237_10041939 3300009545 Bacteria 4615
245 Ga0105237_10078482 3300009545 Unclassified 3291
246 Ga0105238_10412573 3300009551 Unclassified 1344
247 Ga0105249_10001211 3300009553 Bacteria 22772
248 Ga0105249_10001250 3300009553 Bacteria 22317
249 Ga0105249_10001889 3300009553 Bacteria 18128
250 Ga0105249_10006996 3300009553 Bacteria 9844
251 Ga0105249_10007483 3300009553 Bacteria 9528
252 Ga0105249_10008699 3300009553 Bacteria 8849
253 Ga0105249_10196054 3300009553 Unclassified 1974
254 Ga0105249_10283979 3300009553 Bacteria 1654
255 Ga0105239_10001651 3300010375 Bacteria 29415
256 Ga0105239_10001753 3300010375 Bacteria 28602
257 Ga0105239_10048467 3300010375 Bacteria 4659
258 Ga0105239_10071327 3300010375 Bacteria 3817
259 Ga0105239_10324178 3300010375 Unclassified 1737
260 Ga0105246_10328224 3300011119 Unclassified 1246
261 Ga0157373_10000067 3300013100 Bacteria 92618
262 Ga0157373_10002372 3300013100 Bacteria 14308
263 Ga0157371_10000036 3300013102 Bacteria 215191
264 Ga0157371_10016957 3300013102 Bacteria 5424
265 Ga0157371_10029931 3300013102 Bacteria 3930
266 Ga0157371_10047136 3300013102 Bacteria 3064
267 Ga0157371_10070705 3300013102 Bacteria 2471
268 Ga0157371_10122235 3300013102 Bacteria 1851
269 Ga0157370_10000702 3300013104 Bacteria 41838
270 Ga0157370_10001141 3300013104 Bacteria 33176
271 Ga0157370_10003524 3300013104 Bacteria 18349
272 Ga0157370_10013588 3300013104 Bacteria 8378
273 Ga0157369_10000153 3300013105 Bacteria 97572
274 Ga0157369_10270351 3300013105 Bacteria 1771
275 Ga0157369_10275279 3300013105 Bacteria 1753
276 Ga0157369_10322953 3300013105 Bacteria 1604
277 Ga0157374_10000467 3300013296 Bacteria 36724
278 Ga0157374_10018403 3300013296 Bacteria 6163
279 Ga0157374_10020382 3300013296 Bacteria 5882
280 Ga0157374_10042988 3300013296 Bacteria 4172
281 Ga0157374_10057595 3300013296 Bacteria 3630
282 Ga0157374_10166629 3300013296 Bacteria 2147
283 Ga0157374_10183585 3300013296 Bacteria 2045
284 Ga0157378_10002438 3300013297 Bacteria 16544
285 Ga0157378_10020674 3300013297 Bacteria 5790
286 Ga0157378_10037019 3300013297 Bacteria 4320
287 Ga0157378_10056227 3300013297 Bacteria 3506
288 Ga0157378_10078824 3300013297 Bacteria 2973
289 Ga0157378_10095245 3300013297 Bacteria 2711
290 Ga0157378_10210785 3300013297 Unclassified 1842
291 Ga0163162_10000216 3300013306 Bacteria 52917
292 Ga0163162_10000573 3300013306 Bacteria 34029
293 Ga0163162_10000715 3300013306 Bacteria 30803
294 Ga0163162_10000750 3300013306 Bacteria 30227
295 Ga0163162_10001117 3300013306 Bacteria 24935
296 Ga0163162_10006485 3300013306 Bacteria 11330
297 Ga0163162_10011005 3300013306 Bacteria 8810
298 Ga0163162_10039646 3300013306 Bacteria 4708
299 Ga0163162_10143626 3300013306 Bacteria 2501
300 Ga0163162_10264828 3300013306 Bacteria 1850
301 Ga0157372_10000644 3300013307 Bacteria 38351
302 Ga0157372_10012213 3300013307 Bacteria 9149
303 Ga0157372_10051368 3300013307 Bacteria 4588
304 Ga0157372_10055124 3300013307 Bacteria 4438
305 Ga0157372_10315974 3300013307 Bacteria 1819
306 Ga0157372_10587001 3300013307 Bacteria 1299
307 Ga0157375_10000073 3300013308 Bacteria 105972
308 Ga0157375_10001328 3300013308 Bacteria 21305
309 Ga0157375_10002045 3300013308 Bacteria 17406
310 Ga0157375_10010656 3300013308 Bacteria 8095
311 Ga0157375_10015188 3300013308 Bacteria 6890
312 Ga0157375_10036795 3300013308 Bacteria 4686
313 Ga0157375_10068627 3300013308 Bacteria 3548
314 Ga0157375_10078529 3300013308 Bacteria 3334
315 Ga0163163_10000198 3300014325 Bacteria 62120
316 Ga0163163_10003562 3300014325 Bacteria 13222
317 Ga0163163_10003589 3300014325 Bacteria 13185
318 Ga0163163_10279695 3300014325 Bacteria 1720
319 Ga0157380_10000746 3300014326 Bacteria 20287
320 Ga0157380_10014447 3300014326 Bacteria 5776
321 Ga0157380_10073825 3300014326 Bacteria 2767
322 Ga0182008_10000016 3300014497 Bacteria 241246
323 Ga0157377_10002780 3300014745 Bacteria 7797
324 Ga0157377_10006792 3300014745 Bacteria 5481
325 Ga0157379_10000068 3300014968 Bacteria 65388
326 Ga0157379_10006544 3300014968 Bacteria 10048
327 Ga0157379_10070411 3300014968 Bacteria 3129
328 Ga0157379_10082415 3300014968 Bacteria 2882
329 Ga0157379_10085934 3300014968 Bacteria 2820
330 Ga0157379_10275745 3300014968 Bacteria 1530
331 Ga0157376_10000719 3300014969 Bacteria 21414
332 Ga0157376_10000743 3300014969 Bacteria 21197
333 Ga0157376_10003045 3300014969 Bacteria 11485
334 Ga0157376_10004097 3300014969 Bacteria 10092
335 Ga0157376_10277759 3300014969 Bacteria 1576
336 Ga0182006_1000079 3300015261 Bacteria 122553
337 Ga0163161_10005480 3300017792 Bacteria 8809
338 Ga0163161_10006663 3300017792 Bacteria 7993
339 Ga0163161_10008498 3300017792 Bacteria 7110
340 Ga0163161_10016255 3300017792 Bacteria 5193
341 Ga0163161_10048335 3300017792 Unclassified 3072
342 Ga0163161_10156670 3300017792 Bacteria 1734
343 Ga0213876_10016049 3300021384 Bacteria 3961
344 Ga0209675_1000159 3300025291 Bacteria 87316
345 Ga0207656_10002932 3300025321 Bacteria 5821
346 Ga0207696_1039073 3300025711 Bacteria 1398
347 Ga0207655_1000058 3300025728 Bacteria 267656
348 Ga0207682_10032510 3300025893 Bacteria 2097
349 Ga0207642_10074905 3300025899 Unclassified 1624
350 Ga0207710_10002918 3300025900 Bacteria 7769
351 Ga0207710_10059521 3300025900 Unclassified 1729
352 Ga0207688_10004641 3300025901 Bacteria 7487
353 Ga0207680_10000049 3300025903 Bacteria 57625
354 Ga0207680_10082876 3300025903 Unclassified 2020
355 Ga0207647_10001371 3300025904 Bacteria 18715
356 Ga0207647_10016648 3300025904 Bacteria 5014
357 Ga0207645_10004561 3300025907 Bacteria 10226
358 Ga0207645_10006815 3300025907 Bacteria 8154
359 Ga0207645_10011044 3300025907 Bacteria 6181
360 Ga0207643_10002391 3300025908 Bacteria 10176
361 Ga0207643_10023285 3300025908 Bacteria 3415
362 Ga0207643_10042590 3300025908 Bacteria 2560
363 Ga0207643_10061636 3300025908 Bacteria 2142
364 Ga0207705_10015209 3300025909 Bacteria 5528
365 Ga0207654_10002542 3300025911 Bacteria 9256
366 Ga0207654_10008473 3300025911 Bacteria 5201
367 Ga0207654_10031825 3300025911 Bacteria 2909
368 Ga0207707_10000508 3300025912 Bacteria 39968
369 Ga0207707_10042220 3300025912 Bacteria 3982
370 Ga0207695_10000632 3300025913 Bacteria 70471
371 Ga0207695_10002023 3300025913 Bacteria 31171
372 Ga0207695_10003728 3300025913 Bacteria 21215
373 Ga0207695_10028321 3300025913 Bacteria 6217
374 Ga0207695_10040957 3300025913 Bacteria 4961
375 Ga0207671_10001126 3300025914 Bacteria 32182
376 Ga0207671_10004179 3300025914 Bacteria 13946
377 Ga0207671_10062160 3300025914 Unclassified 2772
378 Ga0207671_10086786 3300025914 Bacteria 2352
379 Ga0207671_10112435 3300025914 Bacteria 2073
380 Ga0207671_10126102 3300025914 Unclassified 1961
381 Ga0207660_10002757 3300025917 Bacteria 11512
382 Ga0207662_10048976 3300025918 Unclassified 2505
383 Ga0207662_10067885 3300025918 Bacteria 2152
384 Ga0207657_10044566 3300025919 Bacteria 3898
385 Ga0207649_10001711 3300025920 Bacteria 12613
386 Ga0207649_10032408 3300025920 Bacteria 3115
387 Ga0207649_10080371 3300025920 Unclassified 2108
388 Ga0207652_10001607 3300025921 Bacteria 19870
389 Ga0207652_10183771 3300025921 Bacteria 1879
390 Ga0207681_10003164 3300025923 Bacteria 10335
391 Ga0207681_10020575 3300025923 Bacteria 4184
392 Ga0207650_10001678 3300025925 Bacteria 15729
393 Ga0207650_10017509 3300025925 Bacteria 5019
394 Ga0207650_10069980 3300025925 Bacteria 2637
395 Ga0207650_10085597 3300025925 Bacteria 2399
396 Ga0207659_10012954 3300025926 Bacteria 5326
397 Ga0207659_10051000 3300025926 Bacteria 2941
398 Ga0207659_10060538 3300025926 Bacteria 2725
399 Ga0207659_10129856 3300025926 Bacteria 1943
400 Ga0207659_10148537 3300025926 Unclassified 1828
401 Ga0207644_10101857 3300025931 Bacteria 2159
402 Ga0207644_10128783 3300025931 Bacteria 1935
403 Ga0207690_10022219 3300025932 Unclassified 3944
404 Ga0207706_10002489 3300025933 Bacteria 17951
405 Ga0207706_10011208 3300025933 Bacteria 8174
406 Ga0207706_10013718 3300025933 Bacteria 7353
407 Ga0207706_10019228 3300025933 Bacteria 6142
408 Ga0207706_10025520 3300025933 Bacteria 5295
409 Ga0207706_10038722 3300025933 Bacteria 4229
410 Ga0207706_10066786 3300025933 Unclassified 3165
411 Ga0207686_10000957 3300025934 Bacteria 17232
412 Ga0207686_10027589 3300025934 Bacteria 3327
413 Ga0207686_10046499 3300025934 Bacteria 2677
414 Ga0207709_10000136 3300025935 Bacteria 106728
415 Ga0207670_10007585 3300025936 Bacteria 6064
416 Ga0207670_10014800 3300025936 Bacteria 4643
417 Ga0207669_10023202 3300025937 Bacteria 3310
418 Ga0207669_10026967 3300025937 Bacteria 3135
419 Ga0207669_10058491 3300025937 Bacteria 2352
420 Ga0207704_10014960 3300025938 Bacteria 3939
421 Ga0207691_10000113 3300025940 Bacteria 72765
422 Ga0207691_10006449 3300025940 Bacteria 11331
423 Ga0207691_10012590 3300025940 Bacteria 8109
424 Ga0207691_10058596 3300025940 Bacteria 3503
425 Ga0207691_10075497 3300025940 Bacteria 3039
426 Ga0207691_10104587 3300025940 Bacteria 2523
427 Ga0207691_10168417 3300025940 Bacteria 1919
428 Ga0207691_10171201 3300025940 Bacteria 1902
429 Ga0207691_10233963 3300025940 Bacteria 1590
430 Ga0207689_10001700 3300025942 Bacteria 20878
431 Ga0207689_10006964 3300025942 Bacteria 9941
432 Ga0207689_10007318 3300025942 Bacteria 9686
433 Ga0207689_10009324 3300025942 Bacteria 8484
434 Ga0207689_10010988 3300025942 Bacteria 7784
435 Ga0207689_10025569 3300025942 Bacteria 4947
436 Ga0207689_10036067 3300025942 Bacteria 4106
437 Ga0207689_10051709 3300025942 Bacteria 3387
438 Ga0207689_10094720 3300025942 Bacteria 2452
439 Ga0207689_10100140 3300025942 Bacteria 2381
440 Ga0207689_10119221 3300025942 Bacteria 2171
441 Ga0207661_10008012 3300025944 Bacteria 7530
442 Ga0207661_10018301 3300025944 Bacteria 5204
443 Ga0207679_10046793 3300025945 Bacteria 3138
444 Ga0207679_10089928 3300025945 Bacteria 2371
445 Ga0207679_10292740 3300025945 Unclassified 1400
446 Ga0207667_10001859 3300025949 Bacteria 26535
447 Ga0207667_10108051 3300025949 Bacteria 2870
448 Ga0207667_10293843 3300025949 Unclassified 1660
449 Ga0207667_10349110 3300025949 Bacteria 1509
450 Ga0207667_10376757 3300025949 Unclassified 1446
451 Ga0207651_10000313 3300025960 Bacteria 20839
452 Ga0207651_10018844 3300025960 Bacteria 4120
453 Ga0207651_10024772 3300025960 Bacteria 3718
454 Ga0207651_10304138 3300025960 Unclassified 1327
455 Ga0207712_10001108 3300025961 Bacteria 18819
456 Ga0207712_10003924 3300025961 Bacteria 9396
457 Ga0207712_10003997 3300025961 Bacteria 9306
458 Ga0207712_10017543 3300025961 Unclassified 4651
459 Ga0207712_10098500 3300025961 Bacteria 2168
460 Ga0207712_10161304 3300025961 Unclassified 1743
461 Ga0207668_10005826 3300025972 Bacteria 7258
462 Ga0207668_10006568 3300025972 Bacteria 6875
463 Ga0207668_10033964 3300025972 Bacteria 3383
464 Ga0207668_10039980 3300025972 Bacteria 3161
465 Ga0207668_10083349 3300025972 Bacteria 2326
466 Ga0207668_10096016 3300025972 Bacteria 2190
467 Ga0207640_10011687 3300025981 Bacteria 4977
468 Ga0207640_10026322 3300025981 Bacteria 3530
469 Ga0207640_10114839 3300025981 Bacteria 1917
470 Ga0207658_10001468 3300025986 Bacteria 18385
471 Ga0207658_10008605 3300025986 Bacteria 6944
472 Ga0207658_10019093 3300025986 Bacteria 4741
473 Ga0207658_10047273 3300025986 Bacteria 3149
474 Ga0207658_10320060 3300025986 Bacteria 1342
475 Ga0207677_10001071 3300026023 Bacteria 14919
476 Ga0207677_10003542 3300026023 Bacteria 8271
477 Ga0207677_10014262 3300026023 Bacteria 4635
478 Ga0207677_10115800 3300026023 Bacteria 2006
479 Ga0207703_10000316 3300026035 Bacteria 52401
480 Ga0207703_10003752 3300026035 Bacteria 12645
481 Ga0207703_10085260 3300026035 Unclassified 2643
482 Ga0207639_10016281 3300026041 Bacteria 5257
483 Ga0207639_10023282 3300026041 Bacteria 4471
484 Ga0207639_10069185 3300026041 Unclassified 2754
485 Ga0207639_10079273 3300026041 Bacteria 2595
486 Ga0207639_10172543 3300026041 Bacteria 1833
487 Ga0207639_10177206 3300026041 Bacteria 1810
488 Ga0207639_10295584 3300026041 Bacteria 1430
489 Ga0207708_10109127 3300026075 Bacteria 2147
490 Ga0207702_10395026 3300026078 Unclassified 1332
491 Ga0207641_10000043 3300026088 Bacteria 186340
492 Ga0207641_10008056 3300026088 Bacteria 8731
493 Ga0207641_10019872 3300026088 Bacteria 5511
494 Ga0207641_10034018 3300026088 Bacteria 4236
495 Ga0207641_10149779 3300026088 Bacteria 2112
496 Ga0207648_10002914 3300026089 Bacteria 18110
497 Ga0207648_10005321 3300026089 Bacteria 12980
498 Ga0207648_10019640 3300026089 Bacteria 6098
499 Ga0207648_10034780 3300026089 Bacteria 4441
500 Ga0207648_10129402 3300026089 Bacteria 2222
501 Ga0207648_10368613 3300026089 Unclassified 1297
502 Ga0207676_10001587 3300026095 Bacteria 16726
503 Ga0207676_10002542 3300026095 Bacteria 13025
504 Ga0207676_10004515 3300026095 Bacteria 9844
505 Ga0207676_10005296 3300026095 Bacteria 9136
506 Ga0207676_10070729 3300026095 Bacteria 2799
507 Ga0207676_10080892 3300026095 Bacteria 2638
508 Ga0207676_10086172 3300026095 Bacteria 2565
509 Ga0207676_10119192 3300026095 Bacteria 2222
510 Ga0207674_10003090 3300026116 Bacteria 20578
511 Ga0207674_10014288 3300026116 Bacteria 8774
512 Ga0207674_10034583 3300026116 Bacteria 5280
513 Ga0207674_10037559 3300026116 Bacteria 5036
514 Ga0207674_10048075 3300026116 Bacteria 4369
515 Ga0207674_10143834 3300026116 Unclassified 2344
516 Ga0207674_10244073 3300026116 Bacteria 1743
517 Ga0207674_10287226 3300026116 Bacteria 1593
518 Ga0207674_10414143 3300026116 Unclassified 1302
519 Ga0207675_100007098 3300026118 Bacteria 10587
520 Ga0207675_100016213 3300026118 Bacteria 6956
521 Ga0207675_100027432 3300026118 Bacteria 5304
522 Ga0207675_100039964 3300026118 Bacteria 4377
523 Ga0207675_100042272 3300026118 Bacteria 4254
524 Ga0207675_100145111 3300026118 Bacteria 2256
525 Ga0207675_100155714 3300026118 Unclassified 2177
526 Ga0207683_10014909 3300026121 Bacteria 6616
527 Ga0207683_10051899 3300026121 Bacteria 3593
528 Ga0207683_10108668 3300026121 Bacteria 2482
529 Ga0207683_10187855 3300026121 Unclassified 1875
530 Ga0207683_10394655 3300026121 Bacteria 1272
531 Ga0207698_10017399 3300026142 Bacteria 4875
532 Ga0207698_10063382 3300026142 Bacteria 2892
533 Ga0207698_10109750 3300026142 Bacteria 2309
534 Ga0207698_10126739 3300026142 Bacteria 2173
535 Ga0268266_10000102 3300028379 Bacteria 179754
536 Ga0268266_10006375 3300028379 Bacteria 10805
537 Ga0268266_10063348 3300028379 Bacteria 3192
538 Ga0268266_10278251 3300028379 Bacteria 1555
539 Ga0268265_10022442 3300028380 Bacteria 4435
540 Ga0268264_10000011 3300028381 Bacteria 580884
541 Ga0268264_10002558 3300028381 Bacteria 15941
542 Ga0268264_10003015 3300028381 Bacteria 14601
543 Ga0268264_10007707 3300028381 Bacteria 8968
544 Ga0268264_10012018 3300028381 Bacteria 7128
545 Ga0268264_10049163 3300028381 Bacteria 3508
546 Ga0268264_10217434 3300028381 Unclassified 1757
547 Ga0307517_10005347 3300028786 Bacteria 19393
548 Ga0307515_10000036 3300028794 Bacteria 332188
549 Ga0307511_10007489 3300030521 Bacteria 10970
550 Ga0265327_10000366 3300031251 Bacteria 85818
551 Ga0307509_10153774 3300031507 Bacteria 2211
552 Ga0307516_10022409 3300031730 Bacteria 6487
553 Ga0307412_10000640 3300031911 Bacteria 20375
554 Ga0307412_10001858 3300031911 Bacteria 11683
555 Ga0307412_10002518 3300031911 Bacteria 10189
556 Ga0307416_100000020 3300032002 Bacteria 192862
557 Ga0307414_10000041 3300032004 Bacteria 144783
558 Ga0307411_10212178 3300032005 Bacteria 1496
559 Ga0307510_10000119 3300033180 Bacteria 62835
560 Ga0373924_0004327 3300035410 Bacteria 4955
561 Ga0373937_0006203 3300036401 Bacteria 10298
562 Ga0373937_0158894 3300036401 Unclassified 2119
563 Ga0395905_0077497 3300037471 Bacteria 3115
564 Ga0395905_0120705 3300037471 Bacteria 2464
565 Ga0436365_1726582 3300039437 Bacteria 12978
566 Ga0436361_0978887 3300039447 Bacteria 2398
567 Ga0439436_0005145 3300041404 Bacteria 4010
568 Ga0439439_0005639 3300041406 Bacteria 2867
569 Ga0439465_0000489 3300041413 Bacteria 11781
570 Ga0451853_0979218 3300041512 Bacteria 1522
571 Ga0439431_0009943 3300041997 Bacteria 2154
572 Ga0439445_0000605 3300042004 Bacteria 7352
573 Ga0439457_003897 3300042014 Bacteria 3993
574 Ga0450897_000436 3300042128 Bacteria 2288
575 Ga0439434_0020291 3300042435 Bacteria 1995
576 Ga0439444_0006971 3300042437 Unclassified 1723
577 Ga0451577_0020626 3300042876 Bacteria 6045
578 Ga0451577_0127521 3300042876 Bacteria 2281
579 Ga0451577_0182934 3300042876 Unclassified 1890
580 Ga0466969_0000666 3300044656 Bacteria 18679
581 Ga0466972_0000182 3300044658 Bacteria 48545
582 Ga0466972_0001943 3300044658 Bacteria 10144
583 Ga0466966_0000030 3300044684 Bacteria 103300
584 Ga0466961_0047451 3300044693 Bacteria 2746
585 Ga0453684_0019544 3300044712 Bacteria 10301
586 Ga0453684_0143615 3300044712 Unclassified 2846
587 Ga0453684_0482226 3300044712 Bacteria 1375
588 Ga0466957_0002003 3300044842 Bacteria 10844
589 Ga0466957_0008313 3300044842 Bacteria 5900
590 Ga0466959_0000009 3300045049 Bacteria 176964
591 Ga0466959_0008643 3300045049 Bacteria 7207
592 Ga0466958_0021588 3300045836 Unclassified 3765
593 Ga0495627_000029 3300046453 Bacteria 232349
594 Ga0495627_007357 3300046453 Bacteria 4226
595 Ga0495590_0003729 3300046457 Bacteria 6201
596 Ga0495638_0041347 3300046460 Bacteria 2917
597 Ga0495638_0074526 3300046460 Bacteria 2070
598 Ga0495580_0085514 3300046472 Unclassified 2197
599 Ga0495582_0014360 3300046473 Bacteria 4354
600 Ga0495639_0055812 3300046475 Bacteria 1802
601 Ga0495606_0003913 3300046507 Bacteria 15321
602 Ga0495606_0050092 3300046507 Bacteria 2734
603 Ga0495606_0107711 3300046507 Bacteria 1685
604 Ga0495608_0055996 3300046511 Bacteria 2605
605 Ga0495610_0000001 3300046512 Bacteria 1620061
606 Ga0495630_0083819 3300046517 Bacteria 2407
607 Ga0495632_0006192 3300046519 Bacteria 7746
608 Ga0495643_0022766 3300046522 Bacteria 3568
609 Ga0495648_0004169 3300046524 Bacteria 12432
610 Ga0495663_0000243 3300046525 Bacteria 21677
611 Ga0495663_0003226 3300046525 Bacteria 4743
612 Ga0495654_0000008 3300046530 Bacteria 398340
613 Ga0495586_0084249 3300046535 Bacteria 1750
614 Ga0495587_0101986 3300046536 Bacteria 1653
615 Ga0495609_0000010 3300046538 Bacteria 342605
616 Ga0495633_0000163 3300046558 Bacteria 87285
617 Ga0495633_0003132 3300046558 Bacteria 11208
618 Ga0495667_0089845 3300046559 Unclassified 1991
619 Ga0495668_0042839 3300046616 Bacteria 2519
620 Ga0495611_0000196 3300046648 Bacteria 42876
621 Ga0495611_0020777 3300046648 Bacteria 2830
622 Ga0495625_0009153 3300046660 Bacteria 8328
623 Ga0495625_0043787 3300046660 Unclassified 3244
624 Ga0495625_0168790 3300046660 Bacteria 1462
625 Ga0495635_0048931 3300046663 Bacteria 2914
626 Ga0495657_0034896 3300046675 Bacteria 3491
627 Ga0495613_0127420 3300046689 Unclassified 1825
628 Ga0495670_0061833 3300046691 Unclassified 1883
629 Ga0495672_0042755 3300047320 Bacteria 2730
630 Ga0495687_000001 3300047443 Bacteria 1215582
631 Ga0495675_0094841 3300047444 Bacteria 1871
632 Ga0495686_0000004 3300047472 Bacteria 869019
633 Ga0495686_0000153 3300047472 Bacteria 133256
634 Ga0495686_0009346 3300047472 Bacteria 7069
635 Ga0496100_0012425 3300048903 Bacteria 4882
636 Ga0496102_0008085 3300048905 Bacteria 8999
637 Ga0496108_0127744 3300048911 Bacteria 2184
638 Ga0496109_0141592 3300048912 Bacteria 2249
639 Ga0496110_0060307 3300048913 Bacteria 3345
640 Ga0496113_0068299 3300048916 Bacteria 2697
641 Ga0496115_0136596 3300048918 Bacteria 2022
642 Ga0496116_0000037 3300048919 Bacteria 374675
643 Ga0496117_0000086 3300048920 Bacteria 212331
644 Ga0496117_0155628 3300048920 Bacteria 1346
645 Ga0496118_0000284 3300048921 Bacteria 88966
646 Ga0496118_0040654 3300048921 Bacteria 3694
647 Ga0496119_0000037 3300048922 Bacteria 210912
648 Ga0496121_0109943 3300048924 Bacteria 2104
649 Ga0496122_0000389 3300048925 Bacteria 93538
650 Ga0496122_0000489 3300048925 Bacteria 82241
651 Ga0496122_0004673 3300048925 Bacteria 16820
652 Ga0496122_0013915 3300048925 Bacteria 7825
653 Ga0496122_0019795 3300048925 Bacteria 6129
654 Ga0496123_0000739 3300048926 Bacteria 52947
655 Ga0496123_0008923 3300048926 Bacteria 9117
656 Ga0496123_0050450 3300048926 Bacteria 2780
657 Ga0496124_0006053 3300048927 Bacteria 13321
658 Ga0496125_0000685 3300048928 Bacteria 56407
659 Ga0496125_0009248 3300048928 Bacteria 10176
660 Ga0496125_0011751 3300048928 Bacteria 8727
661 Ga0496126_0002873 3300048929 Bacteria 22479
662 Ga0501335_002129 3300049551 Bacteria 1585
663 Ga0501031_0004536 3300049568 Bacteria 9001
664 Ga0501032_0031441 3300049569 Bacteria 3640
665 Ga0501032_0046480 3300049569 Bacteria 2934
666 Ga0501034_0003582 3300049571 Bacteria 17631
667 Ga0501034_0040999 3300049571 Bacteria 4684
668 Ga0501036_0000630 3300049572 Bacteria 25708
669 Ga0501036_0001356 3300049572 Bacteria 18774
670 Ga0501037_0007477 3300049573 Bacteria 7994
671 Ga0501037_0083250 3300049573 Unclassified 2318
672 Ga0501038_0052718 3300049574 Bacteria 3506
673 Ga0501039_0004101 3300049575 Bacteria 10964
674 Ga0501043_0013189 3300049579 Bacteria 6464
675 Ga0501043_0174971 3300049579 Bacteria 1674
676 Ga0501046_0002967 3300049580 Bacteria 15697
677 Ga0501047_0004450 3300049581 Bacteria 13194
678 Ga0501047_0020430 3300049581 Bacteria 6359
679 Ga0501047_0063759 3300049581 Bacteria 3555
680 Ga0501047_0130519 3300049581 Bacteria 2393
681 Ga0501047_0178622 3300049581 Bacteria 1990
682 Ga0501048_0035393 3300049582 Bacteria 3595
683 Ga0501067_0009302 3300049583 Bacteria 5444
684 Ga0501068_0051628 3300049584 Bacteria 2488
685 Ga0501068_0213893 3300049584 Unclassified 1224
686 Ga0501069_0006684 3300049585 Bacteria 6038
687 Ga0501070_0297125 3300049586 Bacteria 1316
688 Ga0501073_0004829 3300049589 Bacteria 10114
689 Ga0501073_0058380 3300049589 Bacteria 2696
690 Ga0501074_0010705 3300049590 Bacteria 6660
691 Ga0501074_0174662 3300049590 Bacteria 1533
692 Ga0501076_0195832 3300049592 Bacteria 1650
693 Ga0501202_000050 3300049652 Bacteria 12265
694 Ga0501207_000735 3300049654 Unclassified 3857
695 Ga0501217_000079 3300049661 Bacteria 11818
696 Ga0501223_000157 3300049663 Bacteria 17995
697 Ga0501235_000643 3300049669 Bacteria 7040
698 Ga0501251_000677 3300049681 Unclassified 3065
699 Ga0501257_010955 3300049686 Bacteria 2063
700 Ga0501257_019869 3300049686 Unclassified 1573
701 Ga0501259_000566 3300049688 Bacteria 5904
702 Ga0501261_000336 3300049690 Bacteria 6351
703 Ga0501219_000158 3300049703 Bacteria 12365
704 Ga0501221_000123 3300049704 Bacteria 9752
705 Ga0501225_0000570 3300049705 Bacteria 11554
706 Ga0501234_001234 3300049707 Bacteria 4017
707 Ga0501245_000180 3300049708 Bacteria 7000
708 Ga0501079_0028834 3300049741 Bacteria 4261
709 Ga0501080_0015066 3300049742 Bacteria 7125
710 Ga0501083_0007396 3300049744 Bacteria 7790
711 Ga0501241_000009 3300049758 Bacteria 128695
712 Ga0501241_006951 3300049758 Bacteria 2078
713 Ga0501269_000196 3300049766 Bacteria 18180
714 Ga0501035_0032120 3300049822 Bacteria 4778
715 Ga0501035_0045457 3300049822 Bacteria 3951
716 Ga0501035_0345990 3300049822 Bacteria 1245
717 Ga0501044_0018446 3300049823 Bacteria 7476
718 Ga0501284_00050 3300050005 Bacteria 43535
719 nmdc:mga05p37_230156_c1 3300050507 Bacteria 2234
720 nmdc:mga09592_18509_c1 3300050508 Bacteria 5713
721 nmdc:mga09592_201507_c1 3300050508 Bacteria 1724
722 nmdc:mga09592_220978_c1 3300050508 Bacteria 1641
723 nmdc:mga0qj67_104414_c1 3300050509 Bacteria 2286
724 nmdc:mga0qj67_15330_c1 3300050509 Bacteria 5804
725 nmdc:mga06r32_13190_c1 3300050510 Bacteria 7487
726 nmdc:mga06r32_290716_c1 3300050510 Unclassified 1621
727 nmdc:mga06r32_71915_c1 3300050510 Bacteria 3348
728 nmdc:mga08y16_126848_c1 3300050511 Bacteria 2654
729 nmdc:mga08y16_242178_c1 3300050511 Unclassified 1864
730 Ga0500578_0000529 3300053086 Bacteria 46403
731 Ga0500646_0007214 3300053090 Bacteria 2836
732 Ga0500646_0011254 3300053090 Bacteria 2299
733 Ga0500583_0000016 3300053092 Bacteria 144540
734 Ga0500583_0000708 3300053092 Bacteria 9699
735 Ga0500583_0002224 3300053092 Bacteria 5763
736 Ga0500652_013545 3300053131 Bacteria 2891
737 Ga0500568_0002668 3300053139 Bacteria 10352
738 Ga0500568_0011028 3300053139 Bacteria 4209
739 Ga0500588_0017851 3300053146 Bacteria 1860
740 Ga0500604_0001737 3300053151 Bacteria 6092
741 Ga0500622_0014731 3300053156 Bacteria 4192
742 Ga0500636_0071166 3300053177 Bacteria 2017
743 Ga0500636_0083176 3300053177 Bacteria 1842
744 Ga0501084_0065623 3300054114 Bacteria 3037

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10275279 Ga0157369_102752793 294
2 3300049551 Ga0501335_002129 Ga0501335_002129_14_931 300
3 3300053151 Ga0500604_0001737 Ga0500604_0001737_2679_3821 321
4 3300048905 Ga0496102_0008085 Ga0496102_0008085_3513_4595 342
5 3300048916 Ga0496113_0068299 Ga0496113_0068299_65_1147 342
6 3300048919 Ga0496116_0000037 Ga0496116_0000037_3186_4268 342
7 3300048920 Ga0496117_0000086 Ga0496117_0000086_3667_4749 342
8 3300048921 Ga0496118_0000284 Ga0496118_0000284_84219_85301 342
9 3300048922 Ga0496119_0000037 Ga0496119_0000037_3723_4805 342
10 3300048924 Ga0496121_0109943 Ga0496121_0109943_726_1808 342
11 3300048925 Ga0496122_0013915 Ga0496122_0013915_3723_4805 342
12 3300048926 Ga0496123_0000739 Ga0496123_0000739_3723_4805 342
13 3300048927 Ga0496124_0006053 Ga0496124_0006053_9082_10164 342
14 3300048928 Ga0496125_0011751 Ga0496125_0011751_3695_4777 342
15 3300049571 Ga0501034_0040999 Ga0501034_0040999_2083_3120 345
16 3300049586 Ga0501070_0297125 Ga0501070_0297125_125_1162 345
17 3300049822 Ga0501035_0045457 Ga0501035_0045457_2278_3315 345
18 3300046616 Ga0495668_0042839 Ga0495668_0042839_1027_2169 347
19 3300005347 Ga0070668_100346051 Ga0070668_1003460511 348
20 3300013104 Ga0157370_10013588 Ga0157370_100135882 348
21 3300025291 Ga0209675_1000159 Ga0209675_100015972 348
22 3300025972 Ga0207668_10083349 Ga0207668_100833493 348
23 3300048925 Ga0496122_0004673 Ga0496122_0004673_9833_10915 348
24 3300048926 Ga0496123_0050450 Ga0496123_0050450_1276_2358 348
25 3300048928 Ga0496125_0000685 Ga0496125_0000685_45389_46471 348
26 iso_pu_bacteria 2585428115 2587942597 348
27 iso_pu_bacteria 2889290771 2889293605 348
28 iso_pu_bacteria 2905999023 2906002841 348
29 iso_pu_bacteria 2984572630 2984574641 348
30 iso_pu_bacteria 2984606641 2984608092 348
31 iso_pu_bacteria 2511231000 2511234416 349
32 iso_pu_bacteria 2523533629 2524006767 349
33 iso_pu_bacteria 2582581278 2585142357 349
34 iso_pu_bacteria 2582581281 2585159919 349
35 iso_pu_bacteria 2582581282 2585164134 349
36 iso_pu_bacteria 2582581873 2585426725 349
37 iso_pu_bacteria 2585428045 2587680713 349
38 iso_pu_bacteria 2585428060 2587748832 349
39 iso_pu_bacteria 2585428061 2587752731 349
40 iso_pu_bacteria 2585428095 2587868558 349
41 iso_pu_bacteria 2585428182 2588211834 349
42 iso_pu_bacteria 2585428183 2588216499 349
43 iso_pu_bacteria 2585428184 2588217695 349
44 iso_pu_bacteria 2585428185 2588225869 349
45 iso_pu_bacteria 2585428187 2588230933 349
46 iso_pu_bacteria 2588253712 2588447768 349
47 iso_pu_bacteria 2588254255 2590603689 349
48 iso_pu_bacteria 2588254257 2590610413 349
49 iso_pu_bacteria 2728369107 2729202550 349
50 iso_pu_bacteria 2739367874 2740060636 349
51 iso_pu_bacteria 2751185877 2753675034 349
52 iso_pu_bacteria 2765235839 2765575903 349
53 iso_pu_bacteria 2772190705 2772606621 349
54 iso_pu_bacteria 2775506739 2775674140 349
55 iso_pu_bacteria 2816332188 2816875611 349
56 iso_pu_bacteria 2842083920 2842087776 349
57 iso_pu_bacteria 2871720351 2871724837 349
58 iso_pu_bacteria 2919097161 2919099903 349
59 iso_pu_bacteria 2919399522 2919403574 349
60 iso_pu_bacteria 2945924605 2945928718 349
61 iso_pu_bacteria 2946019816 2946019833 349
62 iso_pu_bacteria 2977243572 2977247570 349
63 iso_pu_bacteria 2993372514 2993374894 349
64 iso_pu_bacteria 2993480792 2993481749 349
65 3300005530 Ga0070679_100161191 Ga0070679_1001611912 351
66 3300037471 Ga0395905_0120705 Ga0395905_0120705_1161_2222 351
67 3300046660 Ga0495625_0043787 Ga0495625_0043787_2176_3234 351
68 3300053146 Ga0500588_0017851 Ga0500588_0017851_430_1488 351
69 3300005288 Ga0065714_10069763 Ga0065714_100697633 352
70 3300005289 Ga0065704_10071464 Ga0065704_100714644 352
71 3300005289 Ga0065704_10075289 Ga0065704_100752894 352
72 3300005289 Ga0065704_10089648 Ga0065704_100896482 352
73 3300005329 Ga0070683_100022315 Ga0070683_1000223156 352
74 3300005347 Ga0070668_100022201 Ga0070668_1000222013 352
75 3300005535 Ga0070684_100000979 Ga0070684_1000009794 352
76 3300009036 Ga0105244_10000018 Ga0105244_100000185 352
77 3300009092 Ga0105250_10067518 Ga0105250_100675181 352
78 3300009098 Ga0105245_10140027 Ga0105245_101400272 352
79 3300009101 Ga0105247_10083036 Ga0105247_100830361 352
80 3300009148 Ga0105243_10000089 Ga0105243_1000008991 352
81 3300009177 Ga0105248_10242548 Ga0105248_102425482 352
82 3300009545 Ga0105237_10078482 Ga0105237_100784822 352
83 3300010375 Ga0105239_10324178 Ga0105239_103241781 352
84 3300013100 Ga0157373_10000067 Ga0157373_1000006786 352
85 3300013102 Ga0157371_10000036 Ga0157371_1000003652 352
86 3300013102 Ga0157371_10029931 Ga0157371_100299313 352
87 3300013104 Ga0157370_10001141 Ga0157370_1000114120 352
88 3300013105 Ga0157369_10000153 Ga0157369_1000015353 352
89 3300013296 Ga0157374_10000467 Ga0157374_100004671 352
90 3300013297 Ga0157378_10020674 Ga0157378_100206742 352
91 3300013306 Ga0163162_10000750 Ga0163162_100007506 352
92 3300013308 Ga0157375_10001328 Ga0157375_1000132815 352
93 3300013308 Ga0157375_10002045 Ga0157375_100020459 352
94 3300014325 Ga0163163_10003562 Ga0163163_100035624 352
95 3300014497 Ga0182008_10000016 Ga0182008_100000164 352
96 3300014968 Ga0157379_10000068 Ga0157379_1000006832 352
97 3300014969 Ga0157376_10000743 Ga0157376_100007435 352
98 3300015261 Ga0182006_1000079 Ga0182006_1000079119 352
99 3300017792 Ga0163161_10005480 Ga0163161_100054805 352
100 3300025711 Ga0207696_1039073 Ga0207696_10390731 352
101 3300025728 Ga0207655_1000058 Ga0207655_1000058261 352
102 3300025935 Ga0207709_10000136 Ga0207709_1000013695 352
103 3300025944 Ga0207661_10018301 Ga0207661_100183012 352
104 3300031911 Ga0307412_10000640 Ga0307412_1000064014 352
105 3300031911 Ga0307412_10001858 Ga0307412_100018584 352
106 3300031911 Ga0307412_10002518 Ga0307412_100025186 352
107 3300032002 Ga0307416_100000020 Ga0307416_100000020194 352
108 3300032004 Ga0307414_10000041 Ga0307414_10000041133 352
109 3300039447 Ga0436361_0978887 Ga0436361_0978887_775_1857 352
110 3300041413 Ga0439465_0000489 Ga0439465_0000489_6530_7612 352
111 3300042004 Ga0439445_0000605 Ga0439445_0000605_3067_4149 352
112 3300046453 Ga0495627_000029 Ga0495627_000029_4164_5246 352
113 3300046453 Ga0495627_007357 Ga0495627_007357_1676_2758 352
114 3300046457 Ga0495590_0003729 Ga0495590_0003729_3343_4425 352
115 3300046460 Ga0495638_0074526 Ga0495638_0074526_760_1842 352
116 3300046507 Ga0495606_0003913 Ga0495606_0003913_12801_13883 352
117 3300046507 Ga0495606_0050092 Ga0495606_0050092_685_1767 352
118 3300046512 Ga0495610_0000001 Ga0495610_0000001_5955_7037 352
119 3300046519 Ga0495632_0006192 Ga0495632_0006192_4307_5389 352
120 3300046522 Ga0495643_0022766 Ga0495643_0022766_469_1551 352
121 3300046525 Ga0495663_0000243 Ga0495663_0000243_16292_17374 352
122 3300046525 Ga0495663_0003226 Ga0495663_0003226_2942_4024 352
123 3300046530 Ga0495654_0000008 Ga0495654_0000008_393012_394094 352
124 3300046538 Ga0495609_0000010 Ga0495609_0000010_4092_5174 352
125 3300046558 Ga0495633_0000163 Ga0495633_0000163_82321_83403 352
126 3300046558 Ga0495633_0003132 Ga0495633_0003132_3967_5049 352
127 3300046660 Ga0495625_0009153 Ga0495625_0009153_7046_8128 352
128 3300047472 Ga0495686_0000153 Ga0495686_0000153_6271_7353 352
129 3300047472 Ga0495686_0009346 Ga0495686_0009346_919_2001 352
130 3300048911 Ga0496108_0127744 Ga0496108_0127744_706_1764 352
131 3300048912 Ga0496109_0141592 Ga0496109_0141592_78_1136 352
132 3300048920 Ga0496117_0155628 Ga0496117_0155628_238_1320 352
133 3300048921 Ga0496118_0040654 Ga0496118_0040654_454_1536 352
134 3300048925 Ga0496122_0000389 Ga0496122_0000389_88172_89254 352
135 3300048925 Ga0496122_0000489 Ga0496122_0000489_76586_77668 352
136 3300048925 Ga0496122_0019795 Ga0496122_0019795_1269_2351 352
137 3300048926 Ga0496123_0008923 Ga0496123_0008923_612_1694 352
138 3300048928 Ga0496125_0009248 Ga0496125_0009248_3087_4169 352
139 3300048929 Ga0496126_0002873 Ga0496126_0002873_17303_18385 352
140 3300049758 Ga0501241_000009 Ga0501241_000009_3149_4231 352
141 3300049766 Ga0501269_000196 Ga0501269_000196_6166_7248 352
142 3300046473 Ga0495582_0014360 Ga0495582_0014360_1777_2838 353
143 3300046475 Ga0495639_0055812 Ga0495639_0055812_311_1372 353
144 3300046517 Ga0495630_0083819 Ga0495630_0083819_882_1943 353
145 3300046535 Ga0495586_0084249 Ga0495586_0084249_343_1404 353
146 3300046536 Ga0495587_0101986 Ga0495587_0101986_341_1402 353
147 3300041512 Ga0451853_0979218 Ga0451853_0979218_443_1510 355
148 3300005616 Ga0068852_100150484 Ga0068852_1001504842 356
149 3300009094 Ga0111539_10022334 Ga0111539_100223342 356
150 3300053177 Ga0500636_0083176 Ga0500636_0083176_683_1753 356
151 3300005335 Ga0070666_10037121 Ga0070666_100371212 357
152 3300005343 Ga0070687_100034971 Ga0070687_1000349712 357
153 3300005356 Ga0070674_100253931 Ga0070674_1002539311 357
154 3300005364 Ga0070673_100040305 Ga0070673_1000403053 357
155 3300005367 Ga0070667_100133168 Ga0070667_1001331682 357
156 3300005441 Ga0070700_100095103 Ga0070700_1000951032 357
157 3300005544 Ga0070686_100052602 Ga0070686_1000526021 357
158 3300025918 Ga0207662_10048976 Ga0207662_100489762 357
159 3300025920 Ga0207649_10080371 Ga0207649_100803712 357
160 3300025926 Ga0207659_10148537 Ga0207659_101485372 357
161 3300025937 Ga0207669_10058491 Ga0207669_100584912 357
162 3300026089 Ga0207648_10129402 Ga0207648_101294022 357
163 3300044656 Ga0466969_0000666 Ga0466969_0000666_863_1942 357
164 3300044684 Ga0466966_0000030 Ga0466966_0000030_80968_82047 357
165 3300045049 Ga0466959_0000009 Ga0466959_0000009_151241_152320 357
166 3300049581 Ga0501047_0178622 Ga0501047_0178622_159_1235 357
167 3300005456 Ga0070678_100080138 Ga0070678_1000801382 358
168 3300026121 Ga0207683_10051899 Ga0207683_100518993 358
169 3300049703 Ga0501219_000158 Ga0501219_000158_9134_10240 359
170 3300049758 Ga0501241_006951 Ga0501241_006951_113_1249 359
171 3300050005 Ga0501284_00050 Ga0501284_00050_16030_17136 359
172 3300005616 Ga0068852_100115467 Ga0068852_1001154672 360
173 3300009093 Ga0105240_10000283 Ga0105240_1000028311 360
174 3300009093 Ga0105240_10162660 Ga0105240_101626601 360
175 3300009147 Ga0114129_10032885 Ga0114129_100328854 360
176 3300009174 Ga0105241_10000409 Ga0105241_1000040925 360
177 3300009174 Ga0105241_10354329 Ga0105241_103543291 360
178 3300009551 Ga0105238_10412573 Ga0105238_104125732 360
179 3300013104 Ga0157370_10000702 Ga0157370_1000070237 360
180 3300013297 Ga0157378_10095245 Ga0157378_100952452 360
181 3300013306 Ga0163162_10039646 Ga0163162_100396462 360
182 3300026142 Ga0207698_10063382 Ga0207698_100633822 360
183 3300042014 Ga0439457_003897 Ga0439457_003897_941_2044 360
184 3300042435 Ga0439434_0020291 Ga0439434_0020291_63_1166 360
185 3300046460 Ga0495638_0041347 Ga0495638_0041347_679_1794 360
186 3300046524 Ga0495648_0004169 Ga0495648_0004169_1031_2146 360
187 3300046648 Ga0495611_0020777 Ga0495611_0020777_27_1142 360
188 3300046660 Ga0495625_0168790 Ga0495625_0168790_230_1345 360
189 3300047443 Ga0495687_000001 Ga0495687_000001_932584_933690 360
190 3300050507 nmdc:mga05p37_230156_c1 nmdc:mga05p37_230156_c1_473_1585 360
191 3300053092 Ga0500583_0000708 Ga0500583_0000708_6118_7233 360
192 3300053139 Ga0500568_0011028 Ga0500568_0011028_1761_2876 360
193 3300053156 Ga0500622_0014731 Ga0500622_0014731_1203_2318 360
194 3300005331 Ga0070670_100102102 Ga0070670_1001021023 361
195 3300005577 Ga0068857_100049520 Ga0068857_1000495202 361
196 3300005617 Ga0068859_100088698 Ga0068859_1000886982 361
197 3300006931 Ga0097620_100088699 Ga0097620_1000886992 361
198 3300026116 Ga0207674_10034583 Ga0207674_100345832 361
199 3300028786 Ga0307517_10005347 Ga0307517_100053477 361
200 3300046648 Ga0495611_0000196 Ga0495611_0000196_9619_10728 362
201 3300053139 Ga0500568_0002668 Ga0500568_0002668_4476_5603 362
202 iso_pu_bacteria 2738541278 2738731075 362
203 3300005337 Ga0070682_100101340 Ga0070682_1001013402 363
204 3300026116 Ga0207674_10143834 Ga0207674_101438342 363
205 3300005288 Ga0065714_10071326 Ga0065714_100713264 364
206 3300009093 Ga0105240_10016989 Ga0105240_100169893 364
207 3300013100 Ga0157373_10002372 Ga0157373_1000237211 364
208 3300013102 Ga0157371_10070705 Ga0157371_100707052 364
209 3300013306 Ga0163162_10264828 Ga0163162_102648282 364
210 3300014968 Ga0157379_10085934 Ga0157379_100859342 364
211 3300017792 Ga0163161_10156670 Ga0163161_101566701 364
212 3300021384 Ga0213876_10016049 Ga0213876_100160491 364
213 3300025921 Ga0207652_10183771 Ga0207652_101837712 364
214 3300031251 Ga0265327_10000366 Ga0265327_100003665 364
215 3300049573 Ga0501037_0083250 Ga0501037_0083250_91_1218 364
216 3300005331 Ga0070670_100081212 Ga0070670_1000812121 365
217 3300005338 Ga0068868_100003934 Ga0068868_1000039342 365
218 3300005367 Ga0070667_100003423 Ga0070667_1000034234 365
219 3300005466 Ga0070685_10140189 Ga0070685_101401891 365
220 3300005617 Ga0068859_100030064 Ga0068859_1000300642 365
221 3300005841 Ga0068863_100021283 Ga0068863_1000212834 365
222 3300005843 Ga0068860_100000241 Ga0068860_10000024158 365
223 3300005843 Ga0068860_100034397 Ga0068860_1000343972 365
224 3300006880 Ga0075429_100046275 Ga0075429_1000462752 365
225 3300006881 Ga0068865_100164726 Ga0068865_1001647261 365
226 3300006931 Ga0097620_100030063 Ga0097620_1000300632 365
227 3300009094 Ga0111539_10047195 Ga0111539_100471952 365
228 3300013296 Ga0157374_10018403 Ga0157374_100184034 365
229 3300013297 Ga0157378_10002438 Ga0157378_100024388 365
230 3300013297 Ga0157378_10078824 Ga0157378_100788242 365
231 3300013306 Ga0163162_10000216 Ga0163162_1000021633 365
232 3300025937 Ga0207669_10026967 Ga0207669_100269672 365
233 3300025986 Ga0207658_10008605 Ga0207658_100086052 365
234 3300026023 Ga0207677_10001071 Ga0207677_100010715 365
235 3300026088 Ga0207641_10008056 Ga0207641_100080563 365
236 3300026118 Ga0207675_100145111 Ga0207675_1001451112 365
237 3300028381 Ga0268264_10000011 Ga0268264_10000011374 365
238 3300028381 Ga0268264_10002558 Ga0268264_100025585 365
239 3300041997 Ga0439431_0009943 Ga0439431_0009943_138_1241 365
240 3300042128 Ga0450897_000436 Ga0450897_000436_105_1208 365
241 3300049569 Ga0501032_0031441 Ga0501032_0031441_548_1654 365
242 3300049573 Ga0501037_0007477 Ga0501037_0007477_2816_3922 365
243 3300049822 Ga0501035_0032120 Ga0501035_0032120_1875_2981 365
244 3300050508 nmdc:mga09592_220978_c1 nmdc:mga09592_220978_c1_521_1627 365
245 3300050511 nmdc:mga08y16_126848_c1 nmdc:mga08y16_126848_c1_845_1951 365
246 3300005290 Ga0065712_10110228 Ga0065712_101102282 366
247 3300005340 Ga0070689_100226893 Ga0070689_1002268931 366
248 3300005347 Ga0070668_100180182 Ga0070668_1001801822 366
249 3300005355 Ga0070671_100037104 Ga0070671_1000371042 366
250 3300005367 Ga0070667_100131886 Ga0070667_1001318862 366
251 3300005539 Ga0068853_100172128 Ga0068853_1001721282 366
252 3300005578 Ga0068854_100049439 Ga0068854_1000494391 366
253 3300005616 Ga0068852_100017015 Ga0068852_1000170153 366
254 3300005617 Ga0068859_100000035 Ga0068859_100000035107 366
255 3300005618 Ga0068864_100003043 Ga0068864_1000030433 366
256 3300005841 Ga0068863_100004976 Ga0068863_1000049763 366
257 3300005842 Ga0068858_100002128 Ga0068858_1000021284 366
258 3300005843 Ga0068860_100005982 Ga0068860_1000059823 366
259 3300005843 Ga0068860_100046288 Ga0068860_1000462883 366
260 3300006237 Ga0097621_100009119 Ga0097621_1000091193 366
261 3300006358 Ga0068871_100222176 Ga0068871_1002221761 366
262 3300006847 Ga0075431_100013571 Ga0075431_1000135713 366
263 3300006881 Ga0068865_100252093 Ga0068865_1002520931 366
264 3300006931 Ga0097620_100000035 Ga0097620_100000035107 366
265 3300009093 Ga0105240_10063781 Ga0105240_100637812 366
266 3300009093 Ga0105240_10071812 Ga0105240_100718122 366
267 3300009101 Ga0105247_10007389 Ga0105247_100073892 366
268 3300009147 Ga0114129_10063339 Ga0114129_100633394 366
269 3300009174 Ga0105241_10002106 Ga0105241_100021063 366
270 3300009545 Ga0105237_10000982 Ga0105237_1000098220 366
271 3300009545 Ga0105237_10020423 Ga0105237_100204233 366
272 3300009553 Ga0105249_10001250 Ga0105249_1000125011 366
273 3300010375 Ga0105239_10071327 Ga0105239_100713271 366
274 3300011119 Ga0105246_10328224 Ga0105246_103282241 366
275 3300013105 Ga0157369_10270351 Ga0157369_102703511 366
276 3300013296 Ga0157374_10166629 Ga0157374_101666292 366
277 3300013306 Ga0163162_10000573 Ga0163162_1000057318 366
278 3300013307 Ga0157372_10315974 Ga0157372_103159742 366
279 3300013308 Ga0157375_10036795 Ga0157375_100367952 366
280 3300014326 Ga0157380_10000746 Ga0157380_100007463 366
281 3300014968 Ga0157379_10082415 Ga0157379_100824152 366
282 3300014969 Ga0157376_10004097 Ga0157376_100040972 366
283 3300017792 Ga0163161_10048335 Ga0163161_100483353 366
284 3300025900 Ga0207710_10059521 Ga0207710_100595212 366
285 3300025903 Ga0207680_10000049 Ga0207680_1000004939 366
286 3300025911 Ga0207654_10002542 Ga0207654_100025422 366
287 3300025911 Ga0207654_10031825 Ga0207654_100318252 366
288 3300025913 Ga0207695_10003728 Ga0207695_100037287 366
289 3300025913 Ga0207695_10028321 Ga0207695_100283212 366
290 3300025914 Ga0207671_10001126 Ga0207671_1000112619 366
291 3300025914 Ga0207671_10004179 Ga0207671_100041793 366
292 3300025914 Ga0207671_10062160 Ga0207671_100621602 366
293 3300025914 Ga0207671_10086786 Ga0207671_100867862 366
294 3300025925 Ga0207650_10017509 Ga0207650_100175092 366
295 3300025926 Ga0207659_10060538 Ga0207659_100605382 366
296 3300025931 Ga0207644_10101857 Ga0207644_101018572 366
297 3300025937 Ga0207669_10023202 Ga0207669_100232022 366
298 3300025940 Ga0207691_10006449 Ga0207691_100064497 366
299 3300025940 Ga0207691_10233963 Ga0207691_102339632 366
300 3300025942 Ga0207689_10001700 Ga0207689_100017006 366
301 3300025949 Ga0207667_10001859 Ga0207667_1000185925 366
302 3300025949 Ga0207667_10349110 Ga0207667_103491102 366
303 3300025961 Ga0207712_10003997 Ga0207712_100039972 366
304 3300025972 Ga0207668_10006568 Ga0207668_100065682 366
305 3300025986 Ga0207658_10019093 Ga0207658_100190933 366
306 3300026035 Ga0207703_10003752 Ga0207703_100037523 366
307 3300026041 Ga0207639_10172543 Ga0207639_101725431 366
308 3300026078 Ga0207702_10395026 Ga0207702_103950261 366
309 3300026088 Ga0207641_10000043 Ga0207641_1000004386 366
310 3300026095 Ga0207676_10004515 Ga0207676_100045153 366
311 3300026142 Ga0207698_10017399 Ga0207698_100173992 366
312 3300028379 Ga0268266_10000102 Ga0268266_10000102106 366
313 3300028381 Ga0268264_10007707 Ga0268264_100077077 366
314 3300028381 Ga0268264_10012018 Ga0268264_100120186 366
315 3300028794 Ga0307515_10000036 Ga0307515_1000003671 366
316 3300031507 Ga0307509_10153774 Ga0307509_101537742 366
317 3300033180 Ga0307510_10000119 Ga0307510_1000011926 366
318 3300041404 Ga0439436_0005145 Ga0439436_0005145_686_1795 366
319 3300041406 Ga0439439_0005639 Ga0439439_0005639_1660_2769 366
320 3300042876 Ga0451577_0127521 Ga0451577_0127521_505_1656 366
321 3300042876 Ga0451577_0182934 Ga0451577_0182934_377_1489 366
322 3300044658 Ga0466972_0000182 Ga0466972_0000182_13410_14519 366
323 3300044658 Ga0466972_0001943 Ga0466972_0001943_2183_3349 366
324 3300044842 Ga0466957_0008313 Ga0466957_0008313_2284_3393 366
325 3300046507 Ga0495606_0107711 Ga0495606_0107711_103_1287 366
326 3300047320 Ga0495672_0042755 Ga0495672_0042755_1293_2399 366
327 3300049579 Ga0501043_0174971 Ga0501043_0174971_70_1179 366
328 3300049581 Ga0501047_0020430 Ga0501047_0020430_978_2087 366
329 3300049581 Ga0501047_0130519 Ga0501047_0130519_230_1339 366
330 3300050510 nmdc:mga06r32_13190_c1 nmdc:mga06r32_13190_c1_1601_2710 366
331 3300050511 nmdc:mga08y16_242178_c1 nmdc:mga08y16_242178_c1_696_1805 366
332 3300053086 Ga0500578_0000529 Ga0500578_0000529_13054_14163 366
333 3300053092 Ga0500583_0000016 Ga0500583_0000016_26439_27548 366
334 3300053092 Ga0500583_0002224 Ga0500583_0002224_4392_5501 366
335 3300053131 Ga0500652_013545 Ga0500652_013545_649_1758 366
336 3300053177 Ga0500636_0071166 Ga0500636_0071166_689_1798 366
337 3300003323 rootH1_10068539 rootH1_100685392 367
338 3300005367 Ga0070667_100029335 Ga0070667_1000293352 367
339 3300005456 Ga0070678_100135429 Ga0070678_1001354292 367
340 3300005458 Ga0070681_10054584 Ga0070681_100545842 367
341 3300005539 Ga0068853_100011415 Ga0068853_1000114154 367
342 3300005577 Ga0068857_100060623 Ga0068857_1000606232 367
343 3300005614 Ga0068856_100139980 Ga0068856_1001399802 367
344 3300006237 Ga0097621_100002197 Ga0097621_1000021972 367
345 3300006358 Ga0068871_100042419 Ga0068871_1000424192 367
346 3300009093 Ga0105240_10000533 Ga0105240_1000053322 367
347 3300009093 Ga0105240_10002479 Ga0105240_1000247921 367
348 3300009174 Ga0105241_10168800 Ga0105241_101688001 367
349 3300009545 Ga0105237_10041939 Ga0105237_100419392 367
350 3300010375 Ga0105239_10001651 Ga0105239_1000165118 367
351 3300010375 Ga0105239_10001753 Ga0105239_100017537 367
352 3300013105 Ga0157369_10322953 Ga0157369_103229532 367
353 3300013297 Ga0157378_10056227 Ga0157378_100562272 367
354 3300013306 Ga0163162_10006485 Ga0163162_100064855 367
355 3300013308 Ga0157375_10000073 Ga0157375_1000007375 367
356 3300014968 Ga0157379_10070411 Ga0157379_100704112 367
357 3300014969 Ga0157376_10003045 Ga0157376_100030452 367
358 3300014969 Ga0157376_10277759 Ga0157376_102777592 367
359 3300017792 Ga0163161_10008498 Ga0163161_100084982 367
360 3300025903 Ga0207680_10082876 Ga0207680_100828762 367
361 3300025912 Ga0207707_10042220 Ga0207707_100422202 367
362 3300025913 Ga0207695_10000632 Ga0207695_1000063229 367
363 3300025913 Ga0207695_10002023 Ga0207695_100020238 367
364 3300025914 Ga0207671_10112435 Ga0207671_101124352 367
365 3300025940 Ga0207691_10075497 Ga0207691_100754972 367
366 3300026041 Ga0207639_10023282 Ga0207639_100232822 367
367 3300026116 Ga0207674_10037559 Ga0207674_100375592 367
368 3300026116 Ga0207674_10287226 Ga0207674_102872262 367
369 3300026121 Ga0207683_10108668 Ga0207683_101086682 367
370 3300026142 Ga0207698_10126739 Ga0207698_101267392 367
371 3300030521 Ga0307511_10007489 Ga0307511_100074896 367
372 3300031730 Ga0307516_10022409 Ga0307516_100224092 367
373 3300042876 Ga0451577_0020626 Ga0451577_0020626_1889_3001 367
374 3300044712 Ga0453684_0482226 Ga0453684_0482226_143_1255 367
375 3300044842 Ga0466957_0002003 Ga0466957_0002003_6800_7912 367
376 3300047472 Ga0495686_0000004 Ga0495686_0000004_64798_65934 367
377 3300048903 Ga0496100_0012425 Ga0496100_0012425_3469_4587 367
378 3300053090 Ga0500646_0007214 Ga0500646_0007214_681_1799 367
379 3300053090 Ga0500646_0011254 Ga0500646_0011254_529_1641 367
380 3300005563 Ga0068855_100342844 Ga0068855_1003428442 368
381 3300006237 Ga0097621_100364317 Ga0097621_1003643171 368
382 3300009545 Ga0105237_10001411 Ga0105237_1000141113 368
383 3300013307 Ga0157372_10000644 Ga0157372_100006441 368
384 3300014969 Ga0157376_10000719 Ga0157376_100007192 368
385 3300025949 Ga0207667_10293843 Ga0207667_102938432 368
386 3300044693 Ga0466961_0047451 Ga0466961_0047451_440_1573 368
387 3300045049 Ga0466959_0008643 Ga0466959_0008643_2894_4027 368
388 3300045836 Ga0466958_0021588 Ga0466958_0021588_206_1339 368
389 3300003322 rootL2_10149466 rootL2_101494662 369
390 3300005327 Ga0070658_10000420 Ga0070658_1000042021 369
391 3300005328 Ga0070676_10002624 Ga0070676_100026242 369
392 3300005328 Ga0070676_10045884 Ga0070676_100458842 369
393 3300005331 Ga0070670_100208152 Ga0070670_1002081522 369
394 3300005333 Ga0070677_10015333 Ga0070677_100153332 369
395 3300005334 Ga0068869_100016050 Ga0068869_1000160502 369
396 3300005335 Ga0070666_10011763 Ga0070666_100117632 369
397 3300005338 Ga0068868_100000893 Ga0068868_1000008931 369
398 3300005338 Ga0068868_100023701 Ga0068868_1000237012 369
399 3300005340 Ga0070689_100287894 Ga0070689_1002878941 369
400 3300005347 Ga0070668_100000022 Ga0070668_10000002238 369
401 3300005353 Ga0070669_100022904 Ga0070669_1000229042 369
402 3300005354 Ga0070675_100237592 Ga0070675_1002375922 369
403 3300005364 Ga0070673_100000090 Ga0070673_10000009023 369
404 3300005364 Ga0070673_100050947 Ga0070673_1000509472 369
405 3300005366 Ga0070659_100081899 Ga0070659_1000818992 369
406 3300005367 Ga0070667_100001287 Ga0070667_1000012875 369
407 3300005367 Ga0070667_100043428 Ga0070667_1000434283 369
408 3300005458 Ga0070681_10011658 Ga0070681_100116583 369
409 3300005459 Ga0068867_100002488 Ga0068867_10000248812 369
410 3300005539 Ga0068853_100015986 Ga0068853_1000159862 369
411 3300005539 Ga0068853_100063391 Ga0068853_1000633912 369
412 3300005543 Ga0070672_100000149 Ga0070672_10000014919 369
413 3300005543 Ga0070672_100017178 Ga0070672_1000171782 369
414 3300005548 Ga0070665_100001508 Ga0070665_1000015089 369
415 3300005548 Ga0070665_100024189 Ga0070665_1000241893 369
416 3300005578 Ga0068854_100063703 Ga0068854_1000637032 369
417 3300005618 Ga0068864_100000404 Ga0068864_10000040421 369
418 3300005834 Ga0068851_10001594 Ga0068851_100015944 369
419 3300005834 Ga0068851_10068330 Ga0068851_100683302 369
420 3300005841 Ga0068863_100000216 Ga0068863_10000021641 369
421 3300005842 Ga0068858_100001050 Ga0068858_10000105022 369
422 3300005843 Ga0068860_100028010 Ga0068860_1000280102 369
423 3300006237 Ga0097621_100000622 Ga0097621_1000006223 369
424 3300006237 Ga0097621_100036764 Ga0097621_1000367642 369
425 3300006358 Ga0068871_100000381 Ga0068871_10000038114 369
426 3300006358 Ga0068871_100106785 Ga0068871_1001067852 369
427 3300006881 Ga0068865_100002023 Ga0068865_1000020236 369
428 3300009093 Ga0105240_10009104 Ga0105240_1000910412 369
429 3300009174 Ga0105241_10001664 Ga0105241_100016642 369
430 3300009176 Ga0105242_10013970 Ga0105242_100139705 369
431 3300009176 Ga0105242_10033000 Ga0105242_100330002 369
432 3300013104 Ga0157370_10003524 Ga0157370_1000352424 369
433 3300013297 Ga0157378_10037019 Ga0157378_100370192 369
434 3300013306 Ga0163162_10143626 Ga0163162_101436262 369
435 3300014325 Ga0163163_10003589 Ga0163163_100035892 369
436 3300014968 Ga0157379_10275745 Ga0157379_102757452 369
437 3300017792 Ga0163161_10016255 Ga0163161_100162552 369
438 3300025321 Ga0207656_10002932 Ga0207656_100029322 369
439 3300025901 Ga0207688_10004641 Ga0207688_100046414 369
440 3300025907 Ga0207645_10004561 Ga0207645_100045614 369
441 3300025907 Ga0207645_10006815 Ga0207645_100068155 369
442 3300025908 Ga0207643_10023285 Ga0207643_100232852 369
443 3300025909 Ga0207705_10015209 Ga0207705_100152095 369
444 3300025911 Ga0207654_10008473 Ga0207654_100084735 369
445 3300025912 Ga0207707_10000508 Ga0207707_1000050811 369
446 3300025913 Ga0207695_10040957 Ga0207695_100409574 369
447 3300025917 Ga0207660_10002757 Ga0207660_100027574 369
448 3300025921 Ga0207652_10001607 Ga0207652_100016074 369
449 3300025925 Ga0207650_10001678 Ga0207650_1000167812 369
450 3300025933 Ga0207706_10025520 Ga0207706_100255205 369
451 3300025933 Ga0207706_10038722 Ga0207706_100387222 369
452 3300025934 Ga0207686_10027589 Ga0207686_100275892 369
453 3300025940 Ga0207691_10000113 Ga0207691_1000011343 369
454 3300025940 Ga0207691_10012590 Ga0207691_100125903 369
455 3300025942 Ga0207689_10006964 Ga0207689_100069642 369
456 3300025942 Ga0207689_10025569 Ga0207689_100255692 369
457 3300025949 Ga0207667_10108051 Ga0207667_101080512 369
458 3300025960 Ga0207651_10000313 Ga0207651_100003132 369
459 3300025960 Ga0207651_10024772 Ga0207651_100247721 369
460 3300025972 Ga0207668_10005826 Ga0207668_100058265 369
461 3300025981 Ga0207640_10026322 Ga0207640_100263222 369
462 3300025986 Ga0207658_10001468 Ga0207658_100014689 369
463 3300026035 Ga0207703_10000316 Ga0207703_1000031616 369
464 3300026041 Ga0207639_10016281 Ga0207639_100162812 369
465 3300026041 Ga0207639_10177206 Ga0207639_101772062 369
466 3300026088 Ga0207641_10019872 Ga0207641_100198723 369
467 3300026089 Ga0207648_10002914 Ga0207648_1000291413 369
468 3300026089 Ga0207648_10034780 Ga0207648_100347802 369
469 3300026095 Ga0207676_10001587 Ga0207676_1000158714 369
470 3300026118 Ga0207675_100007098 Ga0207675_1000070983 369
471 3300026118 Ga0207675_100027432 Ga0207675_1000274322 369
472 3300026121 Ga0207683_10014909 Ga0207683_100149093 369
473 3300028379 Ga0268266_10006375 Ga0268266_100063753 369
474 3300028381 Ga0268264_10003015 Ga0268264_100030151 369
475 3300028381 Ga0268264_10049163 Ga0268264_100491632 369
476 3300036401 Ga0373937_0158894 Ga0373937_0158894_508_1653 369
477 3300044712 Ga0453684_0019544 Ga0453684_0019544_8095_9204 369
478 3300046691 Ga0495670_0061833 Ga0495670_0061833_560_1705 369
479 3300049582 Ga0501048_0035393 Ga0501048_0035393_2366_3511 369
480 3300049584 Ga0501068_0213893 Ga0501068_0213893_64_1209 369
481 3300049585 Ga0501069_0006684 Ga0501069_0006684_4258_5403 369
482 3300049589 Ga0501073_0058380 Ga0501073_0058380_1189_2334 369
483 3300049590 Ga0501074_0174662 Ga0501074_0174662_201_1346 369
484 3300049592 Ga0501076_0195832 Ga0501076_0195832_169_1314 369
485 3300049741 Ga0501079_0028834 Ga0501079_0028834_1511_2656 369
486 3300054114 Ga0501084_0065623 Ga0501084_0065623_1218_2363 369
487 3300005331 Ga0070670_100019651 Ga0070670_1000196512 370
488 3300005338 Ga0068868_100055111 Ga0068868_1000551113 370
489 3300005353 Ga0070669_100019244 Ga0070669_1000192444 370
490 3300005535 Ga0070684_100011218 Ga0070684_1000112187 370
491 3300005616 Ga0068852_100009530 Ga0068852_1000095302 370
492 3300005618 Ga0068864_100013085 Ga0068864_1000130855 370
493 3300005618 Ga0068864_100025792 Ga0068864_1000257922 370
494 3300005719 Ga0068861_100024652 Ga0068861_1000246522 370
495 3300005843 Ga0068860_100082463 Ga0068860_1000824632 370
496 3300006237 Ga0097621_100012799 Ga0097621_1000127992 370
497 3300006358 Ga0068871_100006299 Ga0068871_1000062997 370
498 3300009101 Ga0105247_10002595 Ga0105247_100025953 370
499 3300009176 Ga0105242_10044138 Ga0105242_100441382 370
500 3300009553 Ga0105249_10001211 Ga0105249_1000121110 370
501 3300009553 Ga0105249_10006996 Ga0105249_100069962 370
502 3300009553 Ga0105249_10196054 Ga0105249_101960542 370
503 3300013296 Ga0157374_10183585 Ga0157374_101835852 370
504 3300013306 Ga0163162_10000715 Ga0163162_100007152 370
505 3300013307 Ga0157372_10055124 Ga0157372_100551242 370
506 3300025900 Ga0207710_10002918 Ga0207710_100029185 370
507 3300025923 Ga0207681_10020575 Ga0207681_100205754 370
508 3300025942 Ga0207689_10009324 Ga0207689_100093244 370
509 3300025942 Ga0207689_10036067 Ga0207689_100360672 370
510 3300025942 Ga0207689_10100140 Ga0207689_101001402 370
511 3300025945 Ga0207679_10046793 Ga0207679_100467932 370
512 3300025961 Ga0207712_10003924 Ga0207712_100039242 370
513 3300025961 Ga0207712_10017543 Ga0207712_100175431 370
514 3300025972 Ga0207668_10033964 Ga0207668_100339642 370
515 3300025972 Ga0207668_10096016 Ga0207668_100960162 370
516 3300026023 Ga0207677_10115800 Ga0207677_101158002 370
517 3300026035 Ga0207703_10085260 Ga0207703_100852602 370
518 3300026041 Ga0207639_10079273 Ga0207639_100792731 370
519 3300026095 Ga0207676_10005296 Ga0207676_100052965 370
520 3300026095 Ga0207676_10119192 Ga0207676_101191921 370
521 3300026118 Ga0207675_100039964 Ga0207675_1000399643 370
522 3300026118 Ga0207675_100155714 Ga0207675_1001557142 370
523 3300044712 Ga0453684_0143615 Ga0453684_0143615_791_1903 370
524 3300005289 Ga0065704_10015639 Ga0065704_100156392 371
525 3300005295 Ga0065707_10120944 Ga0065707_101209442 371
526 3300005330 Ga0070690_100011351 Ga0070690_1000113515 371
527 3300005334 Ga0068869_100002715 Ga0068869_1000027156 371
528 3300005334 Ga0068869_100090531 Ga0068869_1000905312 371
529 3300005338 Ga0068868_100000524 Ga0068868_1000005247 371
530 3300005340 Ga0070689_100002023 Ga0070689_10000202310 371
531 3300005340 Ga0070689_100015940 Ga0070689_1000159402 371
532 3300005344 Ga0070661_100000686 Ga0070661_10000068623 371
533 3300005344 Ga0070661_100007626 Ga0070661_1000076262 371
534 3300005354 Ga0070675_100026579 Ga0070675_1000265794 371
535 3300005354 Ga0070675_100162190 Ga0070675_1001621902 371
536 3300005355 Ga0070671_100098257 Ga0070671_1000982572 371
537 3300005355 Ga0070671_100140796 Ga0070671_1001407962 371
538 3300005364 Ga0070673_100020477 Ga0070673_1000204772 371
539 3300005364 Ga0070673_100033690 Ga0070673_1000336902 371
540 3300005365 Ga0070688_100024153 Ga0070688_1000241532 371
541 3300005366 Ga0070659_100022425 Ga0070659_1000224254 371
542 3300005367 Ga0070667_100038988 Ga0070667_1000389882 371
543 3300005441 Ga0070700_100075668 Ga0070700_1000756682 371
544 3300005456 Ga0070678_100035043 Ga0070678_1000350432 371
545 3300005457 Ga0070662_100002459 Ga0070662_1000024592 371
546 3300005457 Ga0070662_100004469 Ga0070662_1000044694 371
547 3300005457 Ga0070662_100187733 Ga0070662_1001877331 371
548 3300005459 Ga0068867_100050830 Ga0068867_1000508303 371
549 3300005466 Ga0070685_10025882 Ga0070685_100258822 371
550 3300005471 Ga0070698_100001058 Ga0070698_10000105814 371
551 3300005471 Ga0070698_100005689 Ga0070698_1000056896 371
552 3300005535 Ga0070684_100000433 Ga0070684_1000004338 371
553 3300005535 Ga0070684_100080878 Ga0070684_1000808782 371
554 3300005547 Ga0070693_100108878 Ga0070693_1001088781 371
555 3300005548 Ga0070665_100044734 Ga0070665_1000447342 371
556 3300005577 Ga0068857_100019215 Ga0068857_1000192155 371
557 3300005578 Ga0068854_100010925 Ga0068854_1000109254 371
558 3300005578 Ga0068854_100041891 Ga0068854_1000418912 371
559 3300005616 Ga0068852_100001894 Ga0068852_1000018948 371
560 3300005616 Ga0068852_100034896 Ga0068852_1000348962 371
561 3300005616 Ga0068852_100242897 Ga0068852_1002428972 371
562 3300005617 Ga0068859_100003497 Ga0068859_10000349714 371
563 3300005617 Ga0068859_100131156 Ga0068859_1001311562 371
564 3300005618 Ga0068864_100003513 Ga0068864_1000035138 371
565 3300005618 Ga0068864_100009090 Ga0068864_1000090901 371
566 3300005618 Ga0068864_100062189 Ga0068864_1000621893 371
567 3300005718 Ga0068866_10074699 Ga0068866_100746992 371
568 3300005719 Ga0068861_100021699 Ga0068861_1000216992 371
569 3300005840 Ga0068870_10035171 Ga0068870_100351712 371
570 3300005841 Ga0068863_100056490 Ga0068863_1000564902 371
571 3300005842 Ga0068858_100049193 Ga0068858_1000491932 371
572 3300005842 Ga0068858_100314484 Ga0068858_1003144841 371
573 3300005843 Ga0068860_100139036 Ga0068860_1001390362 371
574 3300006163 Ga0070715_10070645 Ga0070715_100706451 371
575 3300006195 Ga0075366_10000644 Ga0075366_1000064412 371
576 3300006237 Ga0097621_100145813 Ga0097621_1001458132 371
577 3300006358 Ga0068871_100082226 Ga0068871_1000822261 371
578 3300006844 Ga0075428_100007201 Ga0075428_1000072014 371
579 3300006844 Ga0075428_100085955 Ga0075428_1000859552 371
580 3300006846 Ga0075430_100005834 Ga0075430_1000058342 371
581 3300006846 Ga0075430_100111490 Ga0075430_1001114902 371
582 3300006847 Ga0075431_100064466 Ga0075431_1000644662 371
583 3300006847 Ga0075431_100167818 Ga0075431_1001678182 371
584 3300006880 Ga0075429_100102421 Ga0075429_1001024212 371
585 3300006931 Ga0097620_100003497 Ga0097620_10000349714 371
586 3300006931 Ga0097620_100131153 Ga0097620_1001311532 371
587 3300009101 Ga0105247_10065814 Ga0105247_100658142 371
588 3300009147 Ga0114129_10675106 Ga0114129_106751062 371
589 3300009176 Ga0105242_10013557 Ga0105242_100135572 371
590 3300009176 Ga0105242_10445244 Ga0105242_104452442 371
591 3300009177 Ga0105248_10131762 Ga0105248_101317622 371
592 3300009553 Ga0105249_10001889 Ga0105249_100018891 371
593 3300009553 Ga0105249_10008699 Ga0105249_100086996 371
594 3300010375 Ga0105239_10048467 Ga0105239_100484672 371
595 3300013102 Ga0157371_10016957 Ga0157371_100169572 371
596 3300013102 Ga0157371_10047136 Ga0157371_100471363 371
597 3300013102 Ga0157371_10122235 Ga0157371_101222352 371
598 3300013296 Ga0157374_10020382 Ga0157374_100203822 371
599 3300013296 Ga0157374_10042988 Ga0157374_100429882 371
600 3300013296 Ga0157374_10057595 Ga0157374_100575953 371
601 3300013297 Ga0157378_10210785 Ga0157378_102107852 371
602 3300013306 Ga0163162_10001117 Ga0163162_1000111712 371
603 3300013306 Ga0163162_10011005 Ga0163162_100110052 371
604 3300013307 Ga0157372_10012213 Ga0157372_100122138 371
605 3300013307 Ga0157372_10051368 Ga0157372_100513682 371
606 3300013308 Ga0157375_10010656 Ga0157375_100106565 371
607 3300014325 Ga0163163_10000198 Ga0163163_1000019839 371
608 3300014325 Ga0163163_10279695 Ga0163163_102796952 371
609 3300014326 Ga0157380_10073825 Ga0157380_100738252 371
610 3300014745 Ga0157377_10002780 Ga0157377_100027802 371
611 3300014968 Ga0157379_10006544 Ga0157379_100065442 371
612 3300017792 Ga0163161_10006663 Ga0163161_100066632 371
613 3300025893 Ga0207682_10032510 Ga0207682_100325102 371
614 3300025899 Ga0207642_10074905 Ga0207642_100749052 371
615 3300025904 Ga0207647_10001371 Ga0207647_100013716 371
616 3300025904 Ga0207647_10016648 Ga0207647_100166482 371
617 3300025907 Ga0207645_10011044 Ga0207645_100110442 371
618 3300025908 Ga0207643_10042590 Ga0207643_100425902 371
619 3300025908 Ga0207643_10061636 Ga0207643_100616362 371
620 3300025914 Ga0207671_10126102 Ga0207671_101261022 371
621 3300025919 Ga0207657_10044566 Ga0207657_100445663 371
622 3300025920 Ga0207649_10001711 Ga0207649_100017116 371
623 3300025920 Ga0207649_10032408 Ga0207649_100324082 371
624 3300025925 Ga0207650_10069980 Ga0207650_100699802 371
625 3300025925 Ga0207650_10085597 Ga0207650_100855972 371
626 3300025926 Ga0207659_10012954 Ga0207659_100129542 371
627 3300025926 Ga0207659_10051000 Ga0207659_100510003 371
628 3300025926 Ga0207659_10129856 Ga0207659_101298562 371
629 3300025931 Ga0207644_10128783 Ga0207644_101287832 371
630 3300025932 Ga0207690_10022219 Ga0207690_100222192 371
631 3300025933 Ga0207706_10002489 Ga0207706_1000248913 371
632 3300025933 Ga0207706_10011208 Ga0207706_100112082 371
633 3300025933 Ga0207706_10066786 Ga0207706_100667862 371
634 3300025934 Ga0207686_10000957 Ga0207686_100009573 371
635 3300025934 Ga0207686_10046499 Ga0207686_100464992 371
636 3300025936 Ga0207670_10007585 Ga0207670_100075852 371
637 3300025938 Ga0207704_10014960 Ga0207704_100149602 371
638 3300025940 Ga0207691_10058596 Ga0207691_100585963 371
639 3300025940 Ga0207691_10104587 Ga0207691_101045872 371
640 3300025940 Ga0207691_10171201 Ga0207691_101712011 371
641 3300025942 Ga0207689_10007318 Ga0207689_100073184 371
642 3300025942 Ga0207689_10010988 Ga0207689_100109886 371
643 3300025942 Ga0207689_10094720 Ga0207689_100947202 371
644 3300025944 Ga0207661_10008012 Ga0207661_100080121 371
645 3300025945 Ga0207679_10292740 Ga0207679_102927402 371
646 3300025960 Ga0207651_10018844 Ga0207651_100188444 371
647 3300025960 Ga0207651_10304138 Ga0207651_103041381 371
648 3300025961 Ga0207712_10161304 Ga0207712_101613042 371
649 3300025981 Ga0207640_10011687 Ga0207640_100116874 371
650 3300025986 Ga0207658_10047273 Ga0207658_100472732 371
651 3300026023 Ga0207677_10003542 Ga0207677_100035422 371
652 3300026023 Ga0207677_10014262 Ga0207677_100142622 371
653 3300026041 Ga0207639_10069185 Ga0207639_100691852 371
654 3300026075 Ga0207708_10109127 Ga0207708_101091272 371
655 3300026088 Ga0207641_10149779 Ga0207641_101497792 371
656 3300026089 Ga0207648_10019640 Ga0207648_100196402 371
657 3300026089 Ga0207648_10368613 Ga0207648_103686131 371
658 3300026095 Ga0207676_10002542 Ga0207676_100025424 371
659 3300026095 Ga0207676_10070729 Ga0207676_100707293 371
660 3300026095 Ga0207676_10080892 Ga0207676_100808922 371
661 3300026095 Ga0207676_10086172 Ga0207676_100861722 371
662 3300026116 Ga0207674_10003090 Ga0207674_100030908 371
663 3300026116 Ga0207674_10048075 Ga0207674_100480752 371
664 3300026116 Ga0207674_10414143 Ga0207674_104141431 371
665 3300026118 Ga0207675_100042272 Ga0207675_1000422722 371
666 3300026121 Ga0207683_10187855 Ga0207683_101878551 371
667 3300026142 Ga0207698_10109750 Ga0207698_101097502 371
668 3300028379 Ga0268266_10063348 Ga0268266_100633482 371
669 3300028379 Ga0268266_10278251 Ga0268266_102782511 371
670 3300028381 Ga0268264_10217434 Ga0268264_102174342 371
671 3300032005 Ga0307411_10212178 Ga0307411_102121782 371
672 3300035410 Ga0373924_0004327 Ga0373924_0004327_914_2029 371
673 3300036401 Ga0373937_0006203 Ga0373937_0006203_3838_4953 371
674 3300042437 Ga0439444_0006971 Ga0439444_0006971_331_1446 371
675 3300046472 Ga0495580_0085514 Ga0495580_0085514_572_1687 371
676 3300046511 Ga0495608_0055996 Ga0495608_0055996_1163_2278 371
677 3300046559 Ga0495667_0089845 Ga0495667_0089845_235_1350 371
678 3300046663 Ga0495635_0048931 Ga0495635_0048931_52_1167 371
679 3300046675 Ga0495657_0034896 Ga0495657_0034896_881_1996 371
680 3300046689 Ga0495613_0127420 Ga0495613_0127420_173_1288 371
681 3300047444 Ga0495675_0094841 Ga0495675_0094841_276_1391 371
682 3300048913 Ga0496110_0060307 Ga0496110_0060307_832_1953 371
683 3300048918 Ga0496115_0136596 Ga0496115_0136596_119_1288 371
684 3300049568 Ga0501031_0004536 Ga0501031_0004536_5300_6415 371
685 3300049569 Ga0501032_0046480 Ga0501032_0046480_1056_2171 371
686 3300049571 Ga0501034_0003582 Ga0501034_0003582_2700_3815 371
687 3300049572 Ga0501036_0000630 Ga0501036_0000630_7015_8130 371
688 3300049572 Ga0501036_0001356 Ga0501036_0001356_4911_6026 371
689 3300049574 Ga0501038_0052718 Ga0501038_0052718_494_1609 371
690 3300049575 Ga0501039_0004101 Ga0501039_0004101_9079_10194 371
691 3300049579 Ga0501043_0013189 Ga0501043_0013189_4168_5283 371
692 3300049580 Ga0501046_0002967 Ga0501046_0002967_2969_4084 371
693 3300049581 Ga0501047_0004450 Ga0501047_0004450_4792_5907 371
694 3300049581 Ga0501047_0063759 Ga0501047_0063759_1609_2724 371
695 3300049583 Ga0501067_0009302 Ga0501067_0009302_3521_4636 371
696 3300049584 Ga0501068_0051628 Ga0501068_0051628_199_1314 371
697 3300049589 Ga0501073_0004829 Ga0501073_0004829_5438_6553 371
698 3300049590 Ga0501074_0010705 Ga0501074_0010705_5476_6591 371
699 3300049686 Ga0501257_019869 Ga0501257_019869_109_1227 371
700 3300049742 Ga0501080_0015066 Ga0501080_0015066_2449_3564 371
701 3300049744 Ga0501083_0007396 Ga0501083_0007396_1529_2644 371
702 3300049822 Ga0501035_0345990 Ga0501035_0345990_43_1158 371
703 3300049823 Ga0501044_0018446 Ga0501044_0018446_2431_3546 371
704 3300050508 nmdc:mga09592_18509_c1 nmdc:mga09592_18509_c1_4006_5121 371
705 3300050508 nmdc:mga09592_201507_c1 nmdc:mga09592_201507_c1_351_1508 371
706 3300050509 nmdc:mga0qj67_104414_c1 nmdc:mga0qj67_104414_c1_870_1985 371
707 3300050509 nmdc:mga0qj67_15330_c1 nmdc:mga0qj67_15330_c1_447_1604 371
708 3300050510 nmdc:mga06r32_290716_c1 nmdc:mga06r32_290716_c1_189_1304 371
709 3300050510 nmdc:mga06r32_71915_c1 nmdc:mga06r32_71915_c1_344_1501 371
710 2162886011 MRS1b_contig_6871026 MRS1b_0734.00002180 372
711 3300005290 Ga0065712_10003751 Ga0065712_100037512 372
712 3300005293 Ga0065715_10094189 Ga0065715_100941892 372
713 3300005295 Ga0065707_10120092 Ga0065707_101200922 372
714 3300005331 Ga0070670_100037766 Ga0070670_1000377662 372
715 3300005334 Ga0068869_100020039 Ga0068869_1000200392 372
716 3300005347 Ga0070668_100017587 Ga0070668_1000175872 372
717 3300005347 Ga0070668_100135721 Ga0070668_1001357212 372
718 3300005353 Ga0070669_100001361 Ga0070669_1000013612 372
719 3300005354 Ga0070675_100003755 Ga0070675_1000037552 372
720 3300005364 Ga0070673_100002901 Ga0070673_1000029012 372
721 3300005365 Ga0070688_100001271 Ga0070688_1000012718 372
722 3300005438 Ga0070701_10022436 Ga0070701_100224362 372
723 3300005457 Ga0070662_100047909 Ga0070662_1000479093 372
724 3300005459 Ga0068867_100007461 Ga0068867_1000074612 372
725 3300005543 Ga0070672_100123302 Ga0070672_1001233021 372
726 3300005564 Ga0070664_100138697 Ga0070664_1001386971 372
727 3300005577 Ga0068857_100012899 Ga0068857_1000128995 372
728 3300005577 Ga0068857_100218327 Ga0068857_1002183272 372
729 3300005578 Ga0068854_100187242 Ga0068854_1001872422 372
730 3300005617 Ga0068859_100034072 Ga0068859_1000340724 372
731 3300005617 Ga0068859_100165913 Ga0068859_1001659131 372
732 3300005719 Ga0068861_100038509 Ga0068861_1000385092 372
733 3300005840 Ga0068870_10001231 Ga0068870_100012312 372
734 3300005844 Ga0068862_100011534 Ga0068862_1000115342 372
735 3300006931 Ga0097620_100034071 Ga0097620_1000340714 372
736 3300006931 Ga0097620_100165908 Ga0097620_1001659081 372
737 3300009176 Ga0105242_10012123 Ga0105242_100121232 372
738 3300009553 Ga0105249_10007483 Ga0105249_100074832 372
739 3300009553 Ga0105249_10283979 Ga0105249_102839791 372
740 3300013307 Ga0157372_10587001 Ga0157372_105870011 372
741 3300013308 Ga0157375_10015188 Ga0157375_100151882 372
742 3300013308 Ga0157375_10068627 Ga0157375_100686271 372
743 3300013308 Ga0157375_10078529 Ga0157375_100785292 372
744 3300014326 Ga0157380_10014447 Ga0157380_100144474 372
745 3300014745 Ga0157377_10006792 Ga0157377_100067922 372
746 3300025908 Ga0207643_10002391 Ga0207643_100023918 372
747 3300025918 Ga0207662_10067885 Ga0207662_100678852 372
748 3300025923 Ga0207681_10003164 Ga0207681_100031648 372
749 3300025933 Ga0207706_10013718 Ga0207706_100137182 372
750 3300025933 Ga0207706_10019228 Ga0207706_100192282 372
751 3300025936 Ga0207670_10014800 Ga0207670_100148003 372
752 3300025940 Ga0207691_10168417 Ga0207691_101684171 372
753 3300025942 Ga0207689_10051709 Ga0207689_100517092 372
754 3300025942 Ga0207689_10119221 Ga0207689_101192212 372
755 3300025945 Ga0207679_10089928 Ga0207679_100899282 372
756 3300025949 Ga0207667_10376757 Ga0207667_103767571 372
757 3300025961 Ga0207712_10001108 Ga0207712_100011085 372
758 3300025961 Ga0207712_10098500 Ga0207712_100985002 372
759 3300025972 Ga0207668_10039980 Ga0207668_100399802 372
760 3300025981 Ga0207640_10114839 Ga0207640_101148391 372
761 3300025986 Ga0207658_10320060 Ga0207658_103200601 372
762 3300026041 Ga0207639_10295584 Ga0207639_102955841 372
763 3300026088 Ga0207641_10034018 Ga0207641_100340181 372
764 3300026089 Ga0207648_10005321 Ga0207648_100053217 372
765 3300026116 Ga0207674_10014288 Ga0207674_100142882 372
766 3300026116 Ga0207674_10244073 Ga0207674_102440732 372
767 3300026118 Ga0207675_100016213 Ga0207675_1000162132 372
768 3300026121 Ga0207683_10394655 Ga0207683_103946551 372
769 3300028380 Ga0268265_10022442 Ga0268265_100224422 372
770 3300037471 Ga0395905_0077497 Ga0395905_0077497_1767_2957 372
771 3300039437 Ga0436365_1726582 Ga0436365_1726582_7300_8490 372
772 3300049652 Ga0501202_000050 Ga0501202_000050_6578_7705 372
773 3300049654 Ga0501207_000735 Ga0501207_000735_1454_2581 372
774 3300049661 Ga0501217_000079 Ga0501217_000079_6086_7213 372
775 3300049663 Ga0501223_000157 Ga0501223_000157_3659_4786 372
776 3300049669 Ga0501235_000643 Ga0501235_000643_1156_2283 372
777 3300049681 Ga0501251_000677 Ga0501251_000677_750_1877 372
778 3300049686 Ga0501257_010955 Ga0501257_010955_238_1365 372
779 3300049688 Ga0501259_000566 Ga0501259_000566_2517_3644 372
780 3300049690 Ga0501261_000336 Ga0501261_000336_184_1311 372
781 3300049704 Ga0501221_000123 Ga0501221_000123_2149_3276 372
782 3300049705 Ga0501225_0000570 Ga0501225_0000570_2714_3841 372
783 3300049707 Ga0501234_001234 Ga0501234_001234_1631_2758 372
784 3300049708 Ga0501245_000180 Ga0501245_000180_1185_2312 372

Structural Annotation

Top 5 Hits

ID Description Score Start End
6h3i-assembly1.cif.gz_F structural snapshots of the type 9 protein translocon 0.6741 23 361
4fqe-assembly1.cif.gz_A kdgm porin 0.674 71 363
4fqe-assembly1.cif.gz_A kdgm porin 0.6673 71 363
6h3i-assembly1.cif.gz_F structural snapshots of the type 9 protein translocon 0.6484 23 361
4ctd-assembly1.cif.gz_B x-ray structure of an engineered ompg loop6-deletion 0.6471 67 360
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.674 71 363 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6673 71 363 2.40.160.40
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6471 67 360 2.40.160.40
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6355 67 360 2.40.160.40
5ne2A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6271 325 368 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A3C0HC27-F1-model_v4 PorV/PorQ family protein 0.9215 17 366
AF-A0A3C0HC27-F1-model_v4 PorV/PorQ family protein 0.9114 17 366
AF-A0A4P8RW40-F1-model_v4 PorV/PorQ family protein 0.8873 17 361
AF-A0A2D8C3P7-F1-model_v4 PorV/PorQ family protein 0.8858 17 371
AF-M7XJP6-F1-model_v4 DUF5723 domain-containing protein 0.8829 75 372

Feature Viewer

pLDDT pTM Quality
80.26 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map