F480673

General Info

Members Datasets Scaffolds Average Seq Length
783 435 631 514

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0078484|Ga0495657_0078484_477_2102
Length 509
Sequence MNGIDGGIGVVELSRLQFALTALYHFLFVPLTLGLSVILAIMESVYVMTGRRIWRDITMFWGILFTMEFQFGTNWSYYSHYVGDVFGAPLAIEGLMAFFLEATFIGLFFFGWDRLSKPGHLAVTWCVAFGSNFSALWILIANAWMQHPVGSRFNPETMRMEVTDFFAVLFNPVAQSKFVHTVSAGYVTGSVFVLAISAWYLLRGRHLEIARRSMTVAASFGLASALSVVVLGDESGYETTQNQKMKLAAMEAMWHTEPAPAPFTIFGLPDQKERVTHARIQIPWALGLIATRSISQPVPGISELVEQAKGRIRQGIEAYTAVQQLRRNPKDDAARRALDARQDDLGYAMLLRRYVDDPAKATEPQIEQAATLFWSFRLMVGLGFYFIALFAVMFYVAARRQLDRRRWLLRLAFYSLPLPWIRQPWIIEGVLPTFLAASPVPVWNVWISLLGFVLFYTVLLVVDLYLMIKYARLGPTETWEVPDMATRHAPPGGMVVDRETLHPHPRPAE

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
3 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
4 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
5 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
6 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
10 2561511199 Enterobacter sp. R4-368 Isolate Nodule
11 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
44 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
45 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
46 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
47 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
48 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
49 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
50 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
51 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
64 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
65 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
66 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
67 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
68 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
69 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
70 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
71 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
72 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
73 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
74 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
75 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
76 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
77 2751185917 Enterobacter sp. HK169 Isolate Unclassified
78 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
79 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
80 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
81 2775507074 Klebsiella sp. D5A Isolate Unclassified
82 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
83 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
84 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
85 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
86 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
87 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
88 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
89 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
90 2821118458 Enterobacter asburiae 609 Isolate Unclassified
91 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
92 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
93 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
94 2847085930 Erwinia persicina B64 Isolate Bulb
95 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
96 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
97 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
98 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
99 2865014394 Pantoea sp. R-71966 Isolate Unclassified
100 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
101 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
102 2876601092 Pantoea endophytica 596 Isolate Unclassified
103 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
104 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
105 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
106 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
107 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
108 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
109 2904504865 Serratia marcescens 1822 Isolate Unclassified
110 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
111 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
112 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
113 2919150387 Rahnella aceris 1817 Isolate Unclassified
114 2919675420 Luteimonas terrae 4099 Isolate Unclassified
115 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
116 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
117 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
118 2927143783 Rahnella sp. 2050 Isolate Unclassified
119 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
120 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
121 2937539931 Pantoea sp. LS15 Isolate Unclassified
122 2937967321 Serratia sp. YC16 Isolate Unclassified
123 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
124 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
125 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
126 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
127 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
128 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
129 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
130 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
131 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
132 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
133 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
134 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
135 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
136 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
137 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
138 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
139 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
140 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
141 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
142 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
143 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
144 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
145 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
146 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
147 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
148 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
149 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
150 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
151 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
152 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
153 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
154 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
155 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
156 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
157 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
158 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
159 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
160 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
161 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
162 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
163 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
164 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
165 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
166 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
167 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
168 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
169 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
170 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
171 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
172 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
173 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
174 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
175 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
176 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
177 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
178 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
179 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
180 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
181 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
182 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
183 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
184 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
186 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
187 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
188 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
189 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
190 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
191 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
192 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
193 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
194 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
195 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
196 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
197 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
198 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
199 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
200 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
201 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
202 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
203 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
204 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
205 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
206 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
207 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
208 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
209 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
210 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
211 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
212 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
213 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
214 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
215 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
216 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
217 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
218 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
219 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
220 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
221 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
222 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
228 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
229 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
231 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
232 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
233 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
234 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
265 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
266 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
267 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
268 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
269 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
270 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
271 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
272 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
273 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
274 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
275 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
276 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
277 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
278 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
279 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
280 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
281 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
282 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
283 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
284 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
285 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
286 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
288 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
292 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
300 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
303 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
304 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
305 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
306 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
307 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
308 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
309 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
310 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
311 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
312 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
313 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
314 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
315 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
316 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
317 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
318 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
319 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
322 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
323 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
324 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
325 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
329 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
330 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
331 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
332 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
333 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
334 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
341 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
342 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
343 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
346 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
347 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
351 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
359 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
364 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
365 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
379 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
380 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
381 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
382 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
383 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
384 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
385 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
386 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
387 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
388 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
389 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
390 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
391 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
392 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
402 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
403 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
404 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
407 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
408 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
409 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
410 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
411 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
413 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
418 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
419 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 640753048 Serratia proteamaculans 568 Isolate Endosphere
423 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
424 8004592986 Serratia sp. S119 Isolate Unclassified
425 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
426 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
427 8018221730 Enterobacter sp. CM29 Isolate Unclassified
428 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
429 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
430 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
431 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
432 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
433 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
434 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
435 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.95
Metatranscriptomes 0.64
Isolates 19.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.51
Bulb 0.13
Endosphere 4.34
Nodule 1.15
Rhizoplane 10.6
Rhizosphere 63.35
Stem 0.13
Stem Tuber 0.77
Unclassified 19.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C5844 2010549000 Bacteria 1941
2 JGI25162J39368_1000003 3300002737 Bacteria 575218
3 JGI25163J39215_1000007 3300002771 Bacteria 113612
4 JGI25164J39214_1000014 3300002772 Bacteria 219691
5 JGI25152J39213_1000329 3300002773 Bacteria 30338
6 JGI25153J46596_10003384 3300003215 Bacteria 8945
7 rootH2_10019625 3300003320 Bacteria 6208
8 Ga0055538_1000005 3300003751 Bacteria 575218
9 Ga0055539_1000007 3300003752 Bacteria 575218
10 Ga0055533_1000009 3300003756 Bacteria 575218
11 Ga0055525_1000010 3300003759 Bacteria 575218
12 Ga0055541_1000005 3300003841 Bacteria 575218
13 Ga0058692_1000808 3300003856 Bacteria 12462
14 Ga0058692_1003490 3300003856 Bacteria 4847
15 Ga0065704_10001970 3300005289 Bacteria 12114
16 Ga0065704_10002600 3300005289 Bacteria 4957
17 Ga0065707_10082478 3300005295 Bacteria 14636
18 Ga0070690_100019111 3300005330 Bacteria 4153
19 Ga0070670_100028503 3300005331 Bacteria 4806
20 Ga0070666_10027464 3300005335 Bacteria 3728
21 Ga0070666_10030479 3300005335 Bacteria 3554
22 Ga0070680_100000408 3300005336 Bacteria 29300
23 Ga0070689_100066496 3300005340 Bacteria 2808
24 Ga0070668_100009230 3300005347 Bacteria 7314
25 Ga0070671_100002529 3300005355 Bacteria 14159
26 Ga0070671_100047551 3300005355 Bacteria 3567
27 Ga0070659_100007694 3300005366 Bacteria 7836
28 Ga0070659_100121494 3300005366 Bacteria 2116
29 Ga0070667_100000043 3300005367 Bacteria 167034
30 Ga0070667_100019370 3300005367 Bacteria 5645
31 Ga0070667_100069642 3300005367 Bacteria 2994
32 Ga0070709_10000184 3300005434 Bacteria 39762
33 Ga0070709_10108031 3300005434 Bacteria 1866
34 Ga0070713_100000882 3300005436 Bacteria 19204
35 Ga0070678_100002323 3300005456 Bacteria 10385
36 Ga0070681_10000003 3300005458 Bacteria 252785
37 Ga0070685_10061141 3300005466 Bacteria 2205
38 Ga0070679_100000541 3300005530 Bacteria 32093
39 Ga0070684_100036941 3300005535 Bacteria 4188
40 Ga0068853_100002126 3300005539 Bacteria 14738
41 Ga0070686_100007898 3300005544 Bacteria 5949
42 Ga0070665_100000199 3300005548 Bacteria 105924
43 Ga0070665_100010430 3300005548 Bacteria 9401
44 Ga0070665_100015224 3300005548 Bacteria 7721
45 Ga0068855_100000006 3300005563 Bacteria 298092
46 Ga0068855_100021482 3300005563 Bacteria 7741
47 Ga0068855_100233370 3300005563 Bacteria 2059
48 Ga0070664_100001502 3300005564 Bacteria 18596
49 Ga0068857_100106500 3300005577 Bacteria 2518
50 Ga0068856_100000182 3300005614 Bacteria 65421
51 Ga0068856_100000276 3300005614 Bacteria 55917
52 Ga0068852_100020529 3300005616 Bacteria 5254
53 Ga0068859_100027497 3300005617 Bacteria 5705
54 Ga0068864_100038174 3300005618 Bacteria 4100
55 Ga0068863_100001860 3300005841 Bacteria 20979
56 Ga0068858_100009966 3300005842 Bacteria 9022
57 Ga0068858_100107818 3300005842 Bacteria 2600
58 Ga0068860_100000185 3300005843 Bacteria 99579
59 Ga0068860_100004398 3300005843 Bacteria 14394
60 Ga0068860_100037638 3300005843 Bacteria 4631
61 Ga0068860_100160076 3300005843 Bacteria 2170
62 Ga0075364_10023775 3300006051 Bacteria 3882
63 Ga0075364_10034360 3300006051 Bacteria 3270
64 Ga0070715_10002694 3300006163 Bacteria 5506
65 Ga0070715_10043688 3300006163 Bacteria 1891
66 Ga0070712_100000026 3300006175 Bacteria 77190
67 Ga0070712_100020697 3300006175 Bacteria 4307
68 Ga0075366_10004030 3300006195 Bacteria 7854
69 Ga0097621_100008048 3300006237 Bacteria 7567
70 Ga0068871_100056797 3300006358 Bacteria 3183
71 Ga0075434_100072903 3300006871 Bacteria 3426
72 Ga0068865_100016921 3300006881 Bacteria 4678
73 Ga0075436_100000063 3300006914 Bacteria 64417
74 Ga0075436_100055880 3300006914 Bacteria 2727
75 Ga0097620_100027497 3300006931 Bacteria 5705
76 Ga0079104_1001292 3300006946 Bacteria 17270
77 Ga0079104_1019879 3300006946 Bacteria 1864
78 Ga0075435_100126749 3300007076 Bacteria 2134
79 Ga0105251_10001518 3300009011 Bacteria 19945
80 Ga0105251_10038629 3300009011 Bacteria 2338
81 Ga0105251_10066205 3300009011 Bacteria 1689
82 Ga0105244_10000006 3300009036 Bacteria 357997
83 Ga0105244_10002108 3300009036 Bacteria 15294
84 Ga0105244_10005410 3300009036 Bacteria 8495
85 Ga0105244_10050345 3300009036 Bacteria 2125
86 Ga0105250_10000003 3300009092 Bacteria 547770
87 Ga0105250_10000026 3300009092 Bacteria 213233
88 Ga0105250_10000861 3300009092 Bacteria 17902
89 Ga0105250_10000873 3300009092 Bacteria 17814
90 Ga0105250_10002960 3300009092 Bacteria 8266
91 Ga0105250_10015489 3300009092 Bacteria 3122
92 Ga0105250_10017877 3300009092 Bacteria 2879
93 Ga0105250_10038056 3300009092 Bacteria 1930
94 Ga0105240_10000287 3300009093 Bacteria 98443
95 Ga0105240_10000357 3300009093 Bacteria 85936
96 Ga0105240_10005351 3300009093 Bacteria 19146
97 Ga0105240_10015450 3300009093 Bacteria 10381
98 Ga0105240_10021990 3300009093 Bacteria 8472
99 Ga0105245_10005574 3300009098 Bacteria 11064
100 Ga0105245_10011980 3300009098 Bacteria 7540
101 Ga0105247_10001108 3300009101 Bacteria 20064
102 Ga0105247_10005233 3300009101 Bacteria 8192
103 Ga0105241_10025051 3300009174 Bacteria 4433
104 Ga0105241_10078213 3300009174 Bacteria 2584
105 Ga0105242_10026325 3300009176 Bacteria 4609
106 Ga0105242_10090268 3300009176 Bacteria 2577
107 Ga0105248_10021653 3300009177 Bacteria 7120
108 Ga0105248_10071852 3300009177 Bacteria 3888
109 Ga0105237_10154950 3300009545 Bacteria 2288
110 Ga0105238_10014086 3300009551 Bacteria 8085
111 Ga0105238_10018343 3300009551 Bacteria 7121
112 Ga0105238_10027731 3300009551 Bacteria 5773
113 Ga0105239_10012041 3300010375 Bacteria 9644
114 Ga0105239_10027113 3300010375 Bacteria 6307
115 Ga0105246_10002049 3300011119 Bacteria 12146
116 Ga0105246_10007027 3300011119 Bacteria 6890
117 Ga0157373_10001277 3300013100 Bacteria 19254
118 Ga0157373_10002523 3300013100 Bacteria 13935
119 Ga0157373_10003329 3300013100 Bacteria 12140
120 Ga0157373_10016116 3300013100 Bacteria 5455
121 Ga0157371_10000167 3300013102 Bacteria 95585
122 Ga0157371_10001411 3300013102 Bacteria 25041
123 Ga0157371_10001794 3300013102 Bacteria 21713
124 Ga0157371_10004005 3300013102 Bacteria 13051
125 Ga0157370_10000093 3300013104 Bacteria 101308
126 Ga0157370_10003123 3300013104 Bacteria 19615
127 Ga0157370_10008772 3300013104 Bacteria 10869
128 Ga0157370_10029417 3300013104 Bacteria 5391
129 Ga0157369_10001855 3300013105 Bacteria 25533
130 Ga0157369_10082534 3300013105 Bacteria 3438
131 Ga0157374_10005805 3300013296 Bacteria 10426
132 Ga0163162_10012254 3300013306 Bacteria 8367
133 Ga0163162_10064722 3300013306 Bacteria 3701
134 Ga0163162_10099014 3300013306 Bacteria 3006
135 Ga0163162_10108326 3300013306 Bacteria 2874
136 Ga0157372_10006015 3300013307 Bacteria 12885
137 Ga0157372_10008044 3300013307 Bacteria 11213
138 Ga0157372_10068022 3300013307 Bacteria 4004
139 Ga0157372_10074215 3300013307 Bacteria 3835
140 Ga0157372_10092567 3300013307 Bacteria 3439
141 Ga0157375_10021458 3300013308 Bacteria 5923
142 Ga0163163_10076754 3300014325 Bacteria 3337
143 Ga0157379_10009588 3300014968 Bacteria 8433
144 Ga0157379_10010119 3300014968 Bacteria 8224
145 Ga0157379_10012676 3300014968 Bacteria 7368
146 Ga0157379_10015107 3300014968 Bacteria 6772
147 Ga0157379_10045788 3300014968 Bacteria 3905
148 Ga0182006_1000063 3300015261 Bacteria 154042
149 Ga0182005_1014557 3300015265 Bacteria 2200
150 Ga0183366_1001 3300015679 Bacteria 2743932
151 Ga0183370_1001 3300015680 Bacteria 2743932
152 Ga0183369_1001 3300015685 Bacteria 2743932
153 Ga0183368_1001 3300015687 Bacteria 2743932
154 Ga0213876_10000095 3300021384 Bacteria 99902
155 Ga0209760_100001 3300025207 Bacteria 348781
156 Ga0209784_100001 3300025224 Bacteria 3600592
157 Ga0209566_100001 3300025225 Bacteria 3600765
158 Ga0209674_100002 3300025226 Bacteria 3600592
159 Ga0209563_100008 3300025230 Bacteria 1554545
160 Ga0207427_100002 3300025231 Bacteria 1355321
161 Ga0209437_100007 3300025233 Bacteria 938377
162 Ga0209437_100185 3300025233 Bacteria 126819
163 Ga0209677_100004 3300025253 Bacteria 1554545
164 Ga0209129_1000015 3300025258 Bacteria 487967
165 Ga0209233_1015805 3300025261 Bacteria 2092
166 Ga0209025_1000585 3300025294 Bacteria 66076
167 Ga0209758_1000036 3300025297 Bacteria 441671
168 Ga0209758_1003539 3300025297 Bacteria 14062
169 Ga0207696_1000003 3300025711 Bacteria 860639
170 Ga0207696_1000004 3300025711 Bacteria 671626
171 Ga0207696_1000059 3300025711 Bacteria 245763
172 Ga0207696_1000328 3300025711 Bacteria 50336
173 Ga0207696_1000489 3300025711 Bacteria 33338
174 Ga0207696_1000746 3300025711 Bacteria 21687
175 Ga0207696_1000997 3300025711 Bacteria 17032
176 Ga0207696_1001808 3300025711 Bacteria 11035
177 Ga0207655_1000001 3300025728 Bacteria 1866413
178 Ga0207655_1000023 3300025728 Bacteria 467070
179 Ga0207655_1000032 3300025728 Bacteria 391253
180 Ga0207655_1000042 3300025728 Bacteria 333039
181 Ga0207655_1000105 3300025728 Bacteria 182927
182 Ga0207655_1000157 3300025728 Bacteria 124885
183 Ga0207655_1003248 3300025728 Bacteria 12205
184 Ga0207655_1016317 3300025728 Bacteria 4071
185 Ga0207713_1000001 3300025735 Bacteria 2295391
186 Ga0207713_1000005 3300025735 Bacteria 649958
187 Ga0207713_1000006 3300025735 Bacteria 586163
188 Ga0207713_1000021 3300025735 Bacteria 353108
189 Ga0207713_1003470 3300025735 Bacteria 10734
190 Ga0207713_1004111 3300025735 Bacteria 9588
191 Ga0207713_1006063 3300025735 Bacteria 7452
192 Ga0207713_1013428 3300025735 Bacteria 4316
193 Ga0207710_10005583 3300025900 Bacteria 5412
194 Ga0207680_10000006 3300025903 Bacteria 635950
195 Ga0207680_10002749 3300025903 Bacteria 8227
196 Ga0207680_10043528 3300025903 Bacteria 2634
197 Ga0207699_10000223 3300025906 Bacteria 32867
198 Ga0207707_10000001 3300025912 Bacteria 1212482
199 Ga0207695_10000004 3300025913 Bacteria 1288665
200 Ga0207695_10001005 3300025913 Bacteria 49964
201 Ga0207695_10004444 3300025913 Bacteria 19118
202 Ga0207695_10081311 3300025913 Bacteria 3279
203 Ga0207693_10000099 3300025915 Bacteria 77197
204 Ga0207693_10000334 3300025915 Bacteria 43371
205 Ga0207660_10001780 3300025917 Bacteria 14415
206 Ga0207652_10000736 3300025921 Bacteria 31695
207 Ga0207694_10000014 3300025924 Bacteria 374435
208 Ga0207644_10058010 3300025931 Bacteria 2796
209 Ga0207690_10091469 3300025932 Bacteria 2151
210 Ga0207709_10012460 3300025935 Bacteria 4683
211 Ga0207711_10008066 3300025941 Bacteria 8814
212 Ga0207711_10041351 3300025941 Bacteria 3925
213 Ga0207689_10096362 3300025942 Bacteria 2430
214 Ga0207667_10000051 3300025949 Bacteria 233836
215 Ga0207667_10027232 3300025949 Bacteria 6227
216 Ga0207667_10112822 3300025949 Bacteria 2803
217 Ga0207658_10000192 3300025986 Bacteria 65509
218 Ga0207658_10033089 3300025986 Bacteria 3685
219 Ga0207658_10066340 3300025986 Bacteria 2714
220 Ga0207703_10051597 3300026035 Bacteria 3334
221 Ga0207703_10077994 3300026035 Bacteria 2751
222 Ga0207639_10001724 3300026041 Bacteria 14726
223 Ga0207639_10014959 3300026041 Bacteria 5467
224 Ga0207702_10000148 3300026078 Bacteria 81831
225 Ga0207702_10004501 3300026078 Bacteria 12371
226 Ga0207702_10036005 3300026078 Bacteria 4139
227 Ga0207641_10000177 3300026088 Bacteria 88140
228 Ga0207641_10067045 3300026088 Bacteria 3073
229 Ga0207676_10008293 3300026095 Bacteria 7385
230 Ga0207674_10002213 3300026116 Bacteria 24638
231 Ga0207683_10034312 3300026121 Bacteria 4409
232 Ga0209281_1000021 3300027111 Bacteria 541033
233 Ga0209281_1000041 3300027111 Bacteria 347825
234 Ga0209281_1000085 3300027111 Bacteria 252561
235 Ga0209281_1000291 3300027111 Bacteria 91918
236 Ga0209281_1000817 3300027111 Bacteria 28172
237 Ga0209371_1000001 3300027312 Bacteria 2771503
238 Ga0209371_1000010 3300027312 Bacteria 922021
239 Ga0209371_1000047 3300027312 Bacteria 304732
240 Ga0209371_1000590 3300027312 Bacteria 32510
241 Ga0209371_1000803 3300027312 Bacteria 25942
242 Ga0209371_1001366 3300027312 Bacteria 16868
243 Ga0209371_1001830 3300027312 Bacteria 13172
244 Ga0209371_1011312 3300027312 Bacteria 2659
245 Ga0268266_10006560 3300028379 Bacteria 10639
246 Ga0268264_10000088 3300028381 Bacteria 235344
247 Ga0265334_10002838 3300028573 Bacteria 7977
248 Ga0265318_10000031 3300028577 Bacteria 146035
249 Ga0265318_10006809 3300028577 Bacteria 5226
250 Ga0265318_10009576 3300028577 Bacteria 4252
251 Ga0265338_10000006 3300028800 Bacteria 570804
252 Ga0265338_10005866 3300028800 Bacteria 15841
253 Ga0265338_10013556 3300028800 Bacteria 9186
254 Ga0265338_10015294 3300028800 Bacteria 8445
255 Ga0268256_1000001 3300030500 Bacteria 2771065
256 Ga0268256_1000022 3300030500 Bacteria 531115
257 Ga0268256_1000270 3300030500 Bacteria 53886
258 Ga0268256_1000514 3300030500 Bacteria 32518
259 Ga0268256_1000671 3300030500 Bacteria 25942
260 Ga0268256_1001116 3300030500 Bacteria 17468
261 Ga0268256_1001173 3300030500 Bacteria 16868
262 Ga0265330_10004426 3300031235 Bacteria 7132
263 Ga0265328_10008679 3300031239 Bacteria 4174
264 Ga0265328_10011367 3300031239 Bacteria 3559
265 Ga0265328_10011823 3300031239 Bacteria 3482
266 Ga0265320_10001142 3300031240 Bacteria 19529
267 Ga0265325_10000003 3300031241 Bacteria 370490
268 Ga0265325_10003681 3300031241 Bacteria 9926
269 Ga0265325_10005413 3300031241 Bacteria 7882
270 Ga0265325_10007971 3300031241 Bacteria 6287
271 Ga0265329_10005285 3300031242 Bacteria 5238
272 Ga0265340_10002162 3300031247 Bacteria 11273
273 Ga0265340_10022680 3300031247 Bacteria 3208
274 Ga0265339_10001397 3300031249 Bacteria 17979
275 Ga0265339_10012298 3300031249 Bacteria 5229
276 Ga0265339_10017287 3300031249 Bacteria 4276
277 Ga0265339_10024291 3300031249 Bacteria 3494
278 Ga0265339_10049844 3300031249 Bacteria 2291
279 Ga0265331_10000141 3300031250 Bacteria 94896
280 Ga0265331_10001884 3300031250 Bacteria 14788
281 Ga0265331_10002109 3300031250 Bacteria 13711
282 Ga0265331_10005803 3300031250 Bacteria 7396
283 Ga0265331_10007523 3300031250 Bacteria 6295
284 Ga0265331_10012128 3300031250 Bacteria 4684
285 Ga0265327_10000076 3300031251 Bacteria 212272
286 Ga0265316_10011748 3300031344 Bacteria 7876
287 Ga0265316_10151872 3300031344 Bacteria 1734
288 Ga0307513_10084284 3300031456 Bacteria 3265
289 Ga0307509_10000022 3300031507 Bacteria 247822
290 Ga0307509_10145012 3300031507 Bacteria 2302
291 Ga0265313_10000365 3300031595 Bacteria 49111
292 Ga0265313_10000745 3300031595 Bacteria 33374
293 Ga0265313_10001646 3300031595 Bacteria 20705
294 Ga0265313_10003952 3300031595 Bacteria 11666
295 Ga0265313_10004103 3300031595 Bacteria 11341
296 Ga0265313_10005442 3300031595 Bacteria 9371
297 Ga0265313_10014638 3300031595 Bacteria 4622
298 Ga0265313_10040965 3300031595 Bacteria 2285
299 Ga0265314_10004456 3300031711 Bacteria 12996
300 Ga0265314_10010811 3300031711 Bacteria 7589
301 Ga0265314_10056460 3300031711 Bacteria 2702
302 Ga0265342_10003917 3300031712 Bacteria 11954
303 Ga0265342_10005490 3300031712 Bacteria 9645
304 Ga0265342_10006956 3300031712 Bacteria 8359
305 Ga0265342_10008325 3300031712 Bacteria 7456
306 Ga0265342_10029181 3300031712 Bacteria 3428
307 Ga0316576_10010831 3300031727 Bacteria 5944
308 Ga0316578_10000385 3300031728 Bacteria 14147
309 Ga0316578_10032280 3300031728 Bacteria 2990
310 Ga0316577_10014017 3300031733 Bacteria 4396
311 Ga0316577_10018169 3300031733 Bacteria 3886
312 Ga0316577_10043630 3300031733 Bacteria 2509
313 Ga0316593_10005918 3300032168 Bacteria 3266
314 Ga0307510_10000008 3300033180 Bacteria 433990
315 Ga0316592_1006238 3300033524 Bacteria 2290
316 Ga0316588_1003379 3300033528 Bacteria 2905
317 Ga0316596_1000856 3300033541 Bacteria 5700
318 Ga0316596_1021055 3300033541 Bacteria 1660
319 Ga0373934_0009038 3300035086 Bacteria 3726
320 Ga0373936_0011864 3300035113 Bacteria 3306
321 Ga0316574_0008426 3300035398 Bacteria 5723
322 Ga0316574_0014416 3300035398 Bacteria 4568
323 Ga0316574_0033639 3300035398 Bacteria 3120
324 Ga0316574_0044886 3300035398 Bacteria 2735
325 Ga0373931_0014449 3300035691 Bacteria 3860
326 Ga0373935_0106960 3300035692 Bacteria 1852
327 Ga0373927_0015239 3300035695 Bacteria 5080
328 Ga0373933_0134836 3300035724 Bacteria 1555
329 Ga0373937_0059076 3300036401 Bacteria 3524
330 Ga0316582_0017269 3300036647 Bacteria 4171
331 Ga0316582_0017380 3300036647 Bacteria 4161
332 Ga0316582_0049709 3300036647 Bacteria 2653
333 Ga0316584_0000079 3300036712 Bacteria 38059
334 Ga0316584_0016210 3300036712 Bacteria 5342
335 Ga0316584_0092213 3300036712 Bacteria 2268
336 Ga0395899_0010808 3300037312 Bacteria 6998
337 Ga0395905_0002859 3300037471 Bacteria 18881
338 Ga0400490_11094 3300038726 Bacteria 62810
339 Ga0400490_17222 3300038726 Bacteria 34532
340 Ga0400491_21474 3300038727 Bacteria 6670
341 Ga0400485_04923 3300038735 Bacteria 131311
342 Ga0400485_15585 3300038735 Bacteria 12852
343 Ga0400488_22325 3300038741 Bacteria 3722
344 Ga0400488_32056 3300038741 Bacteria 1770
345 Ga0400488_49339 3300038741 Bacteria 2420
346 Ga0400486_08699 3300038742 Bacteria 7367
347 Ga0400486_17653 3300038742 Bacteria 15574
348 Ga0400486_22493 3300038742 Bacteria 147980
349 Ga0400483_044668 3300039062 Bacteria 5549
350 Ga0400483_059624 3300039062 Bacteria 2119
351 Ga0400483_139193 3300039062 Bacteria 15235
352 Ga0400483_145468 3300039062 Bacteria 4222
353 Ga0400483_171382 3300039062 Bacteria 12054
354 Ga0400483_195420 3300039062 Bacteria 7506
355 Ga0400483_239719 3300039062 Bacteria 8876
356 Ga0400483_269989 3300039062 Bacteria 6782
357 Ga0400487_27800 3300039110 Bacteria 73851
358 Ga0400487_54161 3300039110 Bacteria 50571
359 Ga0436365_0727636 3300039437 Bacteria 99848
360 Ga0439438_000001 3300041405 Bacteria 1263568
361 Ga0439447_000496 3300041407 Bacteria 14645
362 Ga0439447_008932 3300041407 Bacteria 3073
363 Ga0439466_0000003 3300041411 Bacteria 486229
364 Ga0451853_3565153 3300041512 Bacteria 3395
365 Ga0439432_001341 3300042006 Bacteria 9318
366 Ga0439432_012730 3300042006 Bacteria 2871
367 Ga0439452_000001 3300042010 Bacteria 1725439
368 Ga0439452_000003 3300042010 Bacteria 942815
369 Ga0439452_000924 3300042010 Bacteria 13287
370 Ga0439463_001202 3300042016 Bacteria 6912
371 Ga0439463_002195 3300042016 Bacteria 5030
372 Ga0450907_002033 3300042146 Bacteria 4030
373 Ga0466981_0000098 3300044669 Bacteria 21564
374 Ga0453684_0000136 3300044712 Bacteria 323402
375 Ga0451576_0000025 3300045051 Bacteria 427980
376 Ga0495627_010254 3300046453 Bacteria 3413
377 Ga0495591_000009 3300046458 Bacteria 331626
378 Ga0495591_000011 3300046458 Bacteria 309685
379 Ga0495591_000080 3300046458 Bacteria 107876
380 Ga0495591_002337 3300046458 Bacteria 10682
381 Ga0495591_004267 3300046458 Bacteria 7075
382 Ga0495591_004770 3300046458 Bacteria 6487
383 Ga0495653_0013811 3300046463 Bacteria 6580
384 Ga0495650_0000016 3300046471 Bacteria 554693
385 Ga0495650_0000033 3300046471 Bacteria 412188
386 Ga0495650_0000153 3300046471 Bacteria 156161
387 Ga0495650_0000581 3300046471 Bacteria 51097
388 Ga0495650_0002020 3300046471 Bacteria 17796
389 Ga0495580_0002303 3300046472 Bacteria 16664
390 Ga0495605_0000142 3300046474 Bacteria 92755
391 Ga0495605_0001220 3300046474 Bacteria 17115
392 Ga0495605_0008951 3300046474 Bacteria 5640
393 Ga0495584_0017970 3300046491 Bacteria 3595
394 Ga0495585_0003413 3300046492 Bacteria 10750
395 Ga0495585_0012507 3300046492 Bacteria 4999
396 Ga0495596_0001342 3300046500 Bacteria 14166
397 Ga0495607_0000105 3300046501 Bacteria 88629
398 Ga0495607_0000677 3300046501 Bacteria 32941
399 Ga0495607_0010742 3300046501 Bacteria 6133
400 Ga0495583_0000322 3300046506 Bacteria 75510
401 Ga0495583_0000499 3300046506 Bacteria 56843
402 Ga0495583_0001458 3300046506 Bacteria 23876
403 Ga0495583_0001787 3300046506 Bacteria 20439
404 Ga0495606_0000206 3300046507 Bacteria 103708
405 Ga0495606_0000325 3300046507 Bacteria 82283
406 Ga0495606_0007320 3300046507 Bacteria 9929
407 Ga0495606_0013109 3300046507 Bacteria 6582
408 Ga0495606_0021350 3300046507 Bacteria 4743
409 Ga0495620_0000737 3300046515 Bacteria 20139
410 Ga0495620_0000959 3300046515 Bacteria 17764
411 Ga0495632_0000190 3300046519 Bacteria 62298
412 Ga0495632_0004112 3300046519 Bacteria 10020
413 Ga0495632_0006621 3300046519 Bacteria 7411
414 Ga0495632_0038297 3300046519 Bacteria 2429
415 Ga0495637_0000055 3300046520 Bacteria 99324
416 Ga0495637_0000591 3300046520 Bacteria 25893
417 Ga0495643_0007219 3300046522 Bacteria 7201
418 Ga0495644_0000933 3300046523 Bacteria 12146
419 Ga0495644_0005099 3300046523 Bacteria 5140
420 Ga0495648_0000219 3300046524 Bacteria 65619
421 Ga0495648_0004944 3300046524 Bacteria 11205
422 Ga0495648_0021358 3300046524 Bacteria 4484
423 Ga0495654_0000125 3300046530 Bacteria 85809
424 Ga0495654_0000493 3300046530 Bacteria 32495
425 Ga0495654_0000599 3300046530 Bacteria 28667
426 Ga0495654_0005581 3300046530 Bacteria 7283
427 Ga0495654_0031797 3300046530 Bacteria 2677
428 Ga0495587_0047848 3300046536 Bacteria 2535
429 Ga0495609_0000090 3300046538 Bacteria 106600
430 Ga0495597_0001470 3300046542 Bacteria 16895
431 Ga0495668_0010851 3300046616 Bacteria 5486
432 Ga0495668_0035552 3300046616 Bacteria 2792
433 Ga0495611_0000801 3300046648 Bacteria 17446
434 Ga0495611_0009172 3300046648 Bacteria 4178
435 Ga0495625_0000062 3300046660 Bacteria 176748
436 Ga0495625_0043223 3300046660 Bacteria 3269
437 Ga0495661_0000061 3300046665 Bacteria 130811
438 Ga0495661_0000123 3300046665 Bacteria 93482
439 Ga0495661_0003364 3300046665 Bacteria 11849
440 Ga0495661_0004215 3300046665 Bacteria 10445
441 Ga0495588_0010188 3300046674 Bacteria 4362
442 Ga0495657_0078484 3300046675 Bacteria 2140
443 Ga0495623_0026402 3300046679 Bacteria 3739
444 Ga0495671_0005016 3300046692 Bacteria 7798
445 Ga0495649_0004050 3300046694 Bacteria 9650
446 Ga0495649_0006368 3300046694 Bacteria 7346
447 Ga0495589_0004048 3300046794 Bacteria 7857
448 Ga0495660_0000007 3300046810 Bacteria 485295
449 Ga0495660_0000074 3300046810 Bacteria 108390
450 Ga0495660_0001740 3300046810 Bacteria 14519
451 Ga0495660_0047695 3300046810 Bacteria 2344
452 Ga0495674_0243851 3300047319 Bacteria 1480
453 Ga0495672_0000004 3300047320 Bacteria 631810
454 Ga0495672_0000012 3300047320 Bacteria 519975
455 Ga0495672_0007348 3300047320 Bacteria 8305
456 Ga0495676_0000042 3300047321 Bacteria 103741
457 Ga0495676_0030843 3300047321 Bacteria 4542
458 Ga0495683_0000194 3300047323 Bacteria 57773
459 Ga0495679_000027 3300047446 Bacteria 193794
460 Ga0495679_000032 3300047446 Bacteria 171636
461 Ga0495673_0000022 3300047469 Bacteria 544086
462 Ga0495673_0000023 3300047469 Bacteria 539904
463 Ga0495673_0000227 3300047469 Bacteria 83114
464 Ga0495673_0000813 3300047469 Bacteria 29294
465 Ga0495673_0001429 3300047469 Bacteria 19118
466 Ga0495673_0027138 3300047469 Bacteria 2729
467 Ga0495681_0000845 3300047470 Bacteria 23614
468 Ga0495686_0008307 3300047472 Bacteria 7634
469 Ga0495626_0000062 3300048091 Bacteria 143269
470 Ga0496100_0044163 3300048903 Bacteria 2853
471 Ga0496100_0069901 3300048903 Bacteria 2339
472 Ga0496100_0078246 3300048903 Bacteria 2226
473 Ga0496101_0000029 3300048904 Bacteria 198515
474 Ga0496101_0042580 3300048904 Bacteria 3241
475 Ga0496102_0016198 3300048905 Bacteria 6514
476 Ga0496102_0032078 3300048905 Bacteria 4718
477 Ga0496102_0093401 3300048905 Bacteria 2787
478 Ga0496103_0013659 3300048906 Bacteria 4817
479 Ga0496104_0001318 3300048907 Bacteria 21417
480 Ga0496104_0006179 3300048907 Bacteria 10518
481 Ga0496104_0043968 3300048907 Bacteria 4197
482 Ga0496104_0076869 3300048907 Bacteria 3180
483 Ga0496105_0011013 3300048908 Bacteria 7128
484 Ga0496105_0083802 3300048908 Bacteria 2633
485 Ga0496106_0102750 3300048909 Bacteria 2218
486 Ga0496107_0009155 3300048910 Bacteria 6865
487 Ga0496108_0012408 3300048911 Bacteria 6934
488 Ga0496108_0143290 3300048911 Bacteria 2059
489 Ga0496110_0020876 3300048913 Bacteria 5534
490 Ga0496111_0003616 3300048914 Bacteria 9585
491 Ga0496112_0017773 3300048915 Bacteria 6692
492 Ga0496112_0051738 3300048915 Bacteria 4029
493 Ga0496113_0015943 3300048916 Bacteria 5181
494 Ga0496113_0114002 3300048916 Bacteria 2107
495 Ga0496114_0004914 3300048917 Bacteria 10412
496 Ga0496114_0107403 3300048917 Bacteria 2388
497 Ga0496115_0015702 3300048918 Bacteria 5750
498 Ga0496115_0057491 3300048918 Bacteria 3129
499 Ga0496116_0000127 3300048919 Bacteria 158773
500 Ga0496116_0000226 3300048919 Bacteria 104792
501 Ga0496116_0000572 3300048919 Bacteria 49208
502 Ga0496116_0008821 3300048919 Bacteria 8686
503 Ga0496116_0014235 3300048919 Bacteria 6365
504 Ga0496116_0026596 3300048919 Bacteria 4227
505 Ga0496116_0057812 3300048919 Bacteria 2532
506 Ga0496117_0000004 3300048920 Bacteria 877131
507 Ga0496117_0000156 3300048920 Bacteria 145285
508 Ga0496117_0000180 3300048920 Bacteria 128746
509 Ga0496117_0005651 3300048920 Bacteria 13047
510 Ga0496117_0014392 3300048920 Bacteria 6819
511 Ga0496117_0020878 3300048920 Bacteria 5325
512 Ga0496118_0000005 3300048921 Bacteria 697350
513 Ga0496118_0000024 3300048921 Bacteria 385236
514 Ga0496118_0004392 3300048921 Bacteria 16755
515 Ga0496118_0007231 3300048921 Bacteria 11845
516 Ga0496118_0018065 3300048921 Bacteria 6382
517 Ga0496118_0072355 3300048921 Bacteria 2476
518 Ga0496118_0128651 3300048921 Bacteria 1631
519 Ga0496118_0140812 3300048921 Bacteria 1529
520 Ga0496119_0000524 3300048922 Bacteria 52149
521 Ga0496119_0002597 3300048922 Bacteria 19610
522 Ga0496119_0007945 3300048922 Bacteria 9439
523 Ga0496119_0016218 3300048922 Bacteria 5687
524 Ga0496119_0020185 3300048922 Bacteria 4868
525 Ga0496119_0057976 3300048922 Bacteria 2337
526 Ga0496120_0000009 3300048923 Bacteria 386727
527 Ga0496120_0000014 3300048923 Bacteria 323163
528 Ga0496120_0000043 3300048923 Bacteria 195584
529 Ga0496120_0001541 3300048923 Bacteria 27015
530 Ga0496120_0003009 3300048923 Bacteria 15982
531 Ga0496120_0003653 3300048923 Bacteria 13782
532 Ga0496120_0006066 3300048923 Bacteria 9389
533 Ga0496120_0008215 3300048923 Bacteria 7637
534 Ga0496120_0015232 3300048923 Bacteria 5082
535 Ga0496120_0027574 3300048923 Bacteria 3490
536 Ga0496120_0053641 3300048923 Bacteria 2289
537 Ga0496121_0000185 3300048924 Bacteria 138586
538 Ga0496121_0002628 3300048924 Bacteria 27099
539 Ga0496121_0002922 3300048924 Bacteria 25030
540 Ga0496121_0009103 3300048924 Bacteria 11490
541 Ga0496121_0015706 3300048924 Bacteria 7892
542 Ga0496121_0032053 3300048924 Bacteria 4785
543 Ga0496121_0110086 3300048924 Bacteria 2102
544 Ga0496122_0000013 3300048925 Bacteria 501039
545 Ga0496122_0000026 3300048925 Bacteria 360871
546 Ga0496122_0000667 3300048925 Bacteria 69054
547 Ga0496122_0000796 3300048925 Bacteria 60440
548 Ga0496122_0006414 3300048925 Bacteria 13516
549 Ga0496122_0010913 3300048925 Bacteria 9291
550 Ga0496122_0012528 3300048925 Bacteria 8429
551 Ga0496123_0000005 3300048926 Bacteria 658131
552 Ga0496123_0000010 3300048926 Bacteria 501039
553 Ga0496123_0000163 3300048926 Bacteria 133536
554 Ga0496123_0000599 3300048926 Bacteria 61266
555 Ga0496123_0000621 3300048926 Bacteria 59502
556 Ga0496123_0004145 3300048926 Bacteria 15498
557 Ga0496123_0004462 3300048926 Bacteria 14683
558 Ga0496123_0010990 3300048926 Bacteria 7912
559 Ga0496123_0018984 3300048926 Bacteria 5435
560 Ga0496123_0026914 3300048926 Bacteria 4296
561 Ga0496124_0000224 3300048927 Bacteria 110603
562 Ga0496124_0000259 3300048927 Bacteria 101764
563 Ga0496124_0002320 3300048927 Bacteria 25093
564 Ga0496124_0002333 3300048927 Bacteria 25044
565 Ga0496124_0004077 3300048927 Bacteria 17299
566 Ga0496124_0005214 3300048927 Bacteria 14755
567 Ga0496124_0010575 3300048927 Bacteria 9331
568 Ga0496124_0016619 3300048927 Bacteria 6983
569 Ga0496124_0047403 3300048927 Bacteria 3677
570 Ga0496124_0097027 3300048927 Bacteria 2393
571 Ga0496124_0097802 3300048927 Bacteria 2382
572 Ga0496125_0000016 3300048928 Bacteria 512512
573 Ga0496125_0000019 3300048928 Bacteria 474989
574 Ga0496126_0000680 3300048929 Bacteria 62501
575 Ga0496126_0002546 3300048929 Bacteria 24392
576 Ga0496126_0028193 3300048929 Bacteria 5353
577 Ga0496126_0052308 3300048929 Bacteria 3713
578 Ga0496126_0072648 3300048929 Bacteria 3059
579 Ga0495678_000043 3300049459 Bacteria 172593
580 Ga0495678_000828 3300049459 Bacteria 27727
581 Ga0495678_005192 3300049459 Bacteria 7281
582 Ga0495682_0000026 3300049460 Bacteria 144529
583 Ga0495682_0000096 3300049460 Bacteria 77498
584 Ga0495682_0009796 3300049460 Bacteria 3730
585 Ga0501032_0053161 3300049569 Bacteria 2728
586 Ga0501033_0009400 3300049570 Bacteria 7528
587 Ga0501033_0035651 3300049570 Bacteria 3729
588 Ga0501034_0217223 3300049571 Bacteria 1865
589 Ga0501036_0005174 3300049572 Bacteria 10546
590 Ga0501037_0091553 3300049573 Bacteria 2199
591 Ga0501038_0002891 3300049574 Bacteria 16020
592 Ga0501038_0007559 3300049574 Bacteria 10019
593 Ga0501039_0008375 3300049575 Bacteria 7878
594 Ga0501046_0000911 3300049580 Bacteria 28909
595 Ga0501047_0003232 3300049581 Bacteria 15448
596 Ga0501047_0007271 3300049581 Bacteria 10407
597 Ga0501047_0023442 3300049581 Bacteria 5925
598 Ga0501047_0033222 3300049581 Bacteria 4980
599 Ga0501048_0020709 3300049582 Bacteria 4821
600 Ga0501048_0045342 3300049582 Bacteria 3140
601 Ga0501067_0001068 3300049583 Bacteria 14777
602 Ga0501069_0002056 3300049585 Bacteria 10108
603 Ga0501069_0012736 3300049585 Bacteria 4477
604 Ga0501070_0000110 3300049586 Bacteria 72071
605 Ga0501070_0003063 3300049586 Bacteria 14557
606 Ga0501073_0067640 3300049589 Bacteria 2490
607 Ga0501074_0096593 3300049590 Bacteria 2115
608 Ga0501077_0066101 3300049593 Bacteria 2294
609 Ga0501079_0005199 3300049741 Bacteria 9673
610 Ga0501080_0064253 3300049742 Bacteria 3414
611 Ga0501080_0073449 3300049742 Bacteria 3182
612 Ga0501080_0188888 3300049742 Bacteria 1893
613 Ga0501083_0002409 3300049744 Bacteria 12787
614 Ga0501083_0020350 3300049744 Bacteria 4616
615 Ga0501035_0002718 3300049822 Bacteria 17190
616 Ga0501044_0001134 3300049823 Bacteria 31657
617 Ga0501044_0071185 3300049823 Bacteria 3536
618 Ga0501044_0150755 3300049823 Bacteria 2307
619 Ga0501044_0164241 3300049823 Bacteria 2195
620 nmdc:mga00v17_29080_c1 3300050491 Bacteria 3241
621 nmdc:mga00v17_5777_c1 3300050491 Bacteria 6536
622 nmdc:mga0n895_62253_c1 3300050512 Bacteria 3687
623 nmdc:mga08x19_26679_c1 3300050514 Bacteria 3605
624 nmdc:mga08x19_80_c1 3300050514 Bacteria 87696
625 Ga0495601_0036273 3300053077 Bacteria 3078
626 Ga0500583_0027435 3300053092 Bacteria 2458
627 Ga0500621_000001 3300053126 Bacteria 1049698
628 Ga0500637_0023296 3300053178 Bacteria 3384
629 Ga0501084_0052916 3300054114 Bacteria 3396
630 Ga0501082_0016188 3300060353 Bacteria 6418
631 Ga0501082_0050459 3300060353 Bacteria 3588

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0008375 Ga0501039_0008375_10_1440 444
2 3300047319 Ga0495674_0243851 Ga0495674_0243851_17_1447 459
3 3300048903 Ga0496100_0078246 Ga0496100_0078246_18_1466 462
4 3300048929 Ga0496126_0000680 Ga0496126_0000680_42129_43643 466
5 3300053077 Ga0495601_0036273 Ga0495601_0036273_1581_3062 467
6 3300035724 Ga0373933_0134836 Ga0373933_0134836_42_1505 470
7 3300028800 Ga0265338_10005866 Ga0265338_1000586611 473
8 3300025261 Ga0209233_1015805 Ga0209233_10158052 478
9 3300035086 Ga0373934_0009038 Ga0373934_0009038_951_2510 479
10 3300046675 Ga0495657_0078484 Ga0495657_0078484_477_2102 479
11 3300005366 Ga0070659_100007694 Ga0070659_1000076947 480
12 3300025932 Ga0207690_10091469 Ga0207690_100914692 480
13 3300048907 Ga0496104_0076869 Ga0496104_0076869_829_2373 480
14 3300049569 Ga0501032_0053161 Ga0501032_0053161_11_1561 480
15 3300049570 Ga0501033_0009400 Ga0501033_0009400_5365_6915 480
16 3300049572 Ga0501036_0005174 Ga0501036_0005174_3328_4878 480
17 3300049574 Ga0501038_0002891 Ga0501038_0002891_12722_14272 480
18 3300049580 Ga0501046_0000911 Ga0501046_0000911_6375_7925 480
19 3300049581 Ga0501047_0007271 Ga0501047_0007271_3432_4982 480
20 3300049582 Ga0501048_0045342 Ga0501048_0045342_1296_2846 480
21 3300049583 Ga0501067_0001068 Ga0501067_0001068_5669_7219 480
22 3300049585 Ga0501069_0002056 Ga0501069_0002056_5504_7054 480
23 3300049586 Ga0501070_0003063 Ga0501070_0003063_3201_4751 480
24 3300049590 Ga0501074_0096593 Ga0501074_0096593_186_1736 480
25 3300049744 Ga0501083_0020350 Ga0501083_0020350_1319_2869 480
26 3300031250 Ga0265331_10002109 Ga0265331_100021091 481
27 3300031251 Ga0265327_10000076 Ga0265327_100000765 481
28 3300038741 Ga0400488_32056 Ga0400488_32056_20_1474 483
29 3300046536 Ga0495587_0047848 Ga0495587_0047848_65_1621 488
30 3300046679 Ga0495623_0026402 Ga0495623_0026402_1109_2836 488
31 3300009176 Ga0105242_10026325 Ga0105242_100263255 489
32 3300049581 Ga0501047_0023442 Ga0501047_0023442_1909_3471 489
33 3300049589 Ga0501073_0067640 Ga0501073_0067640_724_2286 489
34 3300049742 Ga0501080_0064253 Ga0501080_0064253_1785_3347 489
35 3300049744 Ga0501083_0002409 Ga0501083_0002409_9444_11009 489
36 3300005367 Ga0070667_100000043 Ga0070667_10000004318 490
37 3300009092 Ga0105250_10038056 Ga0105250_100380562 490
38 3300009101 Ga0105247_10005233 Ga0105247_100052338 490
39 3300025900 Ga0207710_10005583 Ga0207710_100055837 490
40 3300025986 Ga0207658_10000192 Ga0207658_1000019218 490
41 3300038741 Ga0400488_49339 Ga0400488_49339_919_2394 490
42 3300049581 Ga0501047_0033222 Ga0501047_0033222_693_2252 490
43 3300005336 Ga0070680_100000408 Ga0070680_10000040812 491
44 3300005458 Ga0070681_10000003 Ga0070681_10000003217 491
45 3300005530 Ga0070679_100000541 Ga0070679_1000005418 491
46 3300005563 Ga0068855_100021482 Ga0068855_1000214828 491
47 3300009093 Ga0105240_10000287 Ga0105240_1000028746 491
48 3300009093 Ga0105240_10005351 Ga0105240_100053516 491
49 3300010375 Ga0105239_10012041 Ga0105239_100120417 491
50 3300025912 Ga0207707_10000001 Ga0207707_10000001836 491
51 3300025913 Ga0207695_10001005 Ga0207695_1000100531 491
52 3300025913 Ga0207695_10004444 Ga0207695_100044446 491
53 3300025917 Ga0207660_10001780 Ga0207660_100017803 491
54 3300025921 Ga0207652_10000736 Ga0207652_1000073619 491
55 3300025949 Ga0207667_10112822 Ga0207667_101128222 491
56 3300035398 Ga0316574_0044886 Ga0316574_0044886_817_2385 491
57 3300049581 Ga0501047_0003232 Ga0501047_0003232_1223_2773 491
58 3300025903 Ga0207680_10000006 Ga0207680_1000000628 493
59 3300031240 Ga0265320_10001142 Ga0265320_1000114212 493
60 3300031241 Ga0265325_10003681 Ga0265325_100036815 493
61 3300048923 Ga0496120_0000014 Ga0496120_0000014_270772_272382 493
62 3300048929 Ga0496126_0052308 Ga0496126_0052308_263_1837 493
63 3300028577 Ga0265318_10006809 Ga0265318_100068097 494
64 3300031250 Ga0265331_10007523 Ga0265331_100075234 494
65 3300031595 Ga0265313_10001646 Ga0265313_1000164610 494
66 3300031595 Ga0265313_10005442 Ga0265313_100054428 494
67 3300048921 Ga0496118_0140812 Ga0496118_0140812_20_1504 494
68 3300049570 Ga0501033_0035651 Ga0501033_0035651_1520_3049 494
69 3300049582 Ga0501048_0020709 Ga0501048_0020709_3195_4724 494
70 3300049823 Ga0501044_0071185 Ga0501044_0071185_69_1598 494
71 3300003215 JGI25153J46596_10003384 JGI25153J46596_100033846 495
72 3300025297 Ga0209758_1000036 Ga0209758_1000036390 495
73 3300031247 Ga0265340_10002162 Ga0265340_1000216211 495
74 3300031249 Ga0265339_10049844 Ga0265339_100498443 495
75 3300031344 Ga0265316_10151872 Ga0265316_101518721 495
76 3300031595 Ga0265313_10000365 Ga0265313_1000036549 495
77 3300031712 Ga0265342_10008325 Ga0265342_100083256 495
78 3300005434 Ga0070709_10000184 Ga0070709_1000018421 496
79 3300005434 Ga0070709_10108031 Ga0070709_101080312 496
80 3300005539 Ga0068853_100002126 Ga0068853_1000021262 496
81 3300005614 Ga0068856_100000182 Ga0068856_10000018225 496
82 3300005614 Ga0068856_100000276 Ga0068856_10000027651 496
83 3300005616 Ga0068852_100020529 Ga0068852_1000205292 496
84 3300006175 Ga0070712_100000026 Ga0070712_10000002634 496
85 3300006871 Ga0075434_100072903 Ga0075434_1000729032 496
86 3300006914 Ga0075436_100000063 Ga0075436_10000006349 496
87 3300006914 Ga0075436_100055880 Ga0075436_1000558803 496
88 3300007076 Ga0075435_100126749 Ga0075435_1001267492 496
89 3300009093 Ga0105240_10015450 Ga0105240_100154506 496
90 3300009551 Ga0105238_10014086 Ga0105238_100140865 496
91 3300013100 Ga0157373_10003329 Ga0157373_100033295 496
92 3300013104 Ga0157370_10029417 Ga0157370_100294172 496
93 3300025906 Ga0207699_10000223 Ga0207699_1000022331 496
94 3300025913 Ga0207695_10081311 Ga0207695_100813113 496
95 3300025915 Ga0207693_10000099 Ga0207693_1000009946 496
96 3300025949 Ga0207667_10027232 Ga0207667_100272325 496
97 3300026041 Ga0207639_10001724 Ga0207639_1000172417 496
98 3300026041 Ga0207639_10014959 Ga0207639_100149594 496
99 3300026078 Ga0207702_10000148 Ga0207702_1000014884 496
100 3300026078 Ga0207702_10004501 Ga0207702_1000450110 496
101 3300028577 Ga0265318_10009576 Ga0265318_100095764 496
102 3300028800 Ga0265338_10013556 Ga0265338_100135565 496
103 3300031239 Ga0265328_10011367 Ga0265328_100113674 496
104 3300031241 Ga0265325_10007971 Ga0265325_100079716 496
105 3300031242 Ga0265329_10005285 Ga0265329_100052854 496
106 3300031249 Ga0265339_10017287 Ga0265339_100172874 496
107 3300031250 Ga0265331_10001884 Ga0265331_1000188412 496
108 3300031344 Ga0265316_10011748 Ga0265316_100117484 496
109 3300031507 Ga0307509_10145012 Ga0307509_101450122 496
110 3300031595 Ga0265313_10014638 Ga0265313_100146384 496
111 3300031711 Ga0265314_10004456 Ga0265314_100044565 496
112 3300031711 Ga0265314_10056460 Ga0265314_100564602 496
113 3300031712 Ga0265342_10005490 Ga0265342_100054909 496
114 3300050512 nmdc:mga0n895_62253_c1 nmdc:mga0n895_62253_c1_1343_2896 496
115 3300050514 nmdc:mga08x19_26679_c1 nmdc:mga08x19_26679_c1_1287_2840 496
116 3300050514 nmdc:mga08x19_80_c1 nmdc:mga08x19_80_c1_8326_9879 496
117 3300053092 Ga0500583_0027435 Ga0500583_0027435_195_1760 496
118 3300005295 Ga0065707_10082478 Ga0065707_100824789 497
119 3300014968 Ga0157379_10010119 Ga0157379_100101193 497
120 3300031507 Ga0307509_10000022 Ga0307509_10000022170 497
121 3300053178 Ga0500637_0023296 Ga0500637_0023296_889_2430 497
122 3300031456 Ga0307513_10084284 Ga0307513_100842843 498
123 3300035691 Ga0373931_0014449 Ga0373931_0014449_1736_3304 498
124 3300005841 Ga0068863_100001860 Ga0068863_10000186022 499
125 3300005843 Ga0068860_100000185 Ga0068860_1000001853 499
126 3300025903 Ga0207680_10043528 Ga0207680_100435283 499
127 3300025986 Ga0207658_10066340 Ga0207658_100663403 499
128 3300026088 Ga0207641_10000177 Ga0207641_1000017744 499
129 3300028381 Ga0268264_10000088 Ga0268264_10000088115 499
130 3300031235 Ga0265330_10004426 Ga0265330_100044264 499
131 3300031247 Ga0265340_10022680 Ga0265340_100226803 499
132 3300031595 Ga0265313_10004103 Ga0265313_1000410313 499
133 3300031712 Ga0265342_10006956 Ga0265342_100069562 499
134 3300036647 Ga0316582_0017380 Ga0316582_0017380_2572_4143 499
135 3300044712 Ga0453684_0000136 Ga0453684_0000136_69599_71173 499
136 3300045051 Ga0451576_0000025 Ga0451576_0000025_356718_358292 499
137 3300048905 Ga0496102_0016198 Ga0496102_0016198_2338_3933 499
138 3300048920 Ga0496117_0000156 Ga0496117_0000156_23271_24866 499
139 3300048921 Ga0496118_0000005 Ga0496118_0000005_57692_59287 499
140 3300048923 Ga0496120_0027574 Ga0496120_0027574_1409_3004 499
141 3300048924 Ga0496121_0110086 Ga0496121_0110086_87_1682 499
142 3300049742 Ga0501080_0073449 Ga0501080_0073449_1134_2696 499
143 3300060353 Ga0501082_0016188 Ga0501082_0016188_4831_6393 499
144 3300005842 Ga0068858_100107818 Ga0068858_1001078183 500
145 3300009545 Ga0105237_10154950 Ga0105237_101549502 500
146 3300013296 Ga0157374_10005805 Ga0157374_100058055 500
147 3300014325 Ga0163163_10076754 Ga0163163_100767542 500
148 3300014968 Ga0157379_10045788 Ga0157379_100457883 500
149 3300025294 Ga0209025_1000585 Ga0209025_100058523 500
150 3300025297 Ga0209758_1003539 Ga0209758_10035399 500
151 3300025728 Ga0207655_1000023 Ga0207655_1000023170 500
152 3300025915 Ga0207693_10000334 Ga0207693_1000033418 500
153 3300026078 Ga0207702_10036005 Ga0207702_100360053 500
154 3300031239 Ga0265328_10011823 Ga0265328_100118234 500
155 3300048904 Ga0496101_0042580 Ga0496101_0042580_507_2066 500
156 3300049593 Ga0501077_0066101 Ga0501077_0066101_526_2088 500
157 3300005330 Ga0070690_100019111 Ga0070690_1000191112 501
158 3300005331 Ga0070670_100028503 Ga0070670_1000285032 501
159 3300005335 Ga0070666_10027464 Ga0070666_100274643 501
160 3300005335 Ga0070666_10030479 Ga0070666_100304793 501
161 3300005340 Ga0070689_100066496 Ga0070689_1000664962 501
162 3300005355 Ga0070671_100002529 Ga0070671_1000025294 501
163 3300005367 Ga0070667_100019370 Ga0070667_1000193704 501
164 3300005367 Ga0070667_100069642 Ga0070667_1000696423 501
165 3300005466 Ga0070685_10061141 Ga0070685_100611412 501
166 3300005535 Ga0070684_100036941 Ga0070684_1000369413 501
167 3300005544 Ga0070686_100007898 Ga0070686_1000078982 501
168 3300005548 Ga0070665_100010430 Ga0070665_1000104303 501
169 3300005548 Ga0070665_100015224 Ga0070665_1000152242 501
170 3300005564 Ga0070664_100001502 Ga0070664_1000015029 501
171 3300005617 Ga0068859_100027497 Ga0068859_1000274974 501
172 3300005618 Ga0068864_100038174 Ga0068864_1000381744 501
173 3300005843 Ga0068860_100004398 Ga0068860_1000043984 501
174 3300005843 Ga0068860_100160076 Ga0068860_1001600762 501
175 3300006237 Ga0097621_100008048 Ga0097621_1000080483 501
176 3300006358 Ga0068871_100056797 Ga0068871_1000567972 501
177 3300006931 Ga0097620_100027497 Ga0097620_1000274974 501
178 3300009098 Ga0105245_10005574 Ga0105245_100055749 501
179 3300009101 Ga0105247_10001108 Ga0105247_100011088 501
180 3300009177 Ga0105248_10021653 Ga0105248_100216533 501
181 3300009551 Ga0105238_10018343 Ga0105238_100183434 501
182 3300010375 Ga0105239_10027113 Ga0105239_100271134 501
183 3300011119 Ga0105246_10002049 Ga0105246_100020492 501
184 3300013306 Ga0163162_10012254 Ga0163162_100122543 501
185 3300013307 Ga0157372_10074215 Ga0157372_100742153 501
186 3300013308 Ga0157375_10021458 Ga0157375_100214584 501
187 3300014968 Ga0157379_10012676 Ga0157379_100126763 501
188 3300025931 Ga0207644_10058010 Ga0207644_100580102 501
189 3300025941 Ga0207711_10008066 Ga0207711_100080664 501
190 3300025941 Ga0207711_10041351 Ga0207711_100413513 501
191 3300025942 Ga0207689_10096362 Ga0207689_100963623 501
192 3300025986 Ga0207658_10033089 Ga0207658_100330894 501
193 3300026035 Ga0207703_10077994 Ga0207703_100779942 501
194 3300026088 Ga0207641_10067045 Ga0207641_100670452 501
195 3300026095 Ga0207676_10008293 Ga0207676_100082936 501
196 3300031239 Ga0265328_10008679 Ga0265328_100086795 501
197 3300031250 Ga0265331_10000141 Ga0265331_1000014134 501
198 3300035113 Ga0373936_0011864 Ga0373936_0011864_711_2321 501
199 3300048908 Ga0496105_0083802 Ga0496105_0083802_382_1926 501
200 3300048911 Ga0496108_0143290 Ga0496108_0143290_176_1753 501
201 3300048915 Ga0496112_0017773 Ga0496112_0017773_4457_6034 501
202 3300048916 Ga0496113_0015943 Ga0496113_0015943_1716_3293 501
203 3300048922 Ga0496119_0016218 Ga0496119_0016218_198_1769 501
204 3300048923 Ga0496120_0001541 Ga0496120_0001541_17879_19450 501
205 3300048927 Ga0496124_0002320 Ga0496124_0002320_15300_16871 501
206 3300005355 Ga0070671_100047551 Ga0070671_1000475514 502
207 3300005436 Ga0070713_100000882 Ga0070713_10000088211 502
208 3300005456 Ga0070678_100002323 Ga0070678_1000023234 502
209 3300005843 Ga0068860_100037638 Ga0068860_1000376383 502
210 3300006163 Ga0070715_10002694 Ga0070715_100026946 502
211 3300006175 Ga0070712_100020697 Ga0070712_1000206973 502
212 3300006881 Ga0068865_100016921 Ga0068865_1000169212 502
213 3300009093 Ga0105240_10021990 Ga0105240_100219905 502
214 3300009098 Ga0105245_10011980 Ga0105245_100119803 502
215 3300009174 Ga0105241_10025051 Ga0105241_100250512 502
216 3300009176 Ga0105242_10090268 Ga0105242_100902682 502
217 3300009177 Ga0105248_10071852 Ga0105248_100718523 502
218 3300014968 Ga0157379_10009588 Ga0157379_100095882 502
219 3300046472 Ga0495580_0002303 Ga0495580_0002303_13039_14598 502
220 3300048903 Ga0496100_0069901 Ga0496100_0069901_316_1875 502
221 3300048906 Ga0496103_0013659 Ga0496103_0013659_1195_2754 502
222 3300048910 Ga0496107_0009155 Ga0496107_0009155_782_2341 502
223 3300048911 Ga0496108_0012408 Ga0496108_0012408_4292_5851 502
224 3300048913 Ga0496110_0020876 Ga0496110_0020876_3059_4618 502
225 3300048914 Ga0496111_0003616 Ga0496111_0003616_790_2349 502
226 3300048915 Ga0496112_0051738 Ga0496112_0051738_69_1628 502
227 3300048916 Ga0496113_0114002 Ga0496113_0114002_517_2076 502
228 3300048917 Ga0496114_0107403 Ga0496114_0107403_642_2201 502
229 3300048918 Ga0496115_0015702 Ga0496115_0015702_4083_5642 502
230 3300025728 Ga0207655_1000042 Ga0207655_1000042291 503
231 3300026121 Ga0207683_10034312 Ga0207683_100343122 503
232 3300048907 Ga0496104_0043968 Ga0496104_0043968_1112_2689 503
233 3300048917 Ga0496114_0004914 Ga0496114_0004914_325_1902 503
234 3300048918 Ga0496115_0057491 Ga0496115_0057491_463_2040 503
235 3300048927 Ga0496124_0010575 Ga0496124_0010575_7746_9314 503
236 3300049573 Ga0501037_0091553 Ga0501037_0091553_153_1688 503
237 3300049574 Ga0501038_0007559 Ga0501038_0007559_6326_7861 503
238 3300049586 Ga0501070_0000110 Ga0501070_0000110_3237_4772 503
239 3300049823 Ga0501044_0001134 Ga0501044_0001134_26884_28419 503
240 3300049823 Ga0501044_0164241 Ga0501044_0164241_265_1800 503
241 3300003856 Ga0058692_1000808 Ga0058692_100080811 504
242 3300005347 Ga0070668_100009230 Ga0070668_1000092305 504
243 3300005563 Ga0068855_100000006 Ga0068855_10000000676 504
244 3300006163 Ga0070715_10043688 Ga0070715_100436882 504
245 3300009093 Ga0105240_10000357 Ga0105240_1000035725 504
246 3300009551 Ga0105238_10027731 Ga0105238_100277316 504
247 3300011119 Ga0105246_10007027 Ga0105246_100070272 504
248 3300013306 Ga0163162_10108326 Ga0163162_101083262 504
249 3300025711 Ga0207696_1000746 Ga0207696_100074615 504
250 3300025913 Ga0207695_10000004 Ga0207695_10000004787 504
251 3300025924 Ga0207694_10000014 Ga0207694_10000014168 504
252 3300025949 Ga0207667_10000051 Ga0207667_10000051138 504
253 3300027312 Ga0209371_1001830 Ga0209371_10018305 504
254 3300028573 Ga0265334_10002838 Ga0265334_100028384 504
255 3300028577 Ga0265318_10000031 Ga0265318_1000003169 504
256 3300028800 Ga0265338_10000006 Ga0265338_10000006396 504
257 3300028800 Ga0265338_10015294 Ga0265338_100152945 504
258 3300030500 Ga0268256_1001116 Ga0268256_100111610 504
259 3300031241 Ga0265325_10000003 Ga0265325_1000000340 504
260 3300031249 Ga0265339_10001397 Ga0265339_100013974 504
261 3300031250 Ga0265331_10012128 Ga0265331_100121287 504
262 3300031595 Ga0265313_10003952 Ga0265313_100039527 504
263 3300031711 Ga0265314_10010811 Ga0265314_100108117 504
264 3300031712 Ga0265342_10003917 Ga0265342_100039172 504
265 3300033180 Ga0307510_10000008 Ga0307510_1000000823 504
266 3300041407 Ga0439447_000496 Ga0439447_000496_8595_10166 504
267 3300041411 Ga0439466_0000003 Ga0439466_0000003_400618_402189 504
268 3300042016 Ga0439463_002195 Ga0439463_002195_2528_4099 504
269 3300042146 Ga0450907_002033 Ga0450907_002033_1529_3100 504
270 3300046522 Ga0495643_0007219 Ga0495643_0007219_5275_6846 504
271 3300046810 Ga0495660_0047695 Ga0495660_0047695_411_1982 504
272 3300047320 Ga0495672_0000012 Ga0495672_0000012_119817_121388 504
273 3300048908 Ga0496105_0011013 Ga0496105_0011013_1355_2926 504
274 3300048920 Ga0496117_0000180 Ga0496117_0000180_17102_18673 504
275 3300048921 Ga0496118_0018065 Ga0496118_0018065_4777_6348 504
276 3300048922 Ga0496119_0002597 Ga0496119_0002597_1841_3412 504
277 3300048923 Ga0496120_0003009 Ga0496120_0003009_12571_14142 504
278 3300048924 Ga0496121_0000185 Ga0496121_0000185_13259_14830 504
279 3300048927 Ga0496124_0004077 Ga0496124_0004077_36_1607 504
280 3300049460 Ga0495682_0009796 Ga0495682_0009796_1904_3469 504
281 3300049585 Ga0501069_0012736 Ga0501069_0012736_792_2354 504
282 3300049741 Ga0501079_0005199 Ga0501079_0005199_7632_9194 504
283 3300049742 Ga0501080_0188888 Ga0501080_0188888_275_1837 504
284 3300049822 Ga0501035_0002718 Ga0501035_0002718_10124_11686 504
285 3300049823 Ga0501044_0150755 Ga0501044_0150755_450_2012 504
286 3300054114 Ga0501084_0052916 Ga0501084_0052916_1433_2995 504
287 3300060353 Ga0501082_0050459 Ga0501082_0050459_449_2011 504
288 3300003856 Ga0058692_1003490 Ga0058692_10034903 505
289 3300006051 Ga0075364_10034360 Ga0075364_100343601 505
290 3300009011 Ga0105251_10038629 Ga0105251_100386292 505
291 3300009092 Ga0105250_10002960 Ga0105250_100029601 505
292 3300009092 Ga0105250_10015489 Ga0105250_100154893 505
293 3300013100 Ga0157373_10016116 Ga0157373_100161165 505
294 3300013102 Ga0157371_10001411 Ga0157371_1000141117 505
295 3300013105 Ga0157369_10082534 Ga0157369_100825345 505
296 3300013306 Ga0163162_10064722 Ga0163162_100647222 505
297 3300013307 Ga0157372_10092567 Ga0157372_100925675 505
298 3300025233 Ga0209437_100185 Ga0209437_100185119 505
299 3300025711 Ga0207696_1000003 Ga0207696_1000003615 505
300 3300025711 Ga0207696_1000328 Ga0207696_100032815 505
301 3300025728 Ga0207655_1003248 Ga0207655_10032485 505
302 3300025728 Ga0207655_1016317 Ga0207655_10163175 505
303 3300025735 Ga0207713_1000001 Ga0207713_1000001328 505
304 3300027312 Ga0209371_1000010 Ga0209371_1000010528 505
305 3300027312 Ga0209371_1000590 Ga0209371_100059033 505
306 3300027312 Ga0209371_1011312 Ga0209371_10113122 505
307 3300030500 Ga0268256_1000022 Ga0268256_1000022337 505
308 3300030500 Ga0268256_1000514 Ga0268256_100051433 505
309 3300031241 Ga0265325_10005413 Ga0265325_100054132 505
310 3300035692 Ga0373935_0106960 Ga0373935_0106960_150_1751 505
311 3300046458 Ga0495591_000080 Ga0495591_000080_83507_85078 505
312 3300046458 Ga0495591_002337 Ga0495591_002337_5121_6704 505
313 3300046471 Ga0495650_0000033 Ga0495650_0000033_8341_9924 505
314 3300046491 Ga0495584_0017970 Ga0495584_0017970_307_1890 505
315 3300046501 Ga0495607_0010742 Ga0495607_0010742_690_2273 505
316 3300046507 Ga0495606_0007320 Ga0495606_0007320_212_1795 505
317 3300046523 Ga0495644_0005099 Ga0495644_0005099_1731_3314 505
318 3300046524 Ga0495648_0004944 Ga0495648_0004944_5797_7380 505
319 3300046530 Ga0495654_0000125 Ga0495654_0000125_83498_85069 505
320 3300046530 Ga0495654_0000493 Ga0495654_0000493_18148_19731 505
321 3300046794 Ga0495589_0004048 Ga0495589_0004048_833_2416 505
322 3300046810 Ga0495660_0000074 Ga0495660_0000074_57664_59247 505
323 3300047320 Ga0495672_0000004 Ga0495672_0000004_163322_164905 505
324 3300047469 Ga0495673_0000023 Ga0495673_0000023_79332_80915 505
325 3300048903 Ga0496100_0044163 Ga0496100_0044163_169_1740 505
326 3300048904 Ga0496101_0000029 Ga0496101_0000029_196741_198312 505
327 3300048905 Ga0496102_0032078 Ga0496102_0032078_1347_2918 505
328 3300048909 Ga0496106_0102750 Ga0496106_0102750_339_1910 505
329 3300048919 Ga0496116_0026596 Ga0496116_0026596_1834_3405 505
330 3300048920 Ga0496117_0000004 Ga0496117_0000004_683983_685554 505
331 3300048921 Ga0496118_0000024 Ga0496118_0000024_192088_193659 505
332 3300048923 Ga0496120_0006066 Ga0496120_0006066_7804_9375 505
333 3300048925 Ga0496122_0010913 Ga0496122_0010913_5880_7451 505
334 3300048925 Ga0496122_0012528 Ga0496122_0012528_3160_4731 505
335 3300048926 Ga0496123_0004145 Ga0496123_0004145_2790_4361 505
336 3300048926 Ga0496123_0004462 Ga0496123_0004462_4461_6032 505
337 3300048927 Ga0496124_0005214 Ga0496124_0005214_8455_10026 505
338 3300048927 Ga0496124_0047403 Ga0496124_0047403_330_1901 505
339 3300048927 Ga0496124_0097802 Ga0496124_0097802_777_2348 505
340 3300048928 Ga0496125_0000016 Ga0496125_0000016_176596_178164 505
341 3300049459 Ga0495678_000828 Ga0495678_000828_2338_3921 505
342 3300049460 Ga0495682_0000026 Ga0495682_0000026_137101_138684 505
343 3300049571 Ga0501034_0217223 Ga0501034_0217223_10_1578 505
344 3300050491 nmdc:mga00v17_29080_c1 nmdc:mga00v17_29080_c1_406_1977 505
345 3300053126 Ga0500621_000001 Ga0500621_000001_500979_502562 505
346 3300009092 Ga0105250_10000003 Ga0105250_10000003287 506
347 3300025711 Ga0207696_1000004 Ga0207696_1000004346 506
348 3300031595 Ga0265313_10040965 Ga0265313_100409652 506
349 3300048922 Ga0496119_0020185 Ga0496119_0020185_3329_4849 506
350 3300031249 Ga0265339_10012298 Ga0265339_100122983 507
351 3300031250 Ga0265331_10005803 Ga0265331_100058036 507
352 3300031595 Ga0265313_10000745 Ga0265313_1000074519 507
353 3300031712 Ga0265342_10029181 Ga0265342_100291813 507
354 3300009092 Ga0105250_10000026 Ga0105250_10000026203 508
355 3300025711 Ga0207696_1000059 Ga0207696_100005929 508
356 3300025728 Ga0207655_1000105 Ga0207655_1000105153 508
357 3300025735 Ga0207713_1000005 Ga0207713_1000005132 508
358 3300025935 Ga0207709_10012460 Ga0207709_100124603 508
359 3300046471 Ga0495650_0002020 Ga0495650_0002020_13930_15471 508
360 3300048919 Ga0496116_0014235 Ga0496116_0014235_2757_4328 508
361 3300048923 Ga0496120_0053641 Ga0496120_0053641_483_2051 508
362 3300005563 Ga0068855_100233370 Ga0068855_1002333702 509
363 3300006946 Ga0079104_1001292 Ga0079104_10012927 509
364 3300025903 Ga0207680_10002749 Ga0207680_100027498 509
365 3300027111 Ga0209281_1000291 Ga0209281_10002919 509
366 3300031249 Ga0265339_10024291 Ga0265339_100242913 509
367 3300046458 Ga0495591_004770 Ga0495591_004770_3879_5423 509
368 3300046492 Ga0495585_0012507 Ga0495585_0012507_2528_4072 509
369 3300046501 Ga0495607_0000105 Ga0495607_0000105_30750_32294 509
370 3300046506 Ga0495583_0000322 Ga0495583_0000322_13475_15019 509
371 3300046507 Ga0495606_0000325 Ga0495606_0000325_14304_15848 509
372 3300046515 Ga0495620_0000959 Ga0495620_0000959_9995_11539 509
373 3300046519 Ga0495632_0006621 Ga0495632_0006621_1759_3303 509
374 3300046520 Ga0495637_0000055 Ga0495637_0000055_78282_79826 509
375 3300046523 Ga0495644_0000933 Ga0495644_0000933_7049_8593 509
376 3300046524 Ga0495648_0021358 Ga0495648_0021358_2662_4206 509
377 3300046530 Ga0495654_0000599 Ga0495654_0000599_11020_12564 509
378 3300046538 Ga0495609_0000090 Ga0495609_0000090_86939_88483 509
379 3300046648 Ga0495611_0000801 Ga0495611_0000801_11778_13322 509
380 3300046660 Ga0495625_0000062 Ga0495625_0000062_114806_116350 509
381 3300046665 Ga0495661_0000123 Ga0495661_0000123_34049_35593 509
382 3300046694 Ga0495649_0006368 Ga0495649_0006368_3484_5028 509
383 3300047320 Ga0495672_0007348 Ga0495672_0007348_6671_8215 509
384 3300047470 Ga0495681_0000845 Ga0495681_0000845_14730_16274 509
385 3300047472 Ga0495686_0008307 Ga0495686_0008307_4762_6306 509
386 3300048091 Ga0495626_0000062 Ga0495626_0000062_58909_60453 509
387 3300048905 Ga0496102_0093401 Ga0496102_0093401_695_2239 509
388 3300048925 Ga0496122_0000667 Ga0496122_0000667_3291_4835 509
389 3300048926 Ga0496123_0000163 Ga0496123_0000163_67769_69313 509
390 3300048927 Ga0496124_0000224 Ga0496124_0000224_98715_100259 509
391 3300049459 Ga0495678_005192 Ga0495678_005192_2512_4056 509
392 3300027312 Ga0209371_1000803 Ga0209371_100080318 510
393 3300030500 Ga0268256_1000671 Ga0268256_100067118 510
394 3300035398 Ga0316574_0014416 Ga0316574_0014416_858_2462 510
395 3300035695 Ga0373927_0015239 Ga0373927_0015239_41_1597 510
396 3300036401 Ga0373937_0059076 Ga0373937_0059076_1451_3007 510
397 3300036647 Ga0316582_0017269 Ga0316582_0017269_2122_3726 510
398 iso_pu_bacteria 2728368998 2728748887 510
399 iso_pu_bacteria 2919675420 2919678551 511
400 3300003320 rootH2_10019625 rootH2_100196252 512
401 3300005289 Ga0065704_10001970 Ga0065704_100019706 512
402 3300005289 Ga0065704_10002600 Ga0065704_100026001 512
403 3300005366 Ga0070659_100121494 Ga0070659_1001214942 512
404 3300005548 Ga0070665_100000199 Ga0070665_10000019947 512
405 3300005577 Ga0068857_100106500 Ga0068857_1001065002 512
406 3300006051 Ga0075364_10023775 Ga0075364_100237751 512
407 3300006195 Ga0075366_10004030 Ga0075366_100040306 512
408 3300006946 Ga0079104_1019879 Ga0079104_10198792 512
409 3300009036 Ga0105244_10050345 Ga0105244_100503452 512
410 3300009092 Ga0105250_10017877 Ga0105250_100178772 512
411 3300013104 Ga0157370_10008772 Ga0157370_100087725 512
412 3300015679 Ga0183366_1001 Ga0183366_1001473 512
413 3300015680 Ga0183370_1001 Ga0183370_1001473 512
414 3300015685 Ga0183369_1001 Ga0183369_1001473 512
415 3300015687 Ga0183368_1001 Ga0183368_1001473 512
416 3300025711 Ga0207696_1001808 Ga0207696_10018082 512
417 3300025728 Ga0207655_1000001 Ga0207655_1000001533 512
418 3300025728 Ga0207655_1000032 Ga0207655_1000032264 512
419 3300025735 Ga0207713_1000021 Ga0207713_10000219 512
420 3300025735 Ga0207713_1003470 Ga0207713_10034703 512
421 3300025735 Ga0207713_1006063 Ga0207713_10060631 512
422 3300026116 Ga0207674_10002213 Ga0207674_100022132 512
423 3300027111 Ga0209281_1000021 Ga0209281_100002191 512
424 3300027111 Ga0209281_1000085 Ga0209281_10000859 512
425 3300027111 Ga0209281_1000817 Ga0209281_100081717 512
426 3300027312 Ga0209371_1000001 Ga0209371_1000001433 512
427 3300028379 Ga0268266_10006560 Ga0268266_100065605 512
428 3300030500 Ga0268256_1000001 Ga0268256_10000012208 512
429 3300032168 Ga0316593_10005918 Ga0316593_100059181 512
430 3300041512 Ga0451853_3565153 Ga0451853_3565153_892_2463 512
431 3300042006 Ga0439432_012730 Ga0439432_012730_887_2455 512
432 3300042010 Ga0439452_000924 Ga0439452_000924_2182_3750 512
433 3300044669 Ga0466981_0000098 Ga0466981_0000098_6458_8026 512
434 3300046458 Ga0495591_000011 Ga0495591_000011_284477_286045 512
435 3300046471 Ga0495650_0000153 Ga0495650_0000153_13339_14910 512
436 3300047469 Ga0495673_0000022 Ga0495673_0000022_262608_264176 512
437 3300048907 Ga0496104_0001318 Ga0496104_0001318_3472_5040 512
438 3300048919 Ga0496116_0008821 Ga0496116_0008821_58_1629 512
439 3300048919 Ga0496116_0057812 Ga0496116_0057812_248_1816 512
440 3300048920 Ga0496117_0020878 Ga0496117_0020878_3479_5047 512
441 3300048921 Ga0496118_0007231 Ga0496118_0007231_6487_8055 512
442 3300048921 Ga0496118_0072355 Ga0496118_0072355_674_2242 512
443 3300048922 Ga0496119_0057976 Ga0496119_0057976_245_1816 512
444 3300048923 Ga0496120_0003653 Ga0496120_0003653_1244_2815 512
445 3300048924 Ga0496121_0009103 Ga0496121_0009103_7887_9455 512
446 3300048924 Ga0496121_0015706 Ga0496121_0015706_395_1966 512
447 3300048924 Ga0496121_0032053 Ga0496121_0032053_3203_4771 512
448 3300048925 Ga0496122_0000026 Ga0496122_0000026_2224_3792 512
449 3300048925 Ga0496122_0000796 Ga0496122_0000796_37008_38579 512
450 3300048926 Ga0496123_0000005 Ga0496123_0000005_302539_304107 512
451 3300048926 Ga0496123_0000599 Ga0496123_0000599_22689_24260 512
452 3300048926 Ga0496123_0018984 Ga0496123_0018984_229_1797 512
453 3300048927 Ga0496124_0097027 Ga0496124_0097027_522_2093 512
454 3300048929 Ga0496126_0028193 Ga0496126_0028193_3478_5046 512
455 3300048929 Ga0496126_0072648 Ga0496126_0072648_1244_2812 512
456 3300050491 nmdc:mga00v17_5777_c1 nmdc:mga00v17_5777_c1_200_1768 512
457 iso_pu_bacteria 2919688452 2919691617 512
458 3300031727 Ga0316576_10010831 Ga0316576_100108316 513
459 3300031728 Ga0316578_10032280 Ga0316578_100322802 513
460 3300031733 Ga0316577_10018169 Ga0316577_100181693 513
461 3300033528 Ga0316588_1003379 Ga0316588_10033792 513
462 3300035398 Ga0316574_0033639 Ga0316574_0033639_771_2330 513
463 3300037312 Ga0395899_0010808 Ga0395899_0010808_4255_5835 513
464 3300037471 Ga0395905_0002859 Ga0395905_0002859_10508_12088 513
465 iso_pu_bacteria 2811994881 2812370426 513
466 iso_pu_bacteria 2923519811 2923524517 513
467 3300009174 Ga0105241_10078213 Ga0105241_100782133 514
468 3300038735 Ga0400485_04923 Ga0400485_04923_81987_83570 515
469 3300038742 Ga0400486_22493 Ga0400486_22493_81850_83433 515
470 3300039062 Ga0400483_059624 Ga0400483_059624_423_1976 515
471 3300039062 Ga0400483_195420 Ga0400483_195420_3645_5195 515
472 iso_pu_bacteria 2690315857 2691331244 515
473 iso_pu_bacteria 8002745576 8002749738 515
474 3300005842 Ga0068858_100009966 Ga0068858_1000099665 516
475 3300014968 Ga0157379_10015107 Ga0157379_100151072 516
476 3300026035 Ga0207703_10051597 Ga0207703_100515974 516
477 3300048919 Ga0496116_0000226 Ga0496116_0000226_49339_50961 516
478 3300048923 Ga0496120_0000043 Ga0496120_0000043_6101_7723 516
479 iso_pu_bacteria 2706794495 2707099815 517
480 3300033541 Ga0316596_1021055 Ga0316596_10210551 518
481 3300038726 Ga0400490_11094 Ga0400490_11094_5642_7204 518
482 3300038726 Ga0400490_17222 Ga0400490_17222_16226_17794 518
483 3300038727 Ga0400491_21474 Ga0400491_21474_4831_6399 518
484 3300038735 Ga0400485_15585 Ga0400485_15585_3528_5093 518
485 3300038741 Ga0400488_22325 Ga0400488_22325_2029_3612 518
486 3300038742 Ga0400486_08699 Ga0400486_08699_247_1812 518
487 3300038742 Ga0400486_17653 Ga0400486_17653_7774_9339 518
488 3300039062 Ga0400483_044668 Ga0400483_044668_1520_3085 518
489 3300039062 Ga0400483_139193 Ga0400483_139193_882_2447 518
490 3300039062 Ga0400483_145468 Ga0400483_145468_2173_3756 518
491 3300039062 Ga0400483_171382 Ga0400483_171382_10478_12043 518
492 3300039062 Ga0400483_269989 Ga0400483_269989_1535_3100 518
493 3300039110 Ga0400487_27800 Ga0400487_27800_53294_54859 518
494 3300039110 Ga0400487_54161 Ga0400487_54161_17314_18879 518
495 3300046463 Ga0495653_0013811 Ga0495653_0013811_1743_3338 518
496 3300046492 Ga0495585_0003413 Ga0495585_0003413_3258_4853 518
497 3300046507 Ga0495606_0013109 Ga0495606_0013109_1739_3334 518
498 3300046665 Ga0495661_0000061 Ga0495661_0000061_125846_127441 518
499 3300047321 Ga0495676_0030843 Ga0495676_0030843_1710_3308 518
500 3300047323 Ga0495683_0000194 Ga0495683_0000194_3069_4667 518
501 iso_pu_bacteria 2508501071 2508851225 518
502 iso_pu_bacteria 2511231025 2511381174 518
503 iso_pu_bacteria 2511231035 2511436093 518
504 iso_pu_bacteria 2537561728 2538427348 518
505 iso_pu_bacteria 2547132181 2547694521 518
506 iso_pu_bacteria 2554235234 2555258980 518
507 iso_pu_bacteria 2561511199 2562466596 518
508 iso_pu_bacteria 2565956521 2566036998 518
509 iso_pu_bacteria 2585427591 2585826935 518
510 iso_pu_bacteria 2585427592 2585831106 518
511 iso_pu_bacteria 2599185169 2599410499 518
512 iso_pu_bacteria 2599185299 2599927277 518
513 iso_pu_bacteria 2600255254 2601523865 518
514 iso_pu_bacteria 2600255255 2601529016 518
515 iso_pu_bacteria 2600255256 2601532106 518
516 iso_pu_bacteria 2600255257 2601537477 518
517 iso_pu_bacteria 2600255280 2601615850 518
518 iso_pu_bacteria 2600255281 2601620422 518
519 iso_pu_bacteria 2600255287 2601645870 518
520 iso_pu_bacteria 2600255288 2601648824 518
521 iso_pu_bacteria 2600255289 2601653900 518
522 iso_pu_bacteria 2600255290 2601659327 518
523 iso_pu_bacteria 2600255291 2601665317 518
524 iso_pu_bacteria 2600255298 2601698179 518
525 iso_pu_bacteria 2600255299 2601703328 518
526 iso_pu_bacteria 2600255300 2601708517 518
527 iso_pu_bacteria 2600255301 2601713630 518
528 iso_pu_bacteria 2600255302 2601717161 518
529 iso_pu_bacteria 2600255303 2601722054 518
530 iso_pu_bacteria 2600255304 2601724678 518
531 iso_pu_bacteria 2600255305 2601731959 518
532 iso_pu_bacteria 2600255306 2601738410 518
533 iso_pu_bacteria 2600255307 2601742741 518
534 iso_pu_bacteria 2600255309 2601751885 518
535 iso_pu_bacteria 2600255310 2601755824 518
536 iso_pu_bacteria 2600255311 2601761192 518
537 iso_pu_bacteria 2600255392 2602020216 518
538 iso_pu_bacteria 2602042046 2603638782 518
539 iso_pu_bacteria 2602042047 2603643312 518
540 iso_pu_bacteria 2602042052 2603663441 518
541 iso_pu_bacteria 2602042053 2603668051 518
542 iso_pu_bacteria 2602042066 2603699910 518
543 iso_pu_bacteria 2602042067 2603703890 518
544 iso_pu_bacteria 2602042103 2603839513 518
545 iso_pu_bacteria 2602042104 2603844438 518
546 iso_pu_bacteria 2602042105 2603849665 518
547 iso_pu_bacteria 2602042106 2603854731 518
548 iso_pu_bacteria 2602042110 2603869857 518
549 iso_pu_bacteria 2602042111 2603878968 518
550 iso_pu_bacteria 2603880178 2606047042 518
551 iso_pu_bacteria 2603880184 2606072474 518
552 iso_pu_bacteria 2603880202 2606146452 518
553 iso_pu_bacteria 2603880211 2606177377 518
554 iso_pu_bacteria 2608642108 2608668694 518
555 iso_pu_bacteria 2609459761 2609913860 518
556 iso_pu_bacteria 2636415599 2637226402 518
557 iso_pu_bacteria 2648501241 2649119765 518
558 iso_pu_bacteria 2648501241 2649121071 518
559 iso_pu_bacteria 2648501693 2650896622 518
560 iso_pu_bacteria 2651869818 2652973233 518
561 iso_pu_bacteria 2651869818 2652974604 518
562 iso_pu_bacteria 2667528172 2671102528 518
563 iso_pu_bacteria 2667528173 2671108222 518
564 iso_pu_bacteria 2671180115 2671586553 518
565 iso_pu_bacteria 2675903046 2676407440 518
566 iso_pu_bacteria 2681812866 2681995650 518
567 iso_pu_bacteria 2681812869 2682007445 518
568 iso_pu_bacteria 2684622997 2686352618 518
569 iso_pu_bacteria 2751185917 2753855168 518
570 iso_pu_bacteria 2765235842 2765588104 518
571 iso_pu_bacteria 2772190666 2772437791 518
572 iso_pu_bacteria 2775506706 2775541572 518
573 iso_pu_bacteria 2775507074 2777020281 518
574 iso_pu_bacteria 2791354903 2791923226 518
575 iso_pu_bacteria 2791355010 2792312400 518
576 iso_pu_bacteria 2791355275 2793406238 518
577 iso_pu_bacteria 2806310673 2807180477 518
578 iso_pu_bacteria 2808606414 2809124820 518
579 iso_pu_bacteria 2811995292 2813729844 518
580 iso_pu_bacteria 2814123068 2814697338 518
581 iso_pu_bacteria 2823373977 2823376808 518
582 iso_pu_bacteria 2844425489 2844426701 518
583 iso_pu_bacteria 2844528606 2844532180 518
584 iso_pu_bacteria 2847085930 2847088505 518
585 iso_pu_bacteria 2847797336 2847800704 518
586 iso_pu_bacteria 2852103415 2852103805 518
587 iso_pu_bacteria 2855195626 2855198723 518
588 iso_pu_bacteria 2858466076 2858470105 518
589 iso_pu_bacteria 2865014394 2865017723 518
590 iso_pu_bacteria 2871272651 2871277166 518
591 iso_pu_bacteria 2871282230 2871286678 518
592 iso_pu_bacteria 2876601092 2876602709 518
593 iso_pu_bacteria 2888366609 2888367781 518
594 iso_pu_bacteria 2888373701 2888374529 518
595 iso_pu_bacteria 2891670763 2891672319 518
596 iso_pu_bacteria 2900051742 2900054077 518
597 iso_pu_bacteria 2900051742 2900055743 518
598 iso_pu_bacteria 2904474040 2904475106 518
599 iso_pu_bacteria 2904504865 2904505486 518
600 iso_pu_bacteria 2908669403 2908670983 518
601 iso_pu_bacteria 2919150387 2919151452 518
602 iso_pu_bacteria 2923634449 2923638592 518
603 iso_pu_bacteria 2927143783 2927146326 518
604 iso_pu_bacteria 2937967321 2937969069 518
605 iso_pu_bacteria 2939602548 2939602871 518
606 iso_pu_bacteria 2939607340 2939608337 518
607 iso_pu_bacteria 2945951305 2945953796 518
608 iso_pu_bacteria 2974310843 2974312975 518
609 iso_pu_bacteria 2984494565 2984495837 518
610 iso_pu_bacteria 2990261002 2990262525 518
611 iso_pu_bacteria 3000376612 3000379919 518
612 iso_pu_bacteria 640753048 640936798 518
613 iso_pu_bacteria 8004592986 8004595001 518
614 iso_pu_bacteria 8015394850 8015399161 518
615 iso_pu_bacteria 8016733728 8016736701 518
616 iso_pu_bacteria 8018221730 8018225304 518
617 iso_pu_bacteria 8018405270 8018408109 518
618 iso_pu_bacteria 8019499862 8019501935 518
619 iso_pu_bacteria 8054844752 8054847080 518
620 iso_pu_bacteria 8055097453 8055102157 518
621 iso_pu_bacteria 2522572158 2523106204 519
622 iso_pu_bacteria 2523231067 2523468584 519
623 iso_pu_bacteria 2599185307 2599973577 519
624 iso_pu_bacteria 2738541271 2738688729 519
625 iso_pu_bacteria 2738543016 2739264960 519
626 iso_pu_bacteria 2738543031 2739352060 519
627 iso_pu_bacteria 2821118458 2821118942 519
628 iso_pu_bacteria 2884086401 2884089830 519
629 iso_pu_bacteria 2904513164 2904517405 519
630 iso_pu_bacteria 2919108558 2919109463 519
631 iso_pu_bacteria 2927833300 2927834909 519
632 iso_pu_bacteria 2935625433 2935627457 519
633 iso_pu_bacteria 2937539931 2937543461 519
634 iso_pu_bacteria 2939617950 2939621477 519
635 iso_pu_bacteria 2945874760 2945878940 519
636 iso_pu_bacteria 2969079654 2969083384 519
637 iso_pu_bacteria 2971820967 2971824815 519
638 iso_pu_bacteria 2974435778 2974437618 519
639 iso_pu_bacteria 2984559226 2984560401 519
640 iso_pu_bacteria 2984595703 2984598478 519
641 iso_pu_bacteria 8019504834 8019508381 519
642 iso_pu_bacteria 8055087960 8055088849 519
643 iso_pu_bacteria 8055092621 8055093805 519
644 iso_pu_bacteria 8057304971 8057305901 519
645 3300046506 Ga0495583_0000499 Ga0495583_0000499_12075_13661 521
646 3300046519 Ga0495632_0000190 Ga0495632_0000190_43383_44969 521
647 3300046665 Ga0495661_0003364 Ga0495661_0003364_8194_9780 521
648 2010549000 RicEn_C5844 RicEn_103700 522
649 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003445 522
650 3300002771 JGI25163J39215_1000007 JGI25163J39215_100000775 522
651 3300002772 JGI25164J39214_1000014 JGI25164J39214_100001463 522
652 3300002773 JGI25152J39213_1000329 JGI25152J39213_100032919 522
653 3300003751 Ga0055538_1000005 Ga0055538_1000005445 522
654 3300003752 Ga0055539_1000007 Ga0055539_1000007445 522
655 3300003756 Ga0055533_1000009 Ga0055533_1000009445 522
656 3300003759 Ga0055525_1000010 Ga0055525_1000010445 522
657 3300003841 Ga0055541_1000005 Ga0055541_1000005120 522
658 3300009011 Ga0105251_10001518 Ga0105251_100015189 522
659 3300009011 Ga0105251_10066205 Ga0105251_100662051 522
660 3300009036 Ga0105244_10000006 Ga0105244_10000006290 522
661 3300009036 Ga0105244_10002108 Ga0105244_100021081 522
662 3300009036 Ga0105244_10005410 Ga0105244_100054103 522
663 3300009092 Ga0105250_10000861 Ga0105250_1000086113 522
664 3300009092 Ga0105250_10000873 Ga0105250_100008737 522
665 3300013100 Ga0157373_10001277 Ga0157373_1000127711 522
666 3300013100 Ga0157373_10002523 Ga0157373_1000252310 522
667 3300013102 Ga0157371_10000167 Ga0157371_1000016747 522
668 3300013102 Ga0157371_10001794 Ga0157371_1000179414 522
669 3300013102 Ga0157371_10004005 Ga0157371_100040054 522
670 3300013104 Ga0157370_10000093 Ga0157370_1000009361 522
671 3300013104 Ga0157370_10003123 Ga0157370_1000312313 522
672 3300013105 Ga0157369_10001855 Ga0157369_1000185515 522
673 3300013306 Ga0163162_10099014 Ga0163162_100990142 522
674 3300013307 Ga0157372_10006015 Ga0157372_100060154 522
675 3300013307 Ga0157372_10008044 Ga0157372_100080448 522
676 3300013307 Ga0157372_10068022 Ga0157372_100680222 522
677 3300015261 Ga0182006_1000063 Ga0182006_100006399 522
678 3300015265 Ga0182005_1014557 Ga0182005_10145572 522
679 3300021384 Ga0213876_10000095 Ga0213876_1000009525 522
680 3300025207 Ga0209760_100001 Ga0209760_100001289 522
681 3300025224 Ga0209784_100001 Ga0209784_100001987 522
682 3300025225 Ga0209566_100001 Ga0209566_100001987 522
683 3300025226 Ga0209674_100002 Ga0209674_100002987 522
684 3300025230 Ga0209563_100008 Ga0209563_100008989 522
685 3300025231 Ga0207427_100002 Ga0207427_100002289 522
686 3300025233 Ga0209437_100007 Ga0209437_100007441 522
687 3300025253 Ga0209677_100004 Ga0209677_100004989 522
688 3300025258 Ga0209129_1000015 Ga0209129_1000015411 522
689 3300025711 Ga0207696_1000489 Ga0207696_100048920 522
690 3300025711 Ga0207696_1000997 Ga0207696_10009975 522
691 3300025728 Ga0207655_1000157 Ga0207655_1000157108 522
692 3300025735 Ga0207713_1000006 Ga0207713_1000006370 522
693 3300025735 Ga0207713_1004111 Ga0207713_10041117 522
694 3300025735 Ga0207713_1013428 Ga0207713_10134282 522
695 3300027111 Ga0209281_1000041 Ga0209281_1000041321 522
696 3300027312 Ga0209371_1000047 Ga0209371_1000047265 522
697 3300027312 Ga0209371_1001366 Ga0209371_100136610 522
698 3300030500 Ga0268256_1000270 Ga0268256_10002708 522
699 3300030500 Ga0268256_1001173 Ga0268256_10011737 522
700 3300031728 Ga0316578_10000385 Ga0316578_100003854 522
701 3300031733 Ga0316577_10014017 Ga0316577_100140172 522
702 3300031733 Ga0316577_10043630 Ga0316577_100436302 522
703 3300033524 Ga0316592_1006238 Ga0316592_10062381 522
704 3300033541 Ga0316596_1000856 Ga0316596_10008563 522
705 3300035398 Ga0316574_0008426 Ga0316574_0008426_3803_5401 522
706 3300036647 Ga0316582_0049709 Ga0316582_0049709_413_2011 522
707 3300036712 Ga0316584_0000079 Ga0316584_0000079_28378_29997 522
708 3300036712 Ga0316584_0016210 Ga0316584_0016210_3261_4862 522
709 3300036712 Ga0316584_0092213 Ga0316584_0092213_531_2132 522
710 3300039062 Ga0400483_239719 Ga0400483_239719_2589_4175 522
711 3300039437 Ga0436365_0727636 Ga0436365_0727636_16067_17635 522
712 3300041405 Ga0439438_000001 Ga0439438_000001_128123_129694 522
713 3300041407 Ga0439447_008932 Ga0439447_008932_1302_2873 522
714 3300042006 Ga0439432_001341 Ga0439432_001341_234_1805 522
715 3300042010 Ga0439452_000001 Ga0439452_000001_68731_70302 522
716 3300042010 Ga0439452_000003 Ga0439452_000003_461038_462606 522
717 3300042016 Ga0439463_001202 Ga0439463_001202_4501_6090 522
718 3300046453 Ga0495627_010254 Ga0495627_010254_1527_3116 522
719 3300046458 Ga0495591_000009 Ga0495591_000009_35307_36896 522
720 3300046458 Ga0495591_004267 Ga0495591_004267_1904_3493 522
721 3300046471 Ga0495650_0000016 Ga0495650_0000016_195262_196830 522
722 3300046471 Ga0495650_0000581 Ga0495650_0000581_32466_34055 522
723 3300046474 Ga0495605_0000142 Ga0495605_0000142_69010_70599 522
724 3300046474 Ga0495605_0001220 Ga0495605_0001220_3103_4692 522
725 3300046474 Ga0495605_0008951 Ga0495605_0008951_394_1983 522
726 3300046500 Ga0495596_0001342 Ga0495596_0001342_993_2582 522
727 3300046501 Ga0495607_0000677 Ga0495607_0000677_21995_23587 522
728 3300046506 Ga0495583_0001458 Ga0495583_0001458_21453_23042 522
729 3300046506 Ga0495583_0001787 Ga0495583_0001787_10404_11993 522
730 3300046507 Ga0495606_0000206 Ga0495606_0000206_34289_35878 522
731 3300046507 Ga0495606_0021350 Ga0495606_0021350_787_2376 522
732 3300046515 Ga0495620_0000737 Ga0495620_0000737_9173_10765 522
733 3300046519 Ga0495632_0004112 Ga0495632_0004112_1090_2679 522
734 3300046519 Ga0495632_0038297 Ga0495632_0038297_279_1847 522
735 3300046520 Ga0495637_0000591 Ga0495637_0000591_13725_15314 522
736 3300046524 Ga0495648_0000219 Ga0495648_0000219_5516_7105 522
737 3300046530 Ga0495654_0005581 Ga0495654_0005581_997_2565 522
738 3300046530 Ga0495654_0031797 Ga0495654_0031797_591_2180 522
739 3300046542 Ga0495597_0001470 Ga0495597_0001470_7607_9175 522
740 3300046616 Ga0495668_0010851 Ga0495668_0010851_52_1641 522
741 3300046616 Ga0495668_0035552 Ga0495668_0035552_378_1967 522
742 3300046648 Ga0495611_0009172 Ga0495611_0009172_95_1684 522
743 3300046660 Ga0495625_0043223 Ga0495625_0043223_224_1792 522
744 3300046665 Ga0495661_0004215 Ga0495661_0004215_8493_10082 522
745 3300046674 Ga0495588_0010188 Ga0495588_0010188_1788_3356 522
746 3300046692 Ga0495671_0005016 Ga0495671_0005016_591_2180 522
747 3300046694 Ga0495649_0004050 Ga0495649_0004050_109_1677 522
748 3300046810 Ga0495660_0000007 Ga0495660_0000007_151624_153192 522
749 3300046810 Ga0495660_0001740 Ga0495660_0001740_4809_6398 522
750 3300047321 Ga0495676_0000042 Ga0495676_0000042_59217_60806 522
751 3300047446 Ga0495679_000027 Ga0495679_000027_65705_67294 522
752 3300047446 Ga0495679_000032 Ga0495679_000032_104289_105857 522
753 3300047469 Ga0495673_0000227 Ga0495673_0000227_42935_44527 522
754 3300047469 Ga0495673_0000813 Ga0495673_0000813_15767_17356 522
755 3300047469 Ga0495673_0001429 Ga0495673_0001429_17467_19056 522
756 3300047469 Ga0495673_0027138 Ga0495673_0027138_947_2536 522
757 3300048907 Ga0496104_0006179 Ga0496104_0006179_2154_3722 522
758 3300048919 Ga0496116_0000127 Ga0496116_0000127_151257_152825 522
759 3300048919 Ga0496116_0000572 Ga0496116_0000572_39601_41172 522
760 3300048920 Ga0496117_0005651 Ga0496117_0005651_2558_4129 522
761 3300048920 Ga0496117_0014392 Ga0496117_0014392_5232_6800 522
762 3300048921 Ga0496118_0004392 Ga0496118_0004392_7035_8606 522
763 3300048921 Ga0496118_0128651 Ga0496118_0128651_20_1588 522
764 3300048922 Ga0496119_0000524 Ga0496119_0000524_44475_46043 522
765 3300048922 Ga0496119_0007945 Ga0496119_0007945_2400_3968 522
766 3300048923 Ga0496120_0000009 Ga0496120_0000009_379099_380667 522
767 3300048923 Ga0496120_0008215 Ga0496120_0008215_3254_4822 522
768 3300048923 Ga0496120_0015232 Ga0496120_0015232_1359_2927 522
769 3300048924 Ga0496121_0002628 Ga0496121_0002628_10591_12180 522
770 3300048924 Ga0496121_0002922 Ga0496121_0002922_20405_21994 522
771 3300048925 Ga0496122_0000013 Ga0496122_0000013_199613_201181 522
772 3300048925 Ga0496122_0006414 Ga0496122_0006414_4414_5982 522
773 3300048926 Ga0496123_0000010 Ga0496123_0000010_299859_301427 522
774 3300048926 Ga0496123_0000621 Ga0496123_0000621_51373_52941 522
775 3300048926 Ga0496123_0010990 Ga0496123_0010990_4134_5732 522
776 3300048926 Ga0496123_0026914 Ga0496123_0026914_1531_3120 522
777 3300048927 Ga0496124_0000259 Ga0496124_0000259_73455_75047 522
778 3300048927 Ga0496124_0002333 Ga0496124_0002333_8027_9595 522
779 3300048927 Ga0496124_0016619 Ga0496124_0016619_3411_4982 522
780 3300048928 Ga0496125_0000019 Ga0496125_0000019_141346_142914 522
781 3300048929 Ga0496126_0002546 Ga0496126_0002546_7921_9489 522
782 3300049459 Ga0495678_000043 Ga0495678_000043_102607_104196 522
783 3300049460 Ga0495682_0000096 Ga0495682_0000096_9584_11173 522

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

13

475

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rko-assembly1.cif.gz_A cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9745 2 513
6rko-assembly1.cif.gz_A cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.9724 2 513
6rx4-assembly1.cif.gz_A the structure of bd oxidase from escherichia coli 0.968 2 515
7oy2-assembly1.cif.gz_C high resolution structure of cytochrome bd-ii oxidase from e. coli 0.9662 3 503
6rx4-assembly1.cif.gz_A the structure of bd oxidase from escherichia coli 0.9661 2 515
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5657 12 441 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5528 12 441 1.20.1630.10
af_I1KZ04_198_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.4439 12 236 1.20.120.1770
af_I1KZ04_198_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.407 12 236 1.20.120.1770
af_A0A1D8PLM4_14_243_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4055 20 234 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A376UDY2-F1-model_v4 Cytochrome d ubiquinol oxidase subunit 1 (EC 1.10.3.-) 0.9846 128 238 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A7Y7DJR0-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9783 4 504 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A6N3U8U7-F1-model_v4 deleted 0.9781 11 514
AF-A0A7Z8G990-F1-model_v4 deleted 0.9777 148 515
AF-A0A6M1DKR8-F1-model_v4 Cytochrome bd-I ubiquinol oxidase subunit CydA 0.9773 311 451 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Feature Viewer

pLDDT pTM Quality
84.38 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map