F480673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 435 | 631 | 514 |
Family's Representative Sequence
| Representative Sequence | 3300046675|Ga0495657_0078484|Ga0495657_0078484_477_2102 |
| Length | 509 |
| Sequence | MNGIDGGIGVVELSRLQFALTALYHFLFVPLTLGLSVILAIMESVYVMTGRRIWRDITMFWGILFTMEFQFGTNWSYYSHYVGDVFGAPLAIEGLMAFFLEATFIGLFFFGWDRLSKPGHLAVTWCVAFGSNFSALWILIANAWMQHPVGSRFNPETMRMEVTDFFAVLFNPVAQSKFVHTVSAGYVTGSVFVLAISAWYLLRGRHLEIARRSMTVAASFGLASALSVVVLGDESGYETTQNQKMKLAAMEAMWHTEPAPAPFTIFGLPDQKERVTHARIQIPWALGLIATRSISQPVPGISELVEQAKGRIRQGIEAYTAVQQLRRNPKDDAARRALDARQDDLGYAMLLRRYVDDPAKATEPQIEQAATLFWSFRLMVGLGFYFIALFAVMFYVAARRQLDRRRWLLRLAFYSLPLPWIRQPWIIEGVLPTFLAASPVPVWNVWISLLGFVLFYTVLLVVDLYLMIKYARLGPTETWEVPDMATRHAPPGGMVVDRETLHPHPRPAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 3 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 4 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 5 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 6 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 7 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 8 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 9 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 10 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 11 | 2565956521 | Vibrio rhizosphaerae DSM 18581 | Isolate | Rhizosphere |
| 12 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 13 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 14 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 15 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 16 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 17 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 18 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 19 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 20 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 21 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 22 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 23 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 24 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 25 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 26 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 27 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 28 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 29 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 30 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 31 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 32 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 33 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 34 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 35 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 36 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 37 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 38 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 39 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 40 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 41 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 42 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 43 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 44 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 45 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 46 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 47 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 48 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 49 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 50 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 51 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 52 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 53 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 54 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 55 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 56 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 57 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 58 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 59 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 60 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 61 | 2648501241 | Vibrio splendidus UCD-SED7 | Isolate | Rhizosphere |
| 62 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 63 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 64 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 65 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 66 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 67 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 68 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 69 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 70 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 71 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 72 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 73 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 74 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 75 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 76 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 77 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 78 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 79 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 80 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 81 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 82 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 83 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 84 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 85 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 86 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 87 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 88 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 89 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 90 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 91 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 92 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 93 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 94 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 95 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 96 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 97 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 98 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 99 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 100 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 101 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 102 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 103 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 104 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 105 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 106 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 107 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 108 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 109 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 110 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 111 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 112 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 113 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 114 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 115 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 116 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 117 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 118 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 119 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 120 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 121 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 122 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 123 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 124 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 125 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 126 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 127 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 128 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 129 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 130 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 131 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 132 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 133 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 134 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 135 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 136 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 137 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 138 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 139 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 140 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 141 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 142 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 143 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 144 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 145 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 146 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 147 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 148 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 149 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 151 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 152 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 155 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 156 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 161 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 162 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 164 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 165 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 166 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 167 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 168 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 169 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 171 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 173 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 174 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 175 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 176 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 177 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 178 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 179 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 180 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 181 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 182 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 183 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 184 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 186 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 187 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 188 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 189 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 191 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 192 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 197 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 198 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 199 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 209 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 210 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 216 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 217 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 218 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 219 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 220 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 221 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 222 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 231 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 265 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 266 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 267 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 268 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 270 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 271 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 272 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 273 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 274 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 275 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 276 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 277 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 278 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 279 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 280 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 281 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 282 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 283 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 284 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 285 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 286 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 288 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 292 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 293 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 294 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 295 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 296 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 297 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 300 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 301 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 302 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 303 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 304 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 305 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 306 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 307 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 308 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 309 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 310 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 311 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 312 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 313 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 314 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 315 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 316 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 317 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 318 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 319 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 320 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 321 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 322 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 367 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 368 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 369 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 370 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 371 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 372 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 374 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 375 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 376 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 377 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 378 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 379 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 380 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 381 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 382 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 383 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 384 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 385 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 386 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 387 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 388 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 389 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 390 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 418 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 419 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 420 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 423 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 424 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 425 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 426 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 427 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 428 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 429 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 430 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 431 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 432 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 433 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 434 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 435 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.95 |
| Metatranscriptomes | 0.64 |
| Isolates | 19.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.51 |
| Bulb | 0.13 |
| Endosphere | 4.34 |
| Nodule | 1.15 |
| Rhizoplane | 10.6 |
| Rhizosphere | 63.35 |
| Stem | 0.13 |
| Stem Tuber | 0.77 |
| Unclassified | 19.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C5844 | 2010549000 | Bacteria | 1941 |
| 2 | JGI25162J39368_1000003 | 3300002737 | Bacteria | 575218 |
| 3 | JGI25163J39215_1000007 | 3300002771 | Bacteria | 113612 |
| 4 | JGI25164J39214_1000014 | 3300002772 | Bacteria | 219691 |
| 5 | JGI25152J39213_1000329 | 3300002773 | Bacteria | 30338 |
| 6 | JGI25153J46596_10003384 | 3300003215 | Bacteria | 8945 |
| 7 | rootH2_10019625 | 3300003320 | Bacteria | 6208 |
| 8 | Ga0055538_1000005 | 3300003751 | Bacteria | 575218 |
| 9 | Ga0055539_1000007 | 3300003752 | Bacteria | 575218 |
| 10 | Ga0055533_1000009 | 3300003756 | Bacteria | 575218 |
| 11 | Ga0055525_1000010 | 3300003759 | Bacteria | 575218 |
| 12 | Ga0055541_1000005 | 3300003841 | Bacteria | 575218 |
| 13 | Ga0058692_1000808 | 3300003856 | Bacteria | 12462 |
| 14 | Ga0058692_1003490 | 3300003856 | Bacteria | 4847 |
| 15 | Ga0065704_10001970 | 3300005289 | Bacteria | 12114 |
| 16 | Ga0065704_10002600 | 3300005289 | Bacteria | 4957 |
| 17 | Ga0065707_10082478 | 3300005295 | Bacteria | 14636 |
| 18 | Ga0070690_100019111 | 3300005330 | Bacteria | 4153 |
| 19 | Ga0070670_100028503 | 3300005331 | Bacteria | 4806 |
| 20 | Ga0070666_10027464 | 3300005335 | Bacteria | 3728 |
| 21 | Ga0070666_10030479 | 3300005335 | Bacteria | 3554 |
| 22 | Ga0070680_100000408 | 3300005336 | Bacteria | 29300 |
| 23 | Ga0070689_100066496 | 3300005340 | Bacteria | 2808 |
| 24 | Ga0070668_100009230 | 3300005347 | Bacteria | 7314 |
| 25 | Ga0070671_100002529 | 3300005355 | Bacteria | 14159 |
| 26 | Ga0070671_100047551 | 3300005355 | Bacteria | 3567 |
| 27 | Ga0070659_100007694 | 3300005366 | Bacteria | 7836 |
| 28 | Ga0070659_100121494 | 3300005366 | Bacteria | 2116 |
| 29 | Ga0070667_100000043 | 3300005367 | Bacteria | 167034 |
| 30 | Ga0070667_100019370 | 3300005367 | Bacteria | 5645 |
| 31 | Ga0070667_100069642 | 3300005367 | Bacteria | 2994 |
| 32 | Ga0070709_10000184 | 3300005434 | Bacteria | 39762 |
| 33 | Ga0070709_10108031 | 3300005434 | Bacteria | 1866 |
| 34 | Ga0070713_100000882 | 3300005436 | Bacteria | 19204 |
| 35 | Ga0070678_100002323 | 3300005456 | Bacteria | 10385 |
| 36 | Ga0070681_10000003 | 3300005458 | Bacteria | 252785 |
| 37 | Ga0070685_10061141 | 3300005466 | Bacteria | 2205 |
| 38 | Ga0070679_100000541 | 3300005530 | Bacteria | 32093 |
| 39 | Ga0070684_100036941 | 3300005535 | Bacteria | 4188 |
| 40 | Ga0068853_100002126 | 3300005539 | Bacteria | 14738 |
| 41 | Ga0070686_100007898 | 3300005544 | Bacteria | 5949 |
| 42 | Ga0070665_100000199 | 3300005548 | Bacteria | 105924 |
| 43 | Ga0070665_100010430 | 3300005548 | Bacteria | 9401 |
| 44 | Ga0070665_100015224 | 3300005548 | Bacteria | 7721 |
| 45 | Ga0068855_100000006 | 3300005563 | Bacteria | 298092 |
| 46 | Ga0068855_100021482 | 3300005563 | Bacteria | 7741 |
| 47 | Ga0068855_100233370 | 3300005563 | Bacteria | 2059 |
| 48 | Ga0070664_100001502 | 3300005564 | Bacteria | 18596 |
| 49 | Ga0068857_100106500 | 3300005577 | Bacteria | 2518 |
| 50 | Ga0068856_100000182 | 3300005614 | Bacteria | 65421 |
| 51 | Ga0068856_100000276 | 3300005614 | Bacteria | 55917 |
| 52 | Ga0068852_100020529 | 3300005616 | Bacteria | 5254 |
| 53 | Ga0068859_100027497 | 3300005617 | Bacteria | 5705 |
| 54 | Ga0068864_100038174 | 3300005618 | Bacteria | 4100 |
| 55 | Ga0068863_100001860 | 3300005841 | Bacteria | 20979 |
| 56 | Ga0068858_100009966 | 3300005842 | Bacteria | 9022 |
| 57 | Ga0068858_100107818 | 3300005842 | Bacteria | 2600 |
| 58 | Ga0068860_100000185 | 3300005843 | Bacteria | 99579 |
| 59 | Ga0068860_100004398 | 3300005843 | Bacteria | 14394 |
| 60 | Ga0068860_100037638 | 3300005843 | Bacteria | 4631 |
| 61 | Ga0068860_100160076 | 3300005843 | Bacteria | 2170 |
| 62 | Ga0075364_10023775 | 3300006051 | Bacteria | 3882 |
| 63 | Ga0075364_10034360 | 3300006051 | Bacteria | 3270 |
| 64 | Ga0070715_10002694 | 3300006163 | Bacteria | 5506 |
| 65 | Ga0070715_10043688 | 3300006163 | Bacteria | 1891 |
| 66 | Ga0070712_100000026 | 3300006175 | Bacteria | 77190 |
| 67 | Ga0070712_100020697 | 3300006175 | Bacteria | 4307 |
| 68 | Ga0075366_10004030 | 3300006195 | Bacteria | 7854 |
| 69 | Ga0097621_100008048 | 3300006237 | Bacteria | 7567 |
| 70 | Ga0068871_100056797 | 3300006358 | Bacteria | 3183 |
| 71 | Ga0075434_100072903 | 3300006871 | Bacteria | 3426 |
| 72 | Ga0068865_100016921 | 3300006881 | Bacteria | 4678 |
| 73 | Ga0075436_100000063 | 3300006914 | Bacteria | 64417 |
| 74 | Ga0075436_100055880 | 3300006914 | Bacteria | 2727 |
| 75 | Ga0097620_100027497 | 3300006931 | Bacteria | 5705 |
| 76 | Ga0079104_1001292 | 3300006946 | Bacteria | 17270 |
| 77 | Ga0079104_1019879 | 3300006946 | Bacteria | 1864 |
| 78 | Ga0075435_100126749 | 3300007076 | Bacteria | 2134 |
| 79 | Ga0105251_10001518 | 3300009011 | Bacteria | 19945 |
| 80 | Ga0105251_10038629 | 3300009011 | Bacteria | 2338 |
| 81 | Ga0105251_10066205 | 3300009011 | Bacteria | 1689 |
| 82 | Ga0105244_10000006 | 3300009036 | Bacteria | 357997 |
| 83 | Ga0105244_10002108 | 3300009036 | Bacteria | 15294 |
| 84 | Ga0105244_10005410 | 3300009036 | Bacteria | 8495 |
| 85 | Ga0105244_10050345 | 3300009036 | Bacteria | 2125 |
| 86 | Ga0105250_10000003 | 3300009092 | Bacteria | 547770 |
| 87 | Ga0105250_10000026 | 3300009092 | Bacteria | 213233 |
| 88 | Ga0105250_10000861 | 3300009092 | Bacteria | 17902 |
| 89 | Ga0105250_10000873 | 3300009092 | Bacteria | 17814 |
| 90 | Ga0105250_10002960 | 3300009092 | Bacteria | 8266 |
| 91 | Ga0105250_10015489 | 3300009092 | Bacteria | 3122 |
| 92 | Ga0105250_10017877 | 3300009092 | Bacteria | 2879 |
| 93 | Ga0105250_10038056 | 3300009092 | Bacteria | 1930 |
| 94 | Ga0105240_10000287 | 3300009093 | Bacteria | 98443 |
| 95 | Ga0105240_10000357 | 3300009093 | Bacteria | 85936 |
| 96 | Ga0105240_10005351 | 3300009093 | Bacteria | 19146 |
| 97 | Ga0105240_10015450 | 3300009093 | Bacteria | 10381 |
| 98 | Ga0105240_10021990 | 3300009093 | Bacteria | 8472 |
| 99 | Ga0105245_10005574 | 3300009098 | Bacteria | 11064 |
| 100 | Ga0105245_10011980 | 3300009098 | Bacteria | 7540 |
| 101 | Ga0105247_10001108 | 3300009101 | Bacteria | 20064 |
| 102 | Ga0105247_10005233 | 3300009101 | Bacteria | 8192 |
| 103 | Ga0105241_10025051 | 3300009174 | Bacteria | 4433 |
| 104 | Ga0105241_10078213 | 3300009174 | Bacteria | 2584 |
| 105 | Ga0105242_10026325 | 3300009176 | Bacteria | 4609 |
| 106 | Ga0105242_10090268 | 3300009176 | Bacteria | 2577 |
| 107 | Ga0105248_10021653 | 3300009177 | Bacteria | 7120 |
| 108 | Ga0105248_10071852 | 3300009177 | Bacteria | 3888 |
| 109 | Ga0105237_10154950 | 3300009545 | Bacteria | 2288 |
| 110 | Ga0105238_10014086 | 3300009551 | Bacteria | 8085 |
| 111 | Ga0105238_10018343 | 3300009551 | Bacteria | 7121 |
| 112 | Ga0105238_10027731 | 3300009551 | Bacteria | 5773 |
| 113 | Ga0105239_10012041 | 3300010375 | Bacteria | 9644 |
| 114 | Ga0105239_10027113 | 3300010375 | Bacteria | 6307 |
| 115 | Ga0105246_10002049 | 3300011119 | Bacteria | 12146 |
| 116 | Ga0105246_10007027 | 3300011119 | Bacteria | 6890 |
| 117 | Ga0157373_10001277 | 3300013100 | Bacteria | 19254 |
| 118 | Ga0157373_10002523 | 3300013100 | Bacteria | 13935 |
| 119 | Ga0157373_10003329 | 3300013100 | Bacteria | 12140 |
| 120 | Ga0157373_10016116 | 3300013100 | Bacteria | 5455 |
| 121 | Ga0157371_10000167 | 3300013102 | Bacteria | 95585 |
| 122 | Ga0157371_10001411 | 3300013102 | Bacteria | 25041 |
| 123 | Ga0157371_10001794 | 3300013102 | Bacteria | 21713 |
| 124 | Ga0157371_10004005 | 3300013102 | Bacteria | 13051 |
| 125 | Ga0157370_10000093 | 3300013104 | Bacteria | 101308 |
| 126 | Ga0157370_10003123 | 3300013104 | Bacteria | 19615 |
| 127 | Ga0157370_10008772 | 3300013104 | Bacteria | 10869 |
| 128 | Ga0157370_10029417 | 3300013104 | Bacteria | 5391 |
| 129 | Ga0157369_10001855 | 3300013105 | Bacteria | 25533 |
| 130 | Ga0157369_10082534 | 3300013105 | Bacteria | 3438 |
| 131 | Ga0157374_10005805 | 3300013296 | Bacteria | 10426 |
| 132 | Ga0163162_10012254 | 3300013306 | Bacteria | 8367 |
| 133 | Ga0163162_10064722 | 3300013306 | Bacteria | 3701 |
| 134 | Ga0163162_10099014 | 3300013306 | Bacteria | 3006 |
| 135 | Ga0163162_10108326 | 3300013306 | Bacteria | 2874 |
| 136 | Ga0157372_10006015 | 3300013307 | Bacteria | 12885 |
| 137 | Ga0157372_10008044 | 3300013307 | Bacteria | 11213 |
| 138 | Ga0157372_10068022 | 3300013307 | Bacteria | 4004 |
| 139 | Ga0157372_10074215 | 3300013307 | Bacteria | 3835 |
| 140 | Ga0157372_10092567 | 3300013307 | Bacteria | 3439 |
| 141 | Ga0157375_10021458 | 3300013308 | Bacteria | 5923 |
| 142 | Ga0163163_10076754 | 3300014325 | Bacteria | 3337 |
| 143 | Ga0157379_10009588 | 3300014968 | Bacteria | 8433 |
| 144 | Ga0157379_10010119 | 3300014968 | Bacteria | 8224 |
| 145 | Ga0157379_10012676 | 3300014968 | Bacteria | 7368 |
| 146 | Ga0157379_10015107 | 3300014968 | Bacteria | 6772 |
| 147 | Ga0157379_10045788 | 3300014968 | Bacteria | 3905 |
| 148 | Ga0182006_1000063 | 3300015261 | Bacteria | 154042 |
| 149 | Ga0182005_1014557 | 3300015265 | Bacteria | 2200 |
| 150 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 151 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 152 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 153 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 154 | Ga0213876_10000095 | 3300021384 | Bacteria | 99902 |
| 155 | Ga0209760_100001 | 3300025207 | Bacteria | 348781 |
| 156 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 157 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 158 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 159 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 160 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 161 | Ga0209437_100007 | 3300025233 | Bacteria | 938377 |
| 162 | Ga0209437_100185 | 3300025233 | Bacteria | 126819 |
| 163 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 164 | Ga0209129_1000015 | 3300025258 | Bacteria | 487967 |
| 165 | Ga0209233_1015805 | 3300025261 | Bacteria | 2092 |
| 166 | Ga0209025_1000585 | 3300025294 | Bacteria | 66076 |
| 167 | Ga0209758_1000036 | 3300025297 | Bacteria | 441671 |
| 168 | Ga0209758_1003539 | 3300025297 | Bacteria | 14062 |
| 169 | Ga0207696_1000003 | 3300025711 | Bacteria | 860639 |
| 170 | Ga0207696_1000004 | 3300025711 | Bacteria | 671626 |
| 171 | Ga0207696_1000059 | 3300025711 | Bacteria | 245763 |
| 172 | Ga0207696_1000328 | 3300025711 | Bacteria | 50336 |
| 173 | Ga0207696_1000489 | 3300025711 | Bacteria | 33338 |
| 174 | Ga0207696_1000746 | 3300025711 | Bacteria | 21687 |
| 175 | Ga0207696_1000997 | 3300025711 | Bacteria | 17032 |
| 176 | Ga0207696_1001808 | 3300025711 | Bacteria | 11035 |
| 177 | Ga0207655_1000001 | 3300025728 | Bacteria | 1866413 |
| 178 | Ga0207655_1000023 | 3300025728 | Bacteria | 467070 |
| 179 | Ga0207655_1000032 | 3300025728 | Bacteria | 391253 |
| 180 | Ga0207655_1000042 | 3300025728 | Bacteria | 333039 |
| 181 | Ga0207655_1000105 | 3300025728 | Bacteria | 182927 |
| 182 | Ga0207655_1000157 | 3300025728 | Bacteria | 124885 |
| 183 | Ga0207655_1003248 | 3300025728 | Bacteria | 12205 |
| 184 | Ga0207655_1016317 | 3300025728 | Bacteria | 4071 |
| 185 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 186 | Ga0207713_1000005 | 3300025735 | Bacteria | 649958 |
| 187 | Ga0207713_1000006 | 3300025735 | Bacteria | 586163 |
| 188 | Ga0207713_1000021 | 3300025735 | Bacteria | 353108 |
| 189 | Ga0207713_1003470 | 3300025735 | Bacteria | 10734 |
| 190 | Ga0207713_1004111 | 3300025735 | Bacteria | 9588 |
| 191 | Ga0207713_1006063 | 3300025735 | Bacteria | 7452 |
| 192 | Ga0207713_1013428 | 3300025735 | Bacteria | 4316 |
| 193 | Ga0207710_10005583 | 3300025900 | Bacteria | 5412 |
| 194 | Ga0207680_10000006 | 3300025903 | Bacteria | 635950 |
| 195 | Ga0207680_10002749 | 3300025903 | Bacteria | 8227 |
| 196 | Ga0207680_10043528 | 3300025903 | Bacteria | 2634 |
| 197 | Ga0207699_10000223 | 3300025906 | Bacteria | 32867 |
| 198 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 199 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 200 | Ga0207695_10001005 | 3300025913 | Bacteria | 49964 |
| 201 | Ga0207695_10004444 | 3300025913 | Bacteria | 19118 |
| 202 | Ga0207695_10081311 | 3300025913 | Bacteria | 3279 |
| 203 | Ga0207693_10000099 | 3300025915 | Bacteria | 77197 |
| 204 | Ga0207693_10000334 | 3300025915 | Bacteria | 43371 |
| 205 | Ga0207660_10001780 | 3300025917 | Bacteria | 14415 |
| 206 | Ga0207652_10000736 | 3300025921 | Bacteria | 31695 |
| 207 | Ga0207694_10000014 | 3300025924 | Bacteria | 374435 |
| 208 | Ga0207644_10058010 | 3300025931 | Bacteria | 2796 |
| 209 | Ga0207690_10091469 | 3300025932 | Bacteria | 2151 |
| 210 | Ga0207709_10012460 | 3300025935 | Bacteria | 4683 |
| 211 | Ga0207711_10008066 | 3300025941 | Bacteria | 8814 |
| 212 | Ga0207711_10041351 | 3300025941 | Bacteria | 3925 |
| 213 | Ga0207689_10096362 | 3300025942 | Bacteria | 2430 |
| 214 | Ga0207667_10000051 | 3300025949 | Bacteria | 233836 |
| 215 | Ga0207667_10027232 | 3300025949 | Bacteria | 6227 |
| 216 | Ga0207667_10112822 | 3300025949 | Bacteria | 2803 |
| 217 | Ga0207658_10000192 | 3300025986 | Bacteria | 65509 |
| 218 | Ga0207658_10033089 | 3300025986 | Bacteria | 3685 |
| 219 | Ga0207658_10066340 | 3300025986 | Bacteria | 2714 |
| 220 | Ga0207703_10051597 | 3300026035 | Bacteria | 3334 |
| 221 | Ga0207703_10077994 | 3300026035 | Bacteria | 2751 |
| 222 | Ga0207639_10001724 | 3300026041 | Bacteria | 14726 |
| 223 | Ga0207639_10014959 | 3300026041 | Bacteria | 5467 |
| 224 | Ga0207702_10000148 | 3300026078 | Bacteria | 81831 |
| 225 | Ga0207702_10004501 | 3300026078 | Bacteria | 12371 |
| 226 | Ga0207702_10036005 | 3300026078 | Bacteria | 4139 |
| 227 | Ga0207641_10000177 | 3300026088 | Bacteria | 88140 |
| 228 | Ga0207641_10067045 | 3300026088 | Bacteria | 3073 |
| 229 | Ga0207676_10008293 | 3300026095 | Bacteria | 7385 |
| 230 | Ga0207674_10002213 | 3300026116 | Bacteria | 24638 |
| 231 | Ga0207683_10034312 | 3300026121 | Bacteria | 4409 |
| 232 | Ga0209281_1000021 | 3300027111 | Bacteria | 541033 |
| 233 | Ga0209281_1000041 | 3300027111 | Bacteria | 347825 |
| 234 | Ga0209281_1000085 | 3300027111 | Bacteria | 252561 |
| 235 | Ga0209281_1000291 | 3300027111 | Bacteria | 91918 |
| 236 | Ga0209281_1000817 | 3300027111 | Bacteria | 28172 |
| 237 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 238 | Ga0209371_1000010 | 3300027312 | Bacteria | 922021 |
| 239 | Ga0209371_1000047 | 3300027312 | Bacteria | 304732 |
| 240 | Ga0209371_1000590 | 3300027312 | Bacteria | 32510 |
| 241 | Ga0209371_1000803 | 3300027312 | Bacteria | 25942 |
| 242 | Ga0209371_1001366 | 3300027312 | Bacteria | 16868 |
| 243 | Ga0209371_1001830 | 3300027312 | Bacteria | 13172 |
| 244 | Ga0209371_1011312 | 3300027312 | Bacteria | 2659 |
| 245 | Ga0268266_10006560 | 3300028379 | Bacteria | 10639 |
| 246 | Ga0268264_10000088 | 3300028381 | Bacteria | 235344 |
| 247 | Ga0265334_10002838 | 3300028573 | Bacteria | 7977 |
| 248 | Ga0265318_10000031 | 3300028577 | Bacteria | 146035 |
| 249 | Ga0265318_10006809 | 3300028577 | Bacteria | 5226 |
| 250 | Ga0265318_10009576 | 3300028577 | Bacteria | 4252 |
| 251 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 252 | Ga0265338_10005866 | 3300028800 | Bacteria | 15841 |
| 253 | Ga0265338_10013556 | 3300028800 | Bacteria | 9186 |
| 254 | Ga0265338_10015294 | 3300028800 | Bacteria | 8445 |
| 255 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 256 | Ga0268256_1000022 | 3300030500 | Bacteria | 531115 |
| 257 | Ga0268256_1000270 | 3300030500 | Bacteria | 53886 |
| 258 | Ga0268256_1000514 | 3300030500 | Bacteria | 32518 |
| 259 | Ga0268256_1000671 | 3300030500 | Bacteria | 25942 |
| 260 | Ga0268256_1001116 | 3300030500 | Bacteria | 17468 |
| 261 | Ga0268256_1001173 | 3300030500 | Bacteria | 16868 |
| 262 | Ga0265330_10004426 | 3300031235 | Bacteria | 7132 |
| 263 | Ga0265328_10008679 | 3300031239 | Bacteria | 4174 |
| 264 | Ga0265328_10011367 | 3300031239 | Bacteria | 3559 |
| 265 | Ga0265328_10011823 | 3300031239 | Bacteria | 3482 |
| 266 | Ga0265320_10001142 | 3300031240 | Bacteria | 19529 |
| 267 | Ga0265325_10000003 | 3300031241 | Bacteria | 370490 |
| 268 | Ga0265325_10003681 | 3300031241 | Bacteria | 9926 |
| 269 | Ga0265325_10005413 | 3300031241 | Bacteria | 7882 |
| 270 | Ga0265325_10007971 | 3300031241 | Bacteria | 6287 |
| 271 | Ga0265329_10005285 | 3300031242 | Bacteria | 5238 |
| 272 | Ga0265340_10002162 | 3300031247 | Bacteria | 11273 |
| 273 | Ga0265340_10022680 | 3300031247 | Bacteria | 3208 |
| 274 | Ga0265339_10001397 | 3300031249 | Bacteria | 17979 |
| 275 | Ga0265339_10012298 | 3300031249 | Bacteria | 5229 |
| 276 | Ga0265339_10017287 | 3300031249 | Bacteria | 4276 |
| 277 | Ga0265339_10024291 | 3300031249 | Bacteria | 3494 |
| 278 | Ga0265339_10049844 | 3300031249 | Bacteria | 2291 |
| 279 | Ga0265331_10000141 | 3300031250 | Bacteria | 94896 |
| 280 | Ga0265331_10001884 | 3300031250 | Bacteria | 14788 |
| 281 | Ga0265331_10002109 | 3300031250 | Bacteria | 13711 |
| 282 | Ga0265331_10005803 | 3300031250 | Bacteria | 7396 |
| 283 | Ga0265331_10007523 | 3300031250 | Bacteria | 6295 |
| 284 | Ga0265331_10012128 | 3300031250 | Bacteria | 4684 |
| 285 | Ga0265327_10000076 | 3300031251 | Bacteria | 212272 |
| 286 | Ga0265316_10011748 | 3300031344 | Bacteria | 7876 |
| 287 | Ga0265316_10151872 | 3300031344 | Bacteria | 1734 |
| 288 | Ga0307513_10084284 | 3300031456 | Bacteria | 3265 |
| 289 | Ga0307509_10000022 | 3300031507 | Bacteria | 247822 |
| 290 | Ga0307509_10145012 | 3300031507 | Bacteria | 2302 |
| 291 | Ga0265313_10000365 | 3300031595 | Bacteria | 49111 |
| 292 | Ga0265313_10000745 | 3300031595 | Bacteria | 33374 |
| 293 | Ga0265313_10001646 | 3300031595 | Bacteria | 20705 |
| 294 | Ga0265313_10003952 | 3300031595 | Bacteria | 11666 |
| 295 | Ga0265313_10004103 | 3300031595 | Bacteria | 11341 |
| 296 | Ga0265313_10005442 | 3300031595 | Bacteria | 9371 |
| 297 | Ga0265313_10014638 | 3300031595 | Bacteria | 4622 |
| 298 | Ga0265313_10040965 | 3300031595 | Bacteria | 2285 |
| 299 | Ga0265314_10004456 | 3300031711 | Bacteria | 12996 |
| 300 | Ga0265314_10010811 | 3300031711 | Bacteria | 7589 |
| 301 | Ga0265314_10056460 | 3300031711 | Bacteria | 2702 |
| 302 | Ga0265342_10003917 | 3300031712 | Bacteria | 11954 |
| 303 | Ga0265342_10005490 | 3300031712 | Bacteria | 9645 |
| 304 | Ga0265342_10006956 | 3300031712 | Bacteria | 8359 |
| 305 | Ga0265342_10008325 | 3300031712 | Bacteria | 7456 |
| 306 | Ga0265342_10029181 | 3300031712 | Bacteria | 3428 |
| 307 | Ga0316576_10010831 | 3300031727 | Bacteria | 5944 |
| 308 | Ga0316578_10000385 | 3300031728 | Bacteria | 14147 |
| 309 | Ga0316578_10032280 | 3300031728 | Bacteria | 2990 |
| 310 | Ga0316577_10014017 | 3300031733 | Bacteria | 4396 |
| 311 | Ga0316577_10018169 | 3300031733 | Bacteria | 3886 |
| 312 | Ga0316577_10043630 | 3300031733 | Bacteria | 2509 |
| 313 | Ga0316593_10005918 | 3300032168 | Bacteria | 3266 |
| 314 | Ga0307510_10000008 | 3300033180 | Bacteria | 433990 |
| 315 | Ga0316592_1006238 | 3300033524 | Bacteria | 2290 |
| 316 | Ga0316588_1003379 | 3300033528 | Bacteria | 2905 |
| 317 | Ga0316596_1000856 | 3300033541 | Bacteria | 5700 |
| 318 | Ga0316596_1021055 | 3300033541 | Bacteria | 1660 |
| 319 | Ga0373934_0009038 | 3300035086 | Bacteria | 3726 |
| 320 | Ga0373936_0011864 | 3300035113 | Bacteria | 3306 |
| 321 | Ga0316574_0008426 | 3300035398 | Bacteria | 5723 |
| 322 | Ga0316574_0014416 | 3300035398 | Bacteria | 4568 |
| 323 | Ga0316574_0033639 | 3300035398 | Bacteria | 3120 |
| 324 | Ga0316574_0044886 | 3300035398 | Bacteria | 2735 |
| 325 | Ga0373931_0014449 | 3300035691 | Bacteria | 3860 |
| 326 | Ga0373935_0106960 | 3300035692 | Bacteria | 1852 |
| 327 | Ga0373927_0015239 | 3300035695 | Bacteria | 5080 |
| 328 | Ga0373933_0134836 | 3300035724 | Bacteria | 1555 |
| 329 | Ga0373937_0059076 | 3300036401 | Bacteria | 3524 |
| 330 | Ga0316582_0017269 | 3300036647 | Bacteria | 4171 |
| 331 | Ga0316582_0017380 | 3300036647 | Bacteria | 4161 |
| 332 | Ga0316582_0049709 | 3300036647 | Bacteria | 2653 |
| 333 | Ga0316584_0000079 | 3300036712 | Bacteria | 38059 |
| 334 | Ga0316584_0016210 | 3300036712 | Bacteria | 5342 |
| 335 | Ga0316584_0092213 | 3300036712 | Bacteria | 2268 |
| 336 | Ga0395899_0010808 | 3300037312 | Bacteria | 6998 |
| 337 | Ga0395905_0002859 | 3300037471 | Bacteria | 18881 |
| 338 | Ga0400490_11094 | 3300038726 | Bacteria | 62810 |
| 339 | Ga0400490_17222 | 3300038726 | Bacteria | 34532 |
| 340 | Ga0400491_21474 | 3300038727 | Bacteria | 6670 |
| 341 | Ga0400485_04923 | 3300038735 | Bacteria | 131311 |
| 342 | Ga0400485_15585 | 3300038735 | Bacteria | 12852 |
| 343 | Ga0400488_22325 | 3300038741 | Bacteria | 3722 |
| 344 | Ga0400488_32056 | 3300038741 | Bacteria | 1770 |
| 345 | Ga0400488_49339 | 3300038741 | Bacteria | 2420 |
| 346 | Ga0400486_08699 | 3300038742 | Bacteria | 7367 |
| 347 | Ga0400486_17653 | 3300038742 | Bacteria | 15574 |
| 348 | Ga0400486_22493 | 3300038742 | Bacteria | 147980 |
| 349 | Ga0400483_044668 | 3300039062 | Bacteria | 5549 |
| 350 | Ga0400483_059624 | 3300039062 | Bacteria | 2119 |
| 351 | Ga0400483_139193 | 3300039062 | Bacteria | 15235 |
| 352 | Ga0400483_145468 | 3300039062 | Bacteria | 4222 |
| 353 | Ga0400483_171382 | 3300039062 | Bacteria | 12054 |
| 354 | Ga0400483_195420 | 3300039062 | Bacteria | 7506 |
| 355 | Ga0400483_239719 | 3300039062 | Bacteria | 8876 |
| 356 | Ga0400483_269989 | 3300039062 | Bacteria | 6782 |
| 357 | Ga0400487_27800 | 3300039110 | Bacteria | 73851 |
| 358 | Ga0400487_54161 | 3300039110 | Bacteria | 50571 |
| 359 | Ga0436365_0727636 | 3300039437 | Bacteria | 99848 |
| 360 | Ga0439438_000001 | 3300041405 | Bacteria | 1263568 |
| 361 | Ga0439447_000496 | 3300041407 | Bacteria | 14645 |
| 362 | Ga0439447_008932 | 3300041407 | Bacteria | 3073 |
| 363 | Ga0439466_0000003 | 3300041411 | Bacteria | 486229 |
| 364 | Ga0451853_3565153 | 3300041512 | Bacteria | 3395 |
| 365 | Ga0439432_001341 | 3300042006 | Bacteria | 9318 |
| 366 | Ga0439432_012730 | 3300042006 | Bacteria | 2871 |
| 367 | Ga0439452_000001 | 3300042010 | Bacteria | 1725439 |
| 368 | Ga0439452_000003 | 3300042010 | Bacteria | 942815 |
| 369 | Ga0439452_000924 | 3300042010 | Bacteria | 13287 |
| 370 | Ga0439463_001202 | 3300042016 | Bacteria | 6912 |
| 371 | Ga0439463_002195 | 3300042016 | Bacteria | 5030 |
| 372 | Ga0450907_002033 | 3300042146 | Bacteria | 4030 |
| 373 | Ga0466981_0000098 | 3300044669 | Bacteria | 21564 |
| 374 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 375 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 376 | Ga0495627_010254 | 3300046453 | Bacteria | 3413 |
| 377 | Ga0495591_000009 | 3300046458 | Bacteria | 331626 |
| 378 | Ga0495591_000011 | 3300046458 | Bacteria | 309685 |
| 379 | Ga0495591_000080 | 3300046458 | Bacteria | 107876 |
| 380 | Ga0495591_002337 | 3300046458 | Bacteria | 10682 |
| 381 | Ga0495591_004267 | 3300046458 | Bacteria | 7075 |
| 382 | Ga0495591_004770 | 3300046458 | Bacteria | 6487 |
| 383 | Ga0495653_0013811 | 3300046463 | Bacteria | 6580 |
| 384 | Ga0495650_0000016 | 3300046471 | Bacteria | 554693 |
| 385 | Ga0495650_0000033 | 3300046471 | Bacteria | 412188 |
| 386 | Ga0495650_0000153 | 3300046471 | Bacteria | 156161 |
| 387 | Ga0495650_0000581 | 3300046471 | Bacteria | 51097 |
| 388 | Ga0495650_0002020 | 3300046471 | Bacteria | 17796 |
| 389 | Ga0495580_0002303 | 3300046472 | Bacteria | 16664 |
| 390 | Ga0495605_0000142 | 3300046474 | Bacteria | 92755 |
| 391 | Ga0495605_0001220 | 3300046474 | Bacteria | 17115 |
| 392 | Ga0495605_0008951 | 3300046474 | Bacteria | 5640 |
| 393 | Ga0495584_0017970 | 3300046491 | Bacteria | 3595 |
| 394 | Ga0495585_0003413 | 3300046492 | Bacteria | 10750 |
| 395 | Ga0495585_0012507 | 3300046492 | Bacteria | 4999 |
| 396 | Ga0495596_0001342 | 3300046500 | Bacteria | 14166 |
| 397 | Ga0495607_0000105 | 3300046501 | Bacteria | 88629 |
| 398 | Ga0495607_0000677 | 3300046501 | Bacteria | 32941 |
| 399 | Ga0495607_0010742 | 3300046501 | Bacteria | 6133 |
| 400 | Ga0495583_0000322 | 3300046506 | Bacteria | 75510 |
| 401 | Ga0495583_0000499 | 3300046506 | Bacteria | 56843 |
| 402 | Ga0495583_0001458 | 3300046506 | Bacteria | 23876 |
| 403 | Ga0495583_0001787 | 3300046506 | Bacteria | 20439 |
| 404 | Ga0495606_0000206 | 3300046507 | Bacteria | 103708 |
| 405 | Ga0495606_0000325 | 3300046507 | Bacteria | 82283 |
| 406 | Ga0495606_0007320 | 3300046507 | Bacteria | 9929 |
| 407 | Ga0495606_0013109 | 3300046507 | Bacteria | 6582 |
| 408 | Ga0495606_0021350 | 3300046507 | Bacteria | 4743 |
| 409 | Ga0495620_0000737 | 3300046515 | Bacteria | 20139 |
| 410 | Ga0495620_0000959 | 3300046515 | Bacteria | 17764 |
| 411 | Ga0495632_0000190 | 3300046519 | Bacteria | 62298 |
| 412 | Ga0495632_0004112 | 3300046519 | Bacteria | 10020 |
| 413 | Ga0495632_0006621 | 3300046519 | Bacteria | 7411 |
| 414 | Ga0495632_0038297 | 3300046519 | Bacteria | 2429 |
| 415 | Ga0495637_0000055 | 3300046520 | Bacteria | 99324 |
| 416 | Ga0495637_0000591 | 3300046520 | Bacteria | 25893 |
| 417 | Ga0495643_0007219 | 3300046522 | Bacteria | 7201 |
| 418 | Ga0495644_0000933 | 3300046523 | Bacteria | 12146 |
| 419 | Ga0495644_0005099 | 3300046523 | Bacteria | 5140 |
| 420 | Ga0495648_0000219 | 3300046524 | Bacteria | 65619 |
| 421 | Ga0495648_0004944 | 3300046524 | Bacteria | 11205 |
| 422 | Ga0495648_0021358 | 3300046524 | Bacteria | 4484 |
| 423 | Ga0495654_0000125 | 3300046530 | Bacteria | 85809 |
| 424 | Ga0495654_0000493 | 3300046530 | Bacteria | 32495 |
| 425 | Ga0495654_0000599 | 3300046530 | Bacteria | 28667 |
| 426 | Ga0495654_0005581 | 3300046530 | Bacteria | 7283 |
| 427 | Ga0495654_0031797 | 3300046530 | Bacteria | 2677 |
| 428 | Ga0495587_0047848 | 3300046536 | Bacteria | 2535 |
| 429 | Ga0495609_0000090 | 3300046538 | Bacteria | 106600 |
| 430 | Ga0495597_0001470 | 3300046542 | Bacteria | 16895 |
| 431 | Ga0495668_0010851 | 3300046616 | Bacteria | 5486 |
| 432 | Ga0495668_0035552 | 3300046616 | Bacteria | 2792 |
| 433 | Ga0495611_0000801 | 3300046648 | Bacteria | 17446 |
| 434 | Ga0495611_0009172 | 3300046648 | Bacteria | 4178 |
| 435 | Ga0495625_0000062 | 3300046660 | Bacteria | 176748 |
| 436 | Ga0495625_0043223 | 3300046660 | Bacteria | 3269 |
| 437 | Ga0495661_0000061 | 3300046665 | Bacteria | 130811 |
| 438 | Ga0495661_0000123 | 3300046665 | Bacteria | 93482 |
| 439 | Ga0495661_0003364 | 3300046665 | Bacteria | 11849 |
| 440 | Ga0495661_0004215 | 3300046665 | Bacteria | 10445 |
| 441 | Ga0495588_0010188 | 3300046674 | Bacteria | 4362 |
| 442 | Ga0495657_0078484 | 3300046675 | Bacteria | 2140 |
| 443 | Ga0495623_0026402 | 3300046679 | Bacteria | 3739 |
| 444 | Ga0495671_0005016 | 3300046692 | Bacteria | 7798 |
| 445 | Ga0495649_0004050 | 3300046694 | Bacteria | 9650 |
| 446 | Ga0495649_0006368 | 3300046694 | Bacteria | 7346 |
| 447 | Ga0495589_0004048 | 3300046794 | Bacteria | 7857 |
| 448 | Ga0495660_0000007 | 3300046810 | Bacteria | 485295 |
| 449 | Ga0495660_0000074 | 3300046810 | Bacteria | 108390 |
| 450 | Ga0495660_0001740 | 3300046810 | Bacteria | 14519 |
| 451 | Ga0495660_0047695 | 3300046810 | Bacteria | 2344 |
| 452 | Ga0495674_0243851 | 3300047319 | Bacteria | 1480 |
| 453 | Ga0495672_0000004 | 3300047320 | Bacteria | 631810 |
| 454 | Ga0495672_0000012 | 3300047320 | Bacteria | 519975 |
| 455 | Ga0495672_0007348 | 3300047320 | Bacteria | 8305 |
| 456 | Ga0495676_0000042 | 3300047321 | Bacteria | 103741 |
| 457 | Ga0495676_0030843 | 3300047321 | Bacteria | 4542 |
| 458 | Ga0495683_0000194 | 3300047323 | Bacteria | 57773 |
| 459 | Ga0495679_000027 | 3300047446 | Bacteria | 193794 |
| 460 | Ga0495679_000032 | 3300047446 | Bacteria | 171636 |
| 461 | Ga0495673_0000022 | 3300047469 | Bacteria | 544086 |
| 462 | Ga0495673_0000023 | 3300047469 | Bacteria | 539904 |
| 463 | Ga0495673_0000227 | 3300047469 | Bacteria | 83114 |
| 464 | Ga0495673_0000813 | 3300047469 | Bacteria | 29294 |
| 465 | Ga0495673_0001429 | 3300047469 | Bacteria | 19118 |
| 466 | Ga0495673_0027138 | 3300047469 | Bacteria | 2729 |
| 467 | Ga0495681_0000845 | 3300047470 | Bacteria | 23614 |
| 468 | Ga0495686_0008307 | 3300047472 | Bacteria | 7634 |
| 469 | Ga0495626_0000062 | 3300048091 | Bacteria | 143269 |
| 470 | Ga0496100_0044163 | 3300048903 | Bacteria | 2853 |
| 471 | Ga0496100_0069901 | 3300048903 | Bacteria | 2339 |
| 472 | Ga0496100_0078246 | 3300048903 | Bacteria | 2226 |
| 473 | Ga0496101_0000029 | 3300048904 | Bacteria | 198515 |
| 474 | Ga0496101_0042580 | 3300048904 | Bacteria | 3241 |
| 475 | Ga0496102_0016198 | 3300048905 | Bacteria | 6514 |
| 476 | Ga0496102_0032078 | 3300048905 | Bacteria | 4718 |
| 477 | Ga0496102_0093401 | 3300048905 | Bacteria | 2787 |
| 478 | Ga0496103_0013659 | 3300048906 | Bacteria | 4817 |
| 479 | Ga0496104_0001318 | 3300048907 | Bacteria | 21417 |
| 480 | Ga0496104_0006179 | 3300048907 | Bacteria | 10518 |
| 481 | Ga0496104_0043968 | 3300048907 | Bacteria | 4197 |
| 482 | Ga0496104_0076869 | 3300048907 | Bacteria | 3180 |
| 483 | Ga0496105_0011013 | 3300048908 | Bacteria | 7128 |
| 484 | Ga0496105_0083802 | 3300048908 | Bacteria | 2633 |
| 485 | Ga0496106_0102750 | 3300048909 | Bacteria | 2218 |
| 486 | Ga0496107_0009155 | 3300048910 | Bacteria | 6865 |
| 487 | Ga0496108_0012408 | 3300048911 | Bacteria | 6934 |
| 488 | Ga0496108_0143290 | 3300048911 | Bacteria | 2059 |
| 489 | Ga0496110_0020876 | 3300048913 | Bacteria | 5534 |
| 490 | Ga0496111_0003616 | 3300048914 | Bacteria | 9585 |
| 491 | Ga0496112_0017773 | 3300048915 | Bacteria | 6692 |
| 492 | Ga0496112_0051738 | 3300048915 | Bacteria | 4029 |
| 493 | Ga0496113_0015943 | 3300048916 | Bacteria | 5181 |
| 494 | Ga0496113_0114002 | 3300048916 | Bacteria | 2107 |
| 495 | Ga0496114_0004914 | 3300048917 | Bacteria | 10412 |
| 496 | Ga0496114_0107403 | 3300048917 | Bacteria | 2388 |
| 497 | Ga0496115_0015702 | 3300048918 | Bacteria | 5750 |
| 498 | Ga0496115_0057491 | 3300048918 | Bacteria | 3129 |
| 499 | Ga0496116_0000127 | 3300048919 | Bacteria | 158773 |
| 500 | Ga0496116_0000226 | 3300048919 | Bacteria | 104792 |
| 501 | Ga0496116_0000572 | 3300048919 | Bacteria | 49208 |
| 502 | Ga0496116_0008821 | 3300048919 | Bacteria | 8686 |
| 503 | Ga0496116_0014235 | 3300048919 | Bacteria | 6365 |
| 504 | Ga0496116_0026596 | 3300048919 | Bacteria | 4227 |
| 505 | Ga0496116_0057812 | 3300048919 | Bacteria | 2532 |
| 506 | Ga0496117_0000004 | 3300048920 | Bacteria | 877131 |
| 507 | Ga0496117_0000156 | 3300048920 | Bacteria | 145285 |
| 508 | Ga0496117_0000180 | 3300048920 | Bacteria | 128746 |
| 509 | Ga0496117_0005651 | 3300048920 | Bacteria | 13047 |
| 510 | Ga0496117_0014392 | 3300048920 | Bacteria | 6819 |
| 511 | Ga0496117_0020878 | 3300048920 | Bacteria | 5325 |
| 512 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 513 | Ga0496118_0000024 | 3300048921 | Bacteria | 385236 |
| 514 | Ga0496118_0004392 | 3300048921 | Bacteria | 16755 |
| 515 | Ga0496118_0007231 | 3300048921 | Bacteria | 11845 |
| 516 | Ga0496118_0018065 | 3300048921 | Bacteria | 6382 |
| 517 | Ga0496118_0072355 | 3300048921 | Bacteria | 2476 |
| 518 | Ga0496118_0128651 | 3300048921 | Bacteria | 1631 |
| 519 | Ga0496118_0140812 | 3300048921 | Bacteria | 1529 |
| 520 | Ga0496119_0000524 | 3300048922 | Bacteria | 52149 |
| 521 | Ga0496119_0002597 | 3300048922 | Bacteria | 19610 |
| 522 | Ga0496119_0007945 | 3300048922 | Bacteria | 9439 |
| 523 | Ga0496119_0016218 | 3300048922 | Bacteria | 5687 |
| 524 | Ga0496119_0020185 | 3300048922 | Bacteria | 4868 |
| 525 | Ga0496119_0057976 | 3300048922 | Bacteria | 2337 |
| 526 | Ga0496120_0000009 | 3300048923 | Bacteria | 386727 |
| 527 | Ga0496120_0000014 | 3300048923 | Bacteria | 323163 |
| 528 | Ga0496120_0000043 | 3300048923 | Bacteria | 195584 |
| 529 | Ga0496120_0001541 | 3300048923 | Bacteria | 27015 |
| 530 | Ga0496120_0003009 | 3300048923 | Bacteria | 15982 |
| 531 | Ga0496120_0003653 | 3300048923 | Bacteria | 13782 |
| 532 | Ga0496120_0006066 | 3300048923 | Bacteria | 9389 |
| 533 | Ga0496120_0008215 | 3300048923 | Bacteria | 7637 |
| 534 | Ga0496120_0015232 | 3300048923 | Bacteria | 5082 |
| 535 | Ga0496120_0027574 | 3300048923 | Bacteria | 3490 |
| 536 | Ga0496120_0053641 | 3300048923 | Bacteria | 2289 |
| 537 | Ga0496121_0000185 | 3300048924 | Bacteria | 138586 |
| 538 | Ga0496121_0002628 | 3300048924 | Bacteria | 27099 |
| 539 | Ga0496121_0002922 | 3300048924 | Bacteria | 25030 |
| 540 | Ga0496121_0009103 | 3300048924 | Bacteria | 11490 |
| 541 | Ga0496121_0015706 | 3300048924 | Bacteria | 7892 |
| 542 | Ga0496121_0032053 | 3300048924 | Bacteria | 4785 |
| 543 | Ga0496121_0110086 | 3300048924 | Bacteria | 2102 |
| 544 | Ga0496122_0000013 | 3300048925 | Bacteria | 501039 |
| 545 | Ga0496122_0000026 | 3300048925 | Bacteria | 360871 |
| 546 | Ga0496122_0000667 | 3300048925 | Bacteria | 69054 |
| 547 | Ga0496122_0000796 | 3300048925 | Bacteria | 60440 |
| 548 | Ga0496122_0006414 | 3300048925 | Bacteria | 13516 |
| 549 | Ga0496122_0010913 | 3300048925 | Bacteria | 9291 |
| 550 | Ga0496122_0012528 | 3300048925 | Bacteria | 8429 |
| 551 | Ga0496123_0000005 | 3300048926 | Bacteria | 658131 |
| 552 | Ga0496123_0000010 | 3300048926 | Bacteria | 501039 |
| 553 | Ga0496123_0000163 | 3300048926 | Bacteria | 133536 |
| 554 | Ga0496123_0000599 | 3300048926 | Bacteria | 61266 |
| 555 | Ga0496123_0000621 | 3300048926 | Bacteria | 59502 |
| 556 | Ga0496123_0004145 | 3300048926 | Bacteria | 15498 |
| 557 | Ga0496123_0004462 | 3300048926 | Bacteria | 14683 |
| 558 | Ga0496123_0010990 | 3300048926 | Bacteria | 7912 |
| 559 | Ga0496123_0018984 | 3300048926 | Bacteria | 5435 |
| 560 | Ga0496123_0026914 | 3300048926 | Bacteria | 4296 |
| 561 | Ga0496124_0000224 | 3300048927 | Bacteria | 110603 |
| 562 | Ga0496124_0000259 | 3300048927 | Bacteria | 101764 |
| 563 | Ga0496124_0002320 | 3300048927 | Bacteria | 25093 |
| 564 | Ga0496124_0002333 | 3300048927 | Bacteria | 25044 |
| 565 | Ga0496124_0004077 | 3300048927 | Bacteria | 17299 |
| 566 | Ga0496124_0005214 | 3300048927 | Bacteria | 14755 |
| 567 | Ga0496124_0010575 | 3300048927 | Bacteria | 9331 |
| 568 | Ga0496124_0016619 | 3300048927 | Bacteria | 6983 |
| 569 | Ga0496124_0047403 | 3300048927 | Bacteria | 3677 |
| 570 | Ga0496124_0097027 | 3300048927 | Bacteria | 2393 |
| 571 | Ga0496124_0097802 | 3300048927 | Bacteria | 2382 |
| 572 | Ga0496125_0000016 | 3300048928 | Bacteria | 512512 |
| 573 | Ga0496125_0000019 | 3300048928 | Bacteria | 474989 |
| 574 | Ga0496126_0000680 | 3300048929 | Bacteria | 62501 |
| 575 | Ga0496126_0002546 | 3300048929 | Bacteria | 24392 |
| 576 | Ga0496126_0028193 | 3300048929 | Bacteria | 5353 |
| 577 | Ga0496126_0052308 | 3300048929 | Bacteria | 3713 |
| 578 | Ga0496126_0072648 | 3300048929 | Bacteria | 3059 |
| 579 | Ga0495678_000043 | 3300049459 | Bacteria | 172593 |
| 580 | Ga0495678_000828 | 3300049459 | Bacteria | 27727 |
| 581 | Ga0495678_005192 | 3300049459 | Bacteria | 7281 |
| 582 | Ga0495682_0000026 | 3300049460 | Bacteria | 144529 |
| 583 | Ga0495682_0000096 | 3300049460 | Bacteria | 77498 |
| 584 | Ga0495682_0009796 | 3300049460 | Bacteria | 3730 |
| 585 | Ga0501032_0053161 | 3300049569 | Bacteria | 2728 |
| 586 | Ga0501033_0009400 | 3300049570 | Bacteria | 7528 |
| 587 | Ga0501033_0035651 | 3300049570 | Bacteria | 3729 |
| 588 | Ga0501034_0217223 | 3300049571 | Bacteria | 1865 |
| 589 | Ga0501036_0005174 | 3300049572 | Bacteria | 10546 |
| 590 | Ga0501037_0091553 | 3300049573 | Bacteria | 2199 |
| 591 | Ga0501038_0002891 | 3300049574 | Bacteria | 16020 |
| 592 | Ga0501038_0007559 | 3300049574 | Bacteria | 10019 |
| 593 | Ga0501039_0008375 | 3300049575 | Bacteria | 7878 |
| 594 | Ga0501046_0000911 | 3300049580 | Bacteria | 28909 |
| 595 | Ga0501047_0003232 | 3300049581 | Bacteria | 15448 |
| 596 | Ga0501047_0007271 | 3300049581 | Bacteria | 10407 |
| 597 | Ga0501047_0023442 | 3300049581 | Bacteria | 5925 |
| 598 | Ga0501047_0033222 | 3300049581 | Bacteria | 4980 |
| 599 | Ga0501048_0020709 | 3300049582 | Bacteria | 4821 |
| 600 | Ga0501048_0045342 | 3300049582 | Bacteria | 3140 |
| 601 | Ga0501067_0001068 | 3300049583 | Bacteria | 14777 |
| 602 | Ga0501069_0002056 | 3300049585 | Bacteria | 10108 |
| 603 | Ga0501069_0012736 | 3300049585 | Bacteria | 4477 |
| 604 | Ga0501070_0000110 | 3300049586 | Bacteria | 72071 |
| 605 | Ga0501070_0003063 | 3300049586 | Bacteria | 14557 |
| 606 | Ga0501073_0067640 | 3300049589 | Bacteria | 2490 |
| 607 | Ga0501074_0096593 | 3300049590 | Bacteria | 2115 |
| 608 | Ga0501077_0066101 | 3300049593 | Bacteria | 2294 |
| 609 | Ga0501079_0005199 | 3300049741 | Bacteria | 9673 |
| 610 | Ga0501080_0064253 | 3300049742 | Bacteria | 3414 |
| 611 | Ga0501080_0073449 | 3300049742 | Bacteria | 3182 |
| 612 | Ga0501080_0188888 | 3300049742 | Bacteria | 1893 |
| 613 | Ga0501083_0002409 | 3300049744 | Bacteria | 12787 |
| 614 | Ga0501083_0020350 | 3300049744 | Bacteria | 4616 |
| 615 | Ga0501035_0002718 | 3300049822 | Bacteria | 17190 |
| 616 | Ga0501044_0001134 | 3300049823 | Bacteria | 31657 |
| 617 | Ga0501044_0071185 | 3300049823 | Bacteria | 3536 |
| 618 | Ga0501044_0150755 | 3300049823 | Bacteria | 2307 |
| 619 | Ga0501044_0164241 | 3300049823 | Bacteria | 2195 |
| 620 | nmdc:mga00v17_29080_c1 | 3300050491 | Bacteria | 3241 |
| 621 | nmdc:mga00v17_5777_c1 | 3300050491 | Bacteria | 6536 |
| 622 | nmdc:mga0n895_62253_c1 | 3300050512 | Bacteria | 3687 |
| 623 | nmdc:mga08x19_26679_c1 | 3300050514 | Bacteria | 3605 |
| 624 | nmdc:mga08x19_80_c1 | 3300050514 | Bacteria | 87696 |
| 625 | Ga0495601_0036273 | 3300053077 | Bacteria | 3078 |
| 626 | Ga0500583_0027435 | 3300053092 | Bacteria | 2458 |
| 627 | Ga0500621_000001 | 3300053126 | Bacteria | 1049698 |
| 628 | Ga0500637_0023296 | 3300053178 | Bacteria | 3384 |
| 629 | Ga0501084_0052916 | 3300054114 | Bacteria | 3396 |
| 630 | Ga0501082_0016188 | 3300060353 | Bacteria | 6418 |
| 631 | Ga0501082_0050459 | 3300060353 | Bacteria | 3588 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0008375 | Ga0501039_0008375_10_1440 | 444 |
| 2 | 3300047319 | Ga0495674_0243851 | Ga0495674_0243851_17_1447 | 459 |
| 3 | 3300048903 | Ga0496100_0078246 | Ga0496100_0078246_18_1466 | 462 |
| 4 | 3300048929 | Ga0496126_0000680 | Ga0496126_0000680_42129_43643 | 466 |
| 5 | 3300053077 | Ga0495601_0036273 | Ga0495601_0036273_1581_3062 | 467 |
| 6 | 3300035724 | Ga0373933_0134836 | Ga0373933_0134836_42_1505 | 470 |
| 7 | 3300028800 | Ga0265338_10005866 | Ga0265338_1000586611 | 473 |
| 8 | 3300025261 | Ga0209233_1015805 | Ga0209233_10158052 | 478 |
| 9 | 3300035086 | Ga0373934_0009038 | Ga0373934_0009038_951_2510 | 479 |
| 10 | 3300046675 | Ga0495657_0078484 | Ga0495657_0078484_477_2102 | 479 |
| 11 | 3300005366 | Ga0070659_100007694 | Ga0070659_1000076947 | 480 |
| 12 | 3300025932 | Ga0207690_10091469 | Ga0207690_100914692 | 480 |
| 13 | 3300048907 | Ga0496104_0076869 | Ga0496104_0076869_829_2373 | 480 |
| 14 | 3300049569 | Ga0501032_0053161 | Ga0501032_0053161_11_1561 | 480 |
| 15 | 3300049570 | Ga0501033_0009400 | Ga0501033_0009400_5365_6915 | 480 |
| 16 | 3300049572 | Ga0501036_0005174 | Ga0501036_0005174_3328_4878 | 480 |
| 17 | 3300049574 | Ga0501038_0002891 | Ga0501038_0002891_12722_14272 | 480 |
| 18 | 3300049580 | Ga0501046_0000911 | Ga0501046_0000911_6375_7925 | 480 |
| 19 | 3300049581 | Ga0501047_0007271 | Ga0501047_0007271_3432_4982 | 480 |
| 20 | 3300049582 | Ga0501048_0045342 | Ga0501048_0045342_1296_2846 | 480 |
| 21 | 3300049583 | Ga0501067_0001068 | Ga0501067_0001068_5669_7219 | 480 |
| 22 | 3300049585 | Ga0501069_0002056 | Ga0501069_0002056_5504_7054 | 480 |
| 23 | 3300049586 | Ga0501070_0003063 | Ga0501070_0003063_3201_4751 | 480 |
| 24 | 3300049590 | Ga0501074_0096593 | Ga0501074_0096593_186_1736 | 480 |
| 25 | 3300049744 | Ga0501083_0020350 | Ga0501083_0020350_1319_2869 | 480 |
| 26 | 3300031250 | Ga0265331_10002109 | Ga0265331_100021091 | 481 |
| 27 | 3300031251 | Ga0265327_10000076 | Ga0265327_100000765 | 481 |
| 28 | 3300038741 | Ga0400488_32056 | Ga0400488_32056_20_1474 | 483 |
| 29 | 3300046536 | Ga0495587_0047848 | Ga0495587_0047848_65_1621 | 488 |
| 30 | 3300046679 | Ga0495623_0026402 | Ga0495623_0026402_1109_2836 | 488 |
| 31 | 3300009176 | Ga0105242_10026325 | Ga0105242_100263255 | 489 |
| 32 | 3300049581 | Ga0501047_0023442 | Ga0501047_0023442_1909_3471 | 489 |
| 33 | 3300049589 | Ga0501073_0067640 | Ga0501073_0067640_724_2286 | 489 |
| 34 | 3300049742 | Ga0501080_0064253 | Ga0501080_0064253_1785_3347 | 489 |
| 35 | 3300049744 | Ga0501083_0002409 | Ga0501083_0002409_9444_11009 | 489 |
| 36 | 3300005367 | Ga0070667_100000043 | Ga0070667_10000004318 | 490 |
| 37 | 3300009092 | Ga0105250_10038056 | Ga0105250_100380562 | 490 |
| 38 | 3300009101 | Ga0105247_10005233 | Ga0105247_100052338 | 490 |
| 39 | 3300025900 | Ga0207710_10005583 | Ga0207710_100055837 | 490 |
| 40 | 3300025986 | Ga0207658_10000192 | Ga0207658_1000019218 | 490 |
| 41 | 3300038741 | Ga0400488_49339 | Ga0400488_49339_919_2394 | 490 |
| 42 | 3300049581 | Ga0501047_0033222 | Ga0501047_0033222_693_2252 | 490 |
| 43 | 3300005336 | Ga0070680_100000408 | Ga0070680_10000040812 | 491 |
| 44 | 3300005458 | Ga0070681_10000003 | Ga0070681_10000003217 | 491 |
| 45 | 3300005530 | Ga0070679_100000541 | Ga0070679_1000005418 | 491 |
| 46 | 3300005563 | Ga0068855_100021482 | Ga0068855_1000214828 | 491 |
| 47 | 3300009093 | Ga0105240_10000287 | Ga0105240_1000028746 | 491 |
| 48 | 3300009093 | Ga0105240_10005351 | Ga0105240_100053516 | 491 |
| 49 | 3300010375 | Ga0105239_10012041 | Ga0105239_100120417 | 491 |
| 50 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001836 | 491 |
| 51 | 3300025913 | Ga0207695_10001005 | Ga0207695_1000100531 | 491 |
| 52 | 3300025913 | Ga0207695_10004444 | Ga0207695_100044446 | 491 |
| 53 | 3300025917 | Ga0207660_10001780 | Ga0207660_100017803 | 491 |
| 54 | 3300025921 | Ga0207652_10000736 | Ga0207652_1000073619 | 491 |
| 55 | 3300025949 | Ga0207667_10112822 | Ga0207667_101128222 | 491 |
| 56 | 3300035398 | Ga0316574_0044886 | Ga0316574_0044886_817_2385 | 491 |
| 57 | 3300049581 | Ga0501047_0003232 | Ga0501047_0003232_1223_2773 | 491 |
| 58 | 3300025903 | Ga0207680_10000006 | Ga0207680_1000000628 | 493 |
| 59 | 3300031240 | Ga0265320_10001142 | Ga0265320_1000114212 | 493 |
| 60 | 3300031241 | Ga0265325_10003681 | Ga0265325_100036815 | 493 |
| 61 | 3300048923 | Ga0496120_0000014 | Ga0496120_0000014_270772_272382 | 493 |
| 62 | 3300048929 | Ga0496126_0052308 | Ga0496126_0052308_263_1837 | 493 |
| 63 | 3300028577 | Ga0265318_10006809 | Ga0265318_100068097 | 494 |
| 64 | 3300031250 | Ga0265331_10007523 | Ga0265331_100075234 | 494 |
| 65 | 3300031595 | Ga0265313_10001646 | Ga0265313_1000164610 | 494 |
| 66 | 3300031595 | Ga0265313_10005442 | Ga0265313_100054428 | 494 |
| 67 | 3300048921 | Ga0496118_0140812 | Ga0496118_0140812_20_1504 | 494 |
| 68 | 3300049570 | Ga0501033_0035651 | Ga0501033_0035651_1520_3049 | 494 |
| 69 | 3300049582 | Ga0501048_0020709 | Ga0501048_0020709_3195_4724 | 494 |
| 70 | 3300049823 | Ga0501044_0071185 | Ga0501044_0071185_69_1598 | 494 |
| 71 | 3300003215 | JGI25153J46596_10003384 | JGI25153J46596_100033846 | 495 |
| 72 | 3300025297 | Ga0209758_1000036 | Ga0209758_1000036390 | 495 |
| 73 | 3300031247 | Ga0265340_10002162 | Ga0265340_1000216211 | 495 |
| 74 | 3300031249 | Ga0265339_10049844 | Ga0265339_100498443 | 495 |
| 75 | 3300031344 | Ga0265316_10151872 | Ga0265316_101518721 | 495 |
| 76 | 3300031595 | Ga0265313_10000365 | Ga0265313_1000036549 | 495 |
| 77 | 3300031712 | Ga0265342_10008325 | Ga0265342_100083256 | 495 |
| 78 | 3300005434 | Ga0070709_10000184 | Ga0070709_1000018421 | 496 |
| 79 | 3300005434 | Ga0070709_10108031 | Ga0070709_101080312 | 496 |
| 80 | 3300005539 | Ga0068853_100002126 | Ga0068853_1000021262 | 496 |
| 81 | 3300005614 | Ga0068856_100000182 | Ga0068856_10000018225 | 496 |
| 82 | 3300005614 | Ga0068856_100000276 | Ga0068856_10000027651 | 496 |
| 83 | 3300005616 | Ga0068852_100020529 | Ga0068852_1000205292 | 496 |
| 84 | 3300006175 | Ga0070712_100000026 | Ga0070712_10000002634 | 496 |
| 85 | 3300006871 | Ga0075434_100072903 | Ga0075434_1000729032 | 496 |
| 86 | 3300006914 | Ga0075436_100000063 | Ga0075436_10000006349 | 496 |
| 87 | 3300006914 | Ga0075436_100055880 | Ga0075436_1000558803 | 496 |
| 88 | 3300007076 | Ga0075435_100126749 | Ga0075435_1001267492 | 496 |
| 89 | 3300009093 | Ga0105240_10015450 | Ga0105240_100154506 | 496 |
| 90 | 3300009551 | Ga0105238_10014086 | Ga0105238_100140865 | 496 |
| 91 | 3300013100 | Ga0157373_10003329 | Ga0157373_100033295 | 496 |
| 92 | 3300013104 | Ga0157370_10029417 | Ga0157370_100294172 | 496 |
| 93 | 3300025906 | Ga0207699_10000223 | Ga0207699_1000022331 | 496 |
| 94 | 3300025913 | Ga0207695_10081311 | Ga0207695_100813113 | 496 |
| 95 | 3300025915 | Ga0207693_10000099 | Ga0207693_1000009946 | 496 |
| 96 | 3300025949 | Ga0207667_10027232 | Ga0207667_100272325 | 496 |
| 97 | 3300026041 | Ga0207639_10001724 | Ga0207639_1000172417 | 496 |
| 98 | 3300026041 | Ga0207639_10014959 | Ga0207639_100149594 | 496 |
| 99 | 3300026078 | Ga0207702_10000148 | Ga0207702_1000014884 | 496 |
| 100 | 3300026078 | Ga0207702_10004501 | Ga0207702_1000450110 | 496 |
| 101 | 3300028577 | Ga0265318_10009576 | Ga0265318_100095764 | 496 |
| 102 | 3300028800 | Ga0265338_10013556 | Ga0265338_100135565 | 496 |
| 103 | 3300031239 | Ga0265328_10011367 | Ga0265328_100113674 | 496 |
| 104 | 3300031241 | Ga0265325_10007971 | Ga0265325_100079716 | 496 |
| 105 | 3300031242 | Ga0265329_10005285 | Ga0265329_100052854 | 496 |
| 106 | 3300031249 | Ga0265339_10017287 | Ga0265339_100172874 | 496 |
| 107 | 3300031250 | Ga0265331_10001884 | Ga0265331_1000188412 | 496 |
| 108 | 3300031344 | Ga0265316_10011748 | Ga0265316_100117484 | 496 |
| 109 | 3300031507 | Ga0307509_10145012 | Ga0307509_101450122 | 496 |
| 110 | 3300031595 | Ga0265313_10014638 | Ga0265313_100146384 | 496 |
| 111 | 3300031711 | Ga0265314_10004456 | Ga0265314_100044565 | 496 |
| 112 | 3300031711 | Ga0265314_10056460 | Ga0265314_100564602 | 496 |
| 113 | 3300031712 | Ga0265342_10005490 | Ga0265342_100054909 | 496 |
| 114 | 3300050512 | nmdc:mga0n895_62253_c1 | nmdc:mga0n895_62253_c1_1343_2896 | 496 |
| 115 | 3300050514 | nmdc:mga08x19_26679_c1 | nmdc:mga08x19_26679_c1_1287_2840 | 496 |
| 116 | 3300050514 | nmdc:mga08x19_80_c1 | nmdc:mga08x19_80_c1_8326_9879 | 496 |
| 117 | 3300053092 | Ga0500583_0027435 | Ga0500583_0027435_195_1760 | 496 |
| 118 | 3300005295 | Ga0065707_10082478 | Ga0065707_100824789 | 497 |
| 119 | 3300014968 | Ga0157379_10010119 | Ga0157379_100101193 | 497 |
| 120 | 3300031507 | Ga0307509_10000022 | Ga0307509_10000022170 | 497 |
| 121 | 3300053178 | Ga0500637_0023296 | Ga0500637_0023296_889_2430 | 497 |
| 122 | 3300031456 | Ga0307513_10084284 | Ga0307513_100842843 | 498 |
| 123 | 3300035691 | Ga0373931_0014449 | Ga0373931_0014449_1736_3304 | 498 |
| 124 | 3300005841 | Ga0068863_100001860 | Ga0068863_10000186022 | 499 |
| 125 | 3300005843 | Ga0068860_100000185 | Ga0068860_1000001853 | 499 |
| 126 | 3300025903 | Ga0207680_10043528 | Ga0207680_100435283 | 499 |
| 127 | 3300025986 | Ga0207658_10066340 | Ga0207658_100663403 | 499 |
| 128 | 3300026088 | Ga0207641_10000177 | Ga0207641_1000017744 | 499 |
| 129 | 3300028381 | Ga0268264_10000088 | Ga0268264_10000088115 | 499 |
| 130 | 3300031235 | Ga0265330_10004426 | Ga0265330_100044264 | 499 |
| 131 | 3300031247 | Ga0265340_10022680 | Ga0265340_100226803 | 499 |
| 132 | 3300031595 | Ga0265313_10004103 | Ga0265313_1000410313 | 499 |
| 133 | 3300031712 | Ga0265342_10006956 | Ga0265342_100069562 | 499 |
| 134 | 3300036647 | Ga0316582_0017380 | Ga0316582_0017380_2572_4143 | 499 |
| 135 | 3300044712 | Ga0453684_0000136 | Ga0453684_0000136_69599_71173 | 499 |
| 136 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_356718_358292 | 499 |
| 137 | 3300048905 | Ga0496102_0016198 | Ga0496102_0016198_2338_3933 | 499 |
| 138 | 3300048920 | Ga0496117_0000156 | Ga0496117_0000156_23271_24866 | 499 |
| 139 | 3300048921 | Ga0496118_0000005 | Ga0496118_0000005_57692_59287 | 499 |
| 140 | 3300048923 | Ga0496120_0027574 | Ga0496120_0027574_1409_3004 | 499 |
| 141 | 3300048924 | Ga0496121_0110086 | Ga0496121_0110086_87_1682 | 499 |
| 142 | 3300049742 | Ga0501080_0073449 | Ga0501080_0073449_1134_2696 | 499 |
| 143 | 3300060353 | Ga0501082_0016188 | Ga0501082_0016188_4831_6393 | 499 |
| 144 | 3300005842 | Ga0068858_100107818 | Ga0068858_1001078183 | 500 |
| 145 | 3300009545 | Ga0105237_10154950 | Ga0105237_101549502 | 500 |
| 146 | 3300013296 | Ga0157374_10005805 | Ga0157374_100058055 | 500 |
| 147 | 3300014325 | Ga0163163_10076754 | Ga0163163_100767542 | 500 |
| 148 | 3300014968 | Ga0157379_10045788 | Ga0157379_100457883 | 500 |
| 149 | 3300025294 | Ga0209025_1000585 | Ga0209025_100058523 | 500 |
| 150 | 3300025297 | Ga0209758_1003539 | Ga0209758_10035399 | 500 |
| 151 | 3300025728 | Ga0207655_1000023 | Ga0207655_1000023170 | 500 |
| 152 | 3300025915 | Ga0207693_10000334 | Ga0207693_1000033418 | 500 |
| 153 | 3300026078 | Ga0207702_10036005 | Ga0207702_100360053 | 500 |
| 154 | 3300031239 | Ga0265328_10011823 | Ga0265328_100118234 | 500 |
| 155 | 3300048904 | Ga0496101_0042580 | Ga0496101_0042580_507_2066 | 500 |
| 156 | 3300049593 | Ga0501077_0066101 | Ga0501077_0066101_526_2088 | 500 |
| 157 | 3300005330 | Ga0070690_100019111 | Ga0070690_1000191112 | 501 |
| 158 | 3300005331 | Ga0070670_100028503 | Ga0070670_1000285032 | 501 |
| 159 | 3300005335 | Ga0070666_10027464 | Ga0070666_100274643 | 501 |
| 160 | 3300005335 | Ga0070666_10030479 | Ga0070666_100304793 | 501 |
| 161 | 3300005340 | Ga0070689_100066496 | Ga0070689_1000664962 | 501 |
| 162 | 3300005355 | Ga0070671_100002529 | Ga0070671_1000025294 | 501 |
| 163 | 3300005367 | Ga0070667_100019370 | Ga0070667_1000193704 | 501 |
| 164 | 3300005367 | Ga0070667_100069642 | Ga0070667_1000696423 | 501 |
| 165 | 3300005466 | Ga0070685_10061141 | Ga0070685_100611412 | 501 |
| 166 | 3300005535 | Ga0070684_100036941 | Ga0070684_1000369413 | 501 |
| 167 | 3300005544 | Ga0070686_100007898 | Ga0070686_1000078982 | 501 |
| 168 | 3300005548 | Ga0070665_100010430 | Ga0070665_1000104303 | 501 |
| 169 | 3300005548 | Ga0070665_100015224 | Ga0070665_1000152242 | 501 |
| 170 | 3300005564 | Ga0070664_100001502 | Ga0070664_1000015029 | 501 |
| 171 | 3300005617 | Ga0068859_100027497 | Ga0068859_1000274974 | 501 |
| 172 | 3300005618 | Ga0068864_100038174 | Ga0068864_1000381744 | 501 |
| 173 | 3300005843 | Ga0068860_100004398 | Ga0068860_1000043984 | 501 |
| 174 | 3300005843 | Ga0068860_100160076 | Ga0068860_1001600762 | 501 |
| 175 | 3300006237 | Ga0097621_100008048 | Ga0097621_1000080483 | 501 |
| 176 | 3300006358 | Ga0068871_100056797 | Ga0068871_1000567972 | 501 |
| 177 | 3300006931 | Ga0097620_100027497 | Ga0097620_1000274974 | 501 |
| 178 | 3300009098 | Ga0105245_10005574 | Ga0105245_100055749 | 501 |
| 179 | 3300009101 | Ga0105247_10001108 | Ga0105247_100011088 | 501 |
| 180 | 3300009177 | Ga0105248_10021653 | Ga0105248_100216533 | 501 |
| 181 | 3300009551 | Ga0105238_10018343 | Ga0105238_100183434 | 501 |
| 182 | 3300010375 | Ga0105239_10027113 | Ga0105239_100271134 | 501 |
| 183 | 3300011119 | Ga0105246_10002049 | Ga0105246_100020492 | 501 |
| 184 | 3300013306 | Ga0163162_10012254 | Ga0163162_100122543 | 501 |
| 185 | 3300013307 | Ga0157372_10074215 | Ga0157372_100742153 | 501 |
| 186 | 3300013308 | Ga0157375_10021458 | Ga0157375_100214584 | 501 |
| 187 | 3300014968 | Ga0157379_10012676 | Ga0157379_100126763 | 501 |
| 188 | 3300025931 | Ga0207644_10058010 | Ga0207644_100580102 | 501 |
| 189 | 3300025941 | Ga0207711_10008066 | Ga0207711_100080664 | 501 |
| 190 | 3300025941 | Ga0207711_10041351 | Ga0207711_100413513 | 501 |
| 191 | 3300025942 | Ga0207689_10096362 | Ga0207689_100963623 | 501 |
| 192 | 3300025986 | Ga0207658_10033089 | Ga0207658_100330894 | 501 |
| 193 | 3300026035 | Ga0207703_10077994 | Ga0207703_100779942 | 501 |
| 194 | 3300026088 | Ga0207641_10067045 | Ga0207641_100670452 | 501 |
| 195 | 3300026095 | Ga0207676_10008293 | Ga0207676_100082936 | 501 |
| 196 | 3300031239 | Ga0265328_10008679 | Ga0265328_100086795 | 501 |
| 197 | 3300031250 | Ga0265331_10000141 | Ga0265331_1000014134 | 501 |
| 198 | 3300035113 | Ga0373936_0011864 | Ga0373936_0011864_711_2321 | 501 |
| 199 | 3300048908 | Ga0496105_0083802 | Ga0496105_0083802_382_1926 | 501 |
| 200 | 3300048911 | Ga0496108_0143290 | Ga0496108_0143290_176_1753 | 501 |
| 201 | 3300048915 | Ga0496112_0017773 | Ga0496112_0017773_4457_6034 | 501 |
| 202 | 3300048916 | Ga0496113_0015943 | Ga0496113_0015943_1716_3293 | 501 |
| 203 | 3300048922 | Ga0496119_0016218 | Ga0496119_0016218_198_1769 | 501 |
| 204 | 3300048923 | Ga0496120_0001541 | Ga0496120_0001541_17879_19450 | 501 |
| 205 | 3300048927 | Ga0496124_0002320 | Ga0496124_0002320_15300_16871 | 501 |
| 206 | 3300005355 | Ga0070671_100047551 | Ga0070671_1000475514 | 502 |
| 207 | 3300005436 | Ga0070713_100000882 | Ga0070713_10000088211 | 502 |
| 208 | 3300005456 | Ga0070678_100002323 | Ga0070678_1000023234 | 502 |
| 209 | 3300005843 | Ga0068860_100037638 | Ga0068860_1000376383 | 502 |
| 210 | 3300006163 | Ga0070715_10002694 | Ga0070715_100026946 | 502 |
| 211 | 3300006175 | Ga0070712_100020697 | Ga0070712_1000206973 | 502 |
| 212 | 3300006881 | Ga0068865_100016921 | Ga0068865_1000169212 | 502 |
| 213 | 3300009093 | Ga0105240_10021990 | Ga0105240_100219905 | 502 |
| 214 | 3300009098 | Ga0105245_10011980 | Ga0105245_100119803 | 502 |
| 215 | 3300009174 | Ga0105241_10025051 | Ga0105241_100250512 | 502 |
| 216 | 3300009176 | Ga0105242_10090268 | Ga0105242_100902682 | 502 |
| 217 | 3300009177 | Ga0105248_10071852 | Ga0105248_100718523 | 502 |
| 218 | 3300014968 | Ga0157379_10009588 | Ga0157379_100095882 | 502 |
| 219 | 3300046472 | Ga0495580_0002303 | Ga0495580_0002303_13039_14598 | 502 |
| 220 | 3300048903 | Ga0496100_0069901 | Ga0496100_0069901_316_1875 | 502 |
| 221 | 3300048906 | Ga0496103_0013659 | Ga0496103_0013659_1195_2754 | 502 |
| 222 | 3300048910 | Ga0496107_0009155 | Ga0496107_0009155_782_2341 | 502 |
| 223 | 3300048911 | Ga0496108_0012408 | Ga0496108_0012408_4292_5851 | 502 |
| 224 | 3300048913 | Ga0496110_0020876 | Ga0496110_0020876_3059_4618 | 502 |
| 225 | 3300048914 | Ga0496111_0003616 | Ga0496111_0003616_790_2349 | 502 |
| 226 | 3300048915 | Ga0496112_0051738 | Ga0496112_0051738_69_1628 | 502 |
| 227 | 3300048916 | Ga0496113_0114002 | Ga0496113_0114002_517_2076 | 502 |
| 228 | 3300048917 | Ga0496114_0107403 | Ga0496114_0107403_642_2201 | 502 |
| 229 | 3300048918 | Ga0496115_0015702 | Ga0496115_0015702_4083_5642 | 502 |
| 230 | 3300025728 | Ga0207655_1000042 | Ga0207655_1000042291 | 503 |
| 231 | 3300026121 | Ga0207683_10034312 | Ga0207683_100343122 | 503 |
| 232 | 3300048907 | Ga0496104_0043968 | Ga0496104_0043968_1112_2689 | 503 |
| 233 | 3300048917 | Ga0496114_0004914 | Ga0496114_0004914_325_1902 | 503 |
| 234 | 3300048918 | Ga0496115_0057491 | Ga0496115_0057491_463_2040 | 503 |
| 235 | 3300048927 | Ga0496124_0010575 | Ga0496124_0010575_7746_9314 | 503 |
| 236 | 3300049573 | Ga0501037_0091553 | Ga0501037_0091553_153_1688 | 503 |
| 237 | 3300049574 | Ga0501038_0007559 | Ga0501038_0007559_6326_7861 | 503 |
| 238 | 3300049586 | Ga0501070_0000110 | Ga0501070_0000110_3237_4772 | 503 |
| 239 | 3300049823 | Ga0501044_0001134 | Ga0501044_0001134_26884_28419 | 503 |
| 240 | 3300049823 | Ga0501044_0164241 | Ga0501044_0164241_265_1800 | 503 |
| 241 | 3300003856 | Ga0058692_1000808 | Ga0058692_100080811 | 504 |
| 242 | 3300005347 | Ga0070668_100009230 | Ga0070668_1000092305 | 504 |
| 243 | 3300005563 | Ga0068855_100000006 | Ga0068855_10000000676 | 504 |
| 244 | 3300006163 | Ga0070715_10043688 | Ga0070715_100436882 | 504 |
| 245 | 3300009093 | Ga0105240_10000357 | Ga0105240_1000035725 | 504 |
| 246 | 3300009551 | Ga0105238_10027731 | Ga0105238_100277316 | 504 |
| 247 | 3300011119 | Ga0105246_10007027 | Ga0105246_100070272 | 504 |
| 248 | 3300013306 | Ga0163162_10108326 | Ga0163162_101083262 | 504 |
| 249 | 3300025711 | Ga0207696_1000746 | Ga0207696_100074615 | 504 |
| 250 | 3300025913 | Ga0207695_10000004 | Ga0207695_10000004787 | 504 |
| 251 | 3300025924 | Ga0207694_10000014 | Ga0207694_10000014168 | 504 |
| 252 | 3300025949 | Ga0207667_10000051 | Ga0207667_10000051138 | 504 |
| 253 | 3300027312 | Ga0209371_1001830 | Ga0209371_10018305 | 504 |
| 254 | 3300028573 | Ga0265334_10002838 | Ga0265334_100028384 | 504 |
| 255 | 3300028577 | Ga0265318_10000031 | Ga0265318_1000003169 | 504 |
| 256 | 3300028800 | Ga0265338_10000006 | Ga0265338_10000006396 | 504 |
| 257 | 3300028800 | Ga0265338_10015294 | Ga0265338_100152945 | 504 |
| 258 | 3300030500 | Ga0268256_1001116 | Ga0268256_100111610 | 504 |
| 259 | 3300031241 | Ga0265325_10000003 | Ga0265325_1000000340 | 504 |
| 260 | 3300031249 | Ga0265339_10001397 | Ga0265339_100013974 | 504 |
| 261 | 3300031250 | Ga0265331_10012128 | Ga0265331_100121287 | 504 |
| 262 | 3300031595 | Ga0265313_10003952 | Ga0265313_100039527 | 504 |
| 263 | 3300031711 | Ga0265314_10010811 | Ga0265314_100108117 | 504 |
| 264 | 3300031712 | Ga0265342_10003917 | Ga0265342_100039172 | 504 |
| 265 | 3300033180 | Ga0307510_10000008 | Ga0307510_1000000823 | 504 |
| 266 | 3300041407 | Ga0439447_000496 | Ga0439447_000496_8595_10166 | 504 |
| 267 | 3300041411 | Ga0439466_0000003 | Ga0439466_0000003_400618_402189 | 504 |
| 268 | 3300042016 | Ga0439463_002195 | Ga0439463_002195_2528_4099 | 504 |
| 269 | 3300042146 | Ga0450907_002033 | Ga0450907_002033_1529_3100 | 504 |
| 270 | 3300046522 | Ga0495643_0007219 | Ga0495643_0007219_5275_6846 | 504 |
| 271 | 3300046810 | Ga0495660_0047695 | Ga0495660_0047695_411_1982 | 504 |
| 272 | 3300047320 | Ga0495672_0000012 | Ga0495672_0000012_119817_121388 | 504 |
| 273 | 3300048908 | Ga0496105_0011013 | Ga0496105_0011013_1355_2926 | 504 |
| 274 | 3300048920 | Ga0496117_0000180 | Ga0496117_0000180_17102_18673 | 504 |
| 275 | 3300048921 | Ga0496118_0018065 | Ga0496118_0018065_4777_6348 | 504 |
| 276 | 3300048922 | Ga0496119_0002597 | Ga0496119_0002597_1841_3412 | 504 |
| 277 | 3300048923 | Ga0496120_0003009 | Ga0496120_0003009_12571_14142 | 504 |
| 278 | 3300048924 | Ga0496121_0000185 | Ga0496121_0000185_13259_14830 | 504 |
| 279 | 3300048927 | Ga0496124_0004077 | Ga0496124_0004077_36_1607 | 504 |
| 280 | 3300049460 | Ga0495682_0009796 | Ga0495682_0009796_1904_3469 | 504 |
| 281 | 3300049585 | Ga0501069_0012736 | Ga0501069_0012736_792_2354 | 504 |
| 282 | 3300049741 | Ga0501079_0005199 | Ga0501079_0005199_7632_9194 | 504 |
| 283 | 3300049742 | Ga0501080_0188888 | Ga0501080_0188888_275_1837 | 504 |
| 284 | 3300049822 | Ga0501035_0002718 | Ga0501035_0002718_10124_11686 | 504 |
| 285 | 3300049823 | Ga0501044_0150755 | Ga0501044_0150755_450_2012 | 504 |
| 286 | 3300054114 | Ga0501084_0052916 | Ga0501084_0052916_1433_2995 | 504 |
| 287 | 3300060353 | Ga0501082_0050459 | Ga0501082_0050459_449_2011 | 504 |
| 288 | 3300003856 | Ga0058692_1003490 | Ga0058692_10034903 | 505 |
| 289 | 3300006051 | Ga0075364_10034360 | Ga0075364_100343601 | 505 |
| 290 | 3300009011 | Ga0105251_10038629 | Ga0105251_100386292 | 505 |
| 291 | 3300009092 | Ga0105250_10002960 | Ga0105250_100029601 | 505 |
| 292 | 3300009092 | Ga0105250_10015489 | Ga0105250_100154893 | 505 |
| 293 | 3300013100 | Ga0157373_10016116 | Ga0157373_100161165 | 505 |
| 294 | 3300013102 | Ga0157371_10001411 | Ga0157371_1000141117 | 505 |
| 295 | 3300013105 | Ga0157369_10082534 | Ga0157369_100825345 | 505 |
| 296 | 3300013306 | Ga0163162_10064722 | Ga0163162_100647222 | 505 |
| 297 | 3300013307 | Ga0157372_10092567 | Ga0157372_100925675 | 505 |
| 298 | 3300025233 | Ga0209437_100185 | Ga0209437_100185119 | 505 |
| 299 | 3300025711 | Ga0207696_1000003 | Ga0207696_1000003615 | 505 |
| 300 | 3300025711 | Ga0207696_1000328 | Ga0207696_100032815 | 505 |
| 301 | 3300025728 | Ga0207655_1003248 | Ga0207655_10032485 | 505 |
| 302 | 3300025728 | Ga0207655_1016317 | Ga0207655_10163175 | 505 |
| 303 | 3300025735 | Ga0207713_1000001 | Ga0207713_1000001328 | 505 |
| 304 | 3300027312 | Ga0209371_1000010 | Ga0209371_1000010528 | 505 |
| 305 | 3300027312 | Ga0209371_1000590 | Ga0209371_100059033 | 505 |
| 306 | 3300027312 | Ga0209371_1011312 | Ga0209371_10113122 | 505 |
| 307 | 3300030500 | Ga0268256_1000022 | Ga0268256_1000022337 | 505 |
| 308 | 3300030500 | Ga0268256_1000514 | Ga0268256_100051433 | 505 |
| 309 | 3300031241 | Ga0265325_10005413 | Ga0265325_100054132 | 505 |
| 310 | 3300035692 | Ga0373935_0106960 | Ga0373935_0106960_150_1751 | 505 |
| 311 | 3300046458 | Ga0495591_000080 | Ga0495591_000080_83507_85078 | 505 |
| 312 | 3300046458 | Ga0495591_002337 | Ga0495591_002337_5121_6704 | 505 |
| 313 | 3300046471 | Ga0495650_0000033 | Ga0495650_0000033_8341_9924 | 505 |
| 314 | 3300046491 | Ga0495584_0017970 | Ga0495584_0017970_307_1890 | 505 |
| 315 | 3300046501 | Ga0495607_0010742 | Ga0495607_0010742_690_2273 | 505 |
| 316 | 3300046507 | Ga0495606_0007320 | Ga0495606_0007320_212_1795 | 505 |
| 317 | 3300046523 | Ga0495644_0005099 | Ga0495644_0005099_1731_3314 | 505 |
| 318 | 3300046524 | Ga0495648_0004944 | Ga0495648_0004944_5797_7380 | 505 |
| 319 | 3300046530 | Ga0495654_0000125 | Ga0495654_0000125_83498_85069 | 505 |
| 320 | 3300046530 | Ga0495654_0000493 | Ga0495654_0000493_18148_19731 | 505 |
| 321 | 3300046794 | Ga0495589_0004048 | Ga0495589_0004048_833_2416 | 505 |
| 322 | 3300046810 | Ga0495660_0000074 | Ga0495660_0000074_57664_59247 | 505 |
| 323 | 3300047320 | Ga0495672_0000004 | Ga0495672_0000004_163322_164905 | 505 |
| 324 | 3300047469 | Ga0495673_0000023 | Ga0495673_0000023_79332_80915 | 505 |
| 325 | 3300048903 | Ga0496100_0044163 | Ga0496100_0044163_169_1740 | 505 |
| 326 | 3300048904 | Ga0496101_0000029 | Ga0496101_0000029_196741_198312 | 505 |
| 327 | 3300048905 | Ga0496102_0032078 | Ga0496102_0032078_1347_2918 | 505 |
| 328 | 3300048909 | Ga0496106_0102750 | Ga0496106_0102750_339_1910 | 505 |
| 329 | 3300048919 | Ga0496116_0026596 | Ga0496116_0026596_1834_3405 | 505 |
| 330 | 3300048920 | Ga0496117_0000004 | Ga0496117_0000004_683983_685554 | 505 |
| 331 | 3300048921 | Ga0496118_0000024 | Ga0496118_0000024_192088_193659 | 505 |
| 332 | 3300048923 | Ga0496120_0006066 | Ga0496120_0006066_7804_9375 | 505 |
| 333 | 3300048925 | Ga0496122_0010913 | Ga0496122_0010913_5880_7451 | 505 |
| 334 | 3300048925 | Ga0496122_0012528 | Ga0496122_0012528_3160_4731 | 505 |
| 335 | 3300048926 | Ga0496123_0004145 | Ga0496123_0004145_2790_4361 | 505 |
| 336 | 3300048926 | Ga0496123_0004462 | Ga0496123_0004462_4461_6032 | 505 |
| 337 | 3300048927 | Ga0496124_0005214 | Ga0496124_0005214_8455_10026 | 505 |
| 338 | 3300048927 | Ga0496124_0047403 | Ga0496124_0047403_330_1901 | 505 |
| 339 | 3300048927 | Ga0496124_0097802 | Ga0496124_0097802_777_2348 | 505 |
| 340 | 3300048928 | Ga0496125_0000016 | Ga0496125_0000016_176596_178164 | 505 |
| 341 | 3300049459 | Ga0495678_000828 | Ga0495678_000828_2338_3921 | 505 |
| 342 | 3300049460 | Ga0495682_0000026 | Ga0495682_0000026_137101_138684 | 505 |
| 343 | 3300049571 | Ga0501034_0217223 | Ga0501034_0217223_10_1578 | 505 |
| 344 | 3300050491 | nmdc:mga00v17_29080_c1 | nmdc:mga00v17_29080_c1_406_1977 | 505 |
| 345 | 3300053126 | Ga0500621_000001 | Ga0500621_000001_500979_502562 | 505 |
| 346 | 3300009092 | Ga0105250_10000003 | Ga0105250_10000003287 | 506 |
| 347 | 3300025711 | Ga0207696_1000004 | Ga0207696_1000004346 | 506 |
| 348 | 3300031595 | Ga0265313_10040965 | Ga0265313_100409652 | 506 |
| 349 | 3300048922 | Ga0496119_0020185 | Ga0496119_0020185_3329_4849 | 506 |
| 350 | 3300031249 | Ga0265339_10012298 | Ga0265339_100122983 | 507 |
| 351 | 3300031250 | Ga0265331_10005803 | Ga0265331_100058036 | 507 |
| 352 | 3300031595 | Ga0265313_10000745 | Ga0265313_1000074519 | 507 |
| 353 | 3300031712 | Ga0265342_10029181 | Ga0265342_100291813 | 507 |
| 354 | 3300009092 | Ga0105250_10000026 | Ga0105250_10000026203 | 508 |
| 355 | 3300025711 | Ga0207696_1000059 | Ga0207696_100005929 | 508 |
| 356 | 3300025728 | Ga0207655_1000105 | Ga0207655_1000105153 | 508 |
| 357 | 3300025735 | Ga0207713_1000005 | Ga0207713_1000005132 | 508 |
| 358 | 3300025935 | Ga0207709_10012460 | Ga0207709_100124603 | 508 |
| 359 | 3300046471 | Ga0495650_0002020 | Ga0495650_0002020_13930_15471 | 508 |
| 360 | 3300048919 | Ga0496116_0014235 | Ga0496116_0014235_2757_4328 | 508 |
| 361 | 3300048923 | Ga0496120_0053641 | Ga0496120_0053641_483_2051 | 508 |
| 362 | 3300005563 | Ga0068855_100233370 | Ga0068855_1002333702 | 509 |
| 363 | 3300006946 | Ga0079104_1001292 | Ga0079104_10012927 | 509 |
| 364 | 3300025903 | Ga0207680_10002749 | Ga0207680_100027498 | 509 |
| 365 | 3300027111 | Ga0209281_1000291 | Ga0209281_10002919 | 509 |
| 366 | 3300031249 | Ga0265339_10024291 | Ga0265339_100242913 | 509 |
| 367 | 3300046458 | Ga0495591_004770 | Ga0495591_004770_3879_5423 | 509 |
| 368 | 3300046492 | Ga0495585_0012507 | Ga0495585_0012507_2528_4072 | 509 |
| 369 | 3300046501 | Ga0495607_0000105 | Ga0495607_0000105_30750_32294 | 509 |
| 370 | 3300046506 | Ga0495583_0000322 | Ga0495583_0000322_13475_15019 | 509 |
| 371 | 3300046507 | Ga0495606_0000325 | Ga0495606_0000325_14304_15848 | 509 |
| 372 | 3300046515 | Ga0495620_0000959 | Ga0495620_0000959_9995_11539 | 509 |
| 373 | 3300046519 | Ga0495632_0006621 | Ga0495632_0006621_1759_3303 | 509 |
| 374 | 3300046520 | Ga0495637_0000055 | Ga0495637_0000055_78282_79826 | 509 |
| 375 | 3300046523 | Ga0495644_0000933 | Ga0495644_0000933_7049_8593 | 509 |
| 376 | 3300046524 | Ga0495648_0021358 | Ga0495648_0021358_2662_4206 | 509 |
| 377 | 3300046530 | Ga0495654_0000599 | Ga0495654_0000599_11020_12564 | 509 |
| 378 | 3300046538 | Ga0495609_0000090 | Ga0495609_0000090_86939_88483 | 509 |
| 379 | 3300046648 | Ga0495611_0000801 | Ga0495611_0000801_11778_13322 | 509 |
| 380 | 3300046660 | Ga0495625_0000062 | Ga0495625_0000062_114806_116350 | 509 |
| 381 | 3300046665 | Ga0495661_0000123 | Ga0495661_0000123_34049_35593 | 509 |
| 382 | 3300046694 | Ga0495649_0006368 | Ga0495649_0006368_3484_5028 | 509 |
| 383 | 3300047320 | Ga0495672_0007348 | Ga0495672_0007348_6671_8215 | 509 |
| 384 | 3300047470 | Ga0495681_0000845 | Ga0495681_0000845_14730_16274 | 509 |
| 385 | 3300047472 | Ga0495686_0008307 | Ga0495686_0008307_4762_6306 | 509 |
| 386 | 3300048091 | Ga0495626_0000062 | Ga0495626_0000062_58909_60453 | 509 |
| 387 | 3300048905 | Ga0496102_0093401 | Ga0496102_0093401_695_2239 | 509 |
| 388 | 3300048925 | Ga0496122_0000667 | Ga0496122_0000667_3291_4835 | 509 |
| 389 | 3300048926 | Ga0496123_0000163 | Ga0496123_0000163_67769_69313 | 509 |
| 390 | 3300048927 | Ga0496124_0000224 | Ga0496124_0000224_98715_100259 | 509 |
| 391 | 3300049459 | Ga0495678_005192 | Ga0495678_005192_2512_4056 | 509 |
| 392 | 3300027312 | Ga0209371_1000803 | Ga0209371_100080318 | 510 |
| 393 | 3300030500 | Ga0268256_1000671 | Ga0268256_100067118 | 510 |
| 394 | 3300035398 | Ga0316574_0014416 | Ga0316574_0014416_858_2462 | 510 |
| 395 | 3300035695 | Ga0373927_0015239 | Ga0373927_0015239_41_1597 | 510 |
| 396 | 3300036401 | Ga0373937_0059076 | Ga0373937_0059076_1451_3007 | 510 |
| 397 | 3300036647 | Ga0316582_0017269 | Ga0316582_0017269_2122_3726 | 510 |
| 398 | iso_pu_bacteria | 2728368998 | 2728748887 | 510 |
| 399 | iso_pu_bacteria | 2919675420 | 2919678551 | 511 |
| 400 | 3300003320 | rootH2_10019625 | rootH2_100196252 | 512 |
| 401 | 3300005289 | Ga0065704_10001970 | Ga0065704_100019706 | 512 |
| 402 | 3300005289 | Ga0065704_10002600 | Ga0065704_100026001 | 512 |
| 403 | 3300005366 | Ga0070659_100121494 | Ga0070659_1001214942 | 512 |
| 404 | 3300005548 | Ga0070665_100000199 | Ga0070665_10000019947 | 512 |
| 405 | 3300005577 | Ga0068857_100106500 | Ga0068857_1001065002 | 512 |
| 406 | 3300006051 | Ga0075364_10023775 | Ga0075364_100237751 | 512 |
| 407 | 3300006195 | Ga0075366_10004030 | Ga0075366_100040306 | 512 |
| 408 | 3300006946 | Ga0079104_1019879 | Ga0079104_10198792 | 512 |
| 409 | 3300009036 | Ga0105244_10050345 | Ga0105244_100503452 | 512 |
| 410 | 3300009092 | Ga0105250_10017877 | Ga0105250_100178772 | 512 |
| 411 | 3300013104 | Ga0157370_10008772 | Ga0157370_100087725 | 512 |
| 412 | 3300015679 | Ga0183366_1001 | Ga0183366_1001473 | 512 |
| 413 | 3300015680 | Ga0183370_1001 | Ga0183370_1001473 | 512 |
| 414 | 3300015685 | Ga0183369_1001 | Ga0183369_1001473 | 512 |
| 415 | 3300015687 | Ga0183368_1001 | Ga0183368_1001473 | 512 |
| 416 | 3300025711 | Ga0207696_1001808 | Ga0207696_10018082 | 512 |
| 417 | 3300025728 | Ga0207655_1000001 | Ga0207655_1000001533 | 512 |
| 418 | 3300025728 | Ga0207655_1000032 | Ga0207655_1000032264 | 512 |
| 419 | 3300025735 | Ga0207713_1000021 | Ga0207713_10000219 | 512 |
| 420 | 3300025735 | Ga0207713_1003470 | Ga0207713_10034703 | 512 |
| 421 | 3300025735 | Ga0207713_1006063 | Ga0207713_10060631 | 512 |
| 422 | 3300026116 | Ga0207674_10002213 | Ga0207674_100022132 | 512 |
| 423 | 3300027111 | Ga0209281_1000021 | Ga0209281_100002191 | 512 |
| 424 | 3300027111 | Ga0209281_1000085 | Ga0209281_10000859 | 512 |
| 425 | 3300027111 | Ga0209281_1000817 | Ga0209281_100081717 | 512 |
| 426 | 3300027312 | Ga0209371_1000001 | Ga0209371_1000001433 | 512 |
| 427 | 3300028379 | Ga0268266_10006560 | Ga0268266_100065605 | 512 |
| 428 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000012208 | 512 |
| 429 | 3300032168 | Ga0316593_10005918 | Ga0316593_100059181 | 512 |
| 430 | 3300041512 | Ga0451853_3565153 | Ga0451853_3565153_892_2463 | 512 |
| 431 | 3300042006 | Ga0439432_012730 | Ga0439432_012730_887_2455 | 512 |
| 432 | 3300042010 | Ga0439452_000924 | Ga0439452_000924_2182_3750 | 512 |
| 433 | 3300044669 | Ga0466981_0000098 | Ga0466981_0000098_6458_8026 | 512 |
| 434 | 3300046458 | Ga0495591_000011 | Ga0495591_000011_284477_286045 | 512 |
| 435 | 3300046471 | Ga0495650_0000153 | Ga0495650_0000153_13339_14910 | 512 |
| 436 | 3300047469 | Ga0495673_0000022 | Ga0495673_0000022_262608_264176 | 512 |
| 437 | 3300048907 | Ga0496104_0001318 | Ga0496104_0001318_3472_5040 | 512 |
| 438 | 3300048919 | Ga0496116_0008821 | Ga0496116_0008821_58_1629 | 512 |
| 439 | 3300048919 | Ga0496116_0057812 | Ga0496116_0057812_248_1816 | 512 |
| 440 | 3300048920 | Ga0496117_0020878 | Ga0496117_0020878_3479_5047 | 512 |
| 441 | 3300048921 | Ga0496118_0007231 | Ga0496118_0007231_6487_8055 | 512 |
| 442 | 3300048921 | Ga0496118_0072355 | Ga0496118_0072355_674_2242 | 512 |
| 443 | 3300048922 | Ga0496119_0057976 | Ga0496119_0057976_245_1816 | 512 |
| 444 | 3300048923 | Ga0496120_0003653 | Ga0496120_0003653_1244_2815 | 512 |
| 445 | 3300048924 | Ga0496121_0009103 | Ga0496121_0009103_7887_9455 | 512 |
| 446 | 3300048924 | Ga0496121_0015706 | Ga0496121_0015706_395_1966 | 512 |
| 447 | 3300048924 | Ga0496121_0032053 | Ga0496121_0032053_3203_4771 | 512 |
| 448 | 3300048925 | Ga0496122_0000026 | Ga0496122_0000026_2224_3792 | 512 |
| 449 | 3300048925 | Ga0496122_0000796 | Ga0496122_0000796_37008_38579 | 512 |
| 450 | 3300048926 | Ga0496123_0000005 | Ga0496123_0000005_302539_304107 | 512 |
| 451 | 3300048926 | Ga0496123_0000599 | Ga0496123_0000599_22689_24260 | 512 |
| 452 | 3300048926 | Ga0496123_0018984 | Ga0496123_0018984_229_1797 | 512 |
| 453 | 3300048927 | Ga0496124_0097027 | Ga0496124_0097027_522_2093 | 512 |
| 454 | 3300048929 | Ga0496126_0028193 | Ga0496126_0028193_3478_5046 | 512 |
| 455 | 3300048929 | Ga0496126_0072648 | Ga0496126_0072648_1244_2812 | 512 |
| 456 | 3300050491 | nmdc:mga00v17_5777_c1 | nmdc:mga00v17_5777_c1_200_1768 | 512 |
| 457 | iso_pu_bacteria | 2919688452 | 2919691617 | 512 |
| 458 | 3300031727 | Ga0316576_10010831 | Ga0316576_100108316 | 513 |
| 459 | 3300031728 | Ga0316578_10032280 | Ga0316578_100322802 | 513 |
| 460 | 3300031733 | Ga0316577_10018169 | Ga0316577_100181693 | 513 |
| 461 | 3300033528 | Ga0316588_1003379 | Ga0316588_10033792 | 513 |
| 462 | 3300035398 | Ga0316574_0033639 | Ga0316574_0033639_771_2330 | 513 |
| 463 | 3300037312 | Ga0395899_0010808 | Ga0395899_0010808_4255_5835 | 513 |
| 464 | 3300037471 | Ga0395905_0002859 | Ga0395905_0002859_10508_12088 | 513 |
| 465 | iso_pu_bacteria | 2811994881 | 2812370426 | 513 |
| 466 | iso_pu_bacteria | 2923519811 | 2923524517 | 513 |
| 467 | 3300009174 | Ga0105241_10078213 | Ga0105241_100782133 | 514 |
| 468 | 3300038735 | Ga0400485_04923 | Ga0400485_04923_81987_83570 | 515 |
| 469 | 3300038742 | Ga0400486_22493 | Ga0400486_22493_81850_83433 | 515 |
| 470 | 3300039062 | Ga0400483_059624 | Ga0400483_059624_423_1976 | 515 |
| 471 | 3300039062 | Ga0400483_195420 | Ga0400483_195420_3645_5195 | 515 |
| 472 | iso_pu_bacteria | 2690315857 | 2691331244 | 515 |
| 473 | iso_pu_bacteria | 8002745576 | 8002749738 | 515 |
| 474 | 3300005842 | Ga0068858_100009966 | Ga0068858_1000099665 | 516 |
| 475 | 3300014968 | Ga0157379_10015107 | Ga0157379_100151072 | 516 |
| 476 | 3300026035 | Ga0207703_10051597 | Ga0207703_100515974 | 516 |
| 477 | 3300048919 | Ga0496116_0000226 | Ga0496116_0000226_49339_50961 | 516 |
| 478 | 3300048923 | Ga0496120_0000043 | Ga0496120_0000043_6101_7723 | 516 |
| 479 | iso_pu_bacteria | 2706794495 | 2707099815 | 517 |
| 480 | 3300033541 | Ga0316596_1021055 | Ga0316596_10210551 | 518 |
| 481 | 3300038726 | Ga0400490_11094 | Ga0400490_11094_5642_7204 | 518 |
| 482 | 3300038726 | Ga0400490_17222 | Ga0400490_17222_16226_17794 | 518 |
| 483 | 3300038727 | Ga0400491_21474 | Ga0400491_21474_4831_6399 | 518 |
| 484 | 3300038735 | Ga0400485_15585 | Ga0400485_15585_3528_5093 | 518 |
| 485 | 3300038741 | Ga0400488_22325 | Ga0400488_22325_2029_3612 | 518 |
| 486 | 3300038742 | Ga0400486_08699 | Ga0400486_08699_247_1812 | 518 |
| 487 | 3300038742 | Ga0400486_17653 | Ga0400486_17653_7774_9339 | 518 |
| 488 | 3300039062 | Ga0400483_044668 | Ga0400483_044668_1520_3085 | 518 |
| 489 | 3300039062 | Ga0400483_139193 | Ga0400483_139193_882_2447 | 518 |
| 490 | 3300039062 | Ga0400483_145468 | Ga0400483_145468_2173_3756 | 518 |
| 491 | 3300039062 | Ga0400483_171382 | Ga0400483_171382_10478_12043 | 518 |
| 492 | 3300039062 | Ga0400483_269989 | Ga0400483_269989_1535_3100 | 518 |
| 493 | 3300039110 | Ga0400487_27800 | Ga0400487_27800_53294_54859 | 518 |
| 494 | 3300039110 | Ga0400487_54161 | Ga0400487_54161_17314_18879 | 518 |
| 495 | 3300046463 | Ga0495653_0013811 | Ga0495653_0013811_1743_3338 | 518 |
| 496 | 3300046492 | Ga0495585_0003413 | Ga0495585_0003413_3258_4853 | 518 |
| 497 | 3300046507 | Ga0495606_0013109 | Ga0495606_0013109_1739_3334 | 518 |
| 498 | 3300046665 | Ga0495661_0000061 | Ga0495661_0000061_125846_127441 | 518 |
| 499 | 3300047321 | Ga0495676_0030843 | Ga0495676_0030843_1710_3308 | 518 |
| 500 | 3300047323 | Ga0495683_0000194 | Ga0495683_0000194_3069_4667 | 518 |
| 501 | iso_pu_bacteria | 2508501071 | 2508851225 | 518 |
| 502 | iso_pu_bacteria | 2511231025 | 2511381174 | 518 |
| 503 | iso_pu_bacteria | 2511231035 | 2511436093 | 518 |
| 504 | iso_pu_bacteria | 2537561728 | 2538427348 | 518 |
| 505 | iso_pu_bacteria | 2547132181 | 2547694521 | 518 |
| 506 | iso_pu_bacteria | 2554235234 | 2555258980 | 518 |
| 507 | iso_pu_bacteria | 2561511199 | 2562466596 | 518 |
| 508 | iso_pu_bacteria | 2565956521 | 2566036998 | 518 |
| 509 | iso_pu_bacteria | 2585427591 | 2585826935 | 518 |
| 510 | iso_pu_bacteria | 2585427592 | 2585831106 | 518 |
| 511 | iso_pu_bacteria | 2599185169 | 2599410499 | 518 |
| 512 | iso_pu_bacteria | 2599185299 | 2599927277 | 518 |
| 513 | iso_pu_bacteria | 2600255254 | 2601523865 | 518 |
| 514 | iso_pu_bacteria | 2600255255 | 2601529016 | 518 |
| 515 | iso_pu_bacteria | 2600255256 | 2601532106 | 518 |
| 516 | iso_pu_bacteria | 2600255257 | 2601537477 | 518 |
| 517 | iso_pu_bacteria | 2600255280 | 2601615850 | 518 |
| 518 | iso_pu_bacteria | 2600255281 | 2601620422 | 518 |
| 519 | iso_pu_bacteria | 2600255287 | 2601645870 | 518 |
| 520 | iso_pu_bacteria | 2600255288 | 2601648824 | 518 |
| 521 | iso_pu_bacteria | 2600255289 | 2601653900 | 518 |
| 522 | iso_pu_bacteria | 2600255290 | 2601659327 | 518 |
| 523 | iso_pu_bacteria | 2600255291 | 2601665317 | 518 |
| 524 | iso_pu_bacteria | 2600255298 | 2601698179 | 518 |
| 525 | iso_pu_bacteria | 2600255299 | 2601703328 | 518 |
| 526 | iso_pu_bacteria | 2600255300 | 2601708517 | 518 |
| 527 | iso_pu_bacteria | 2600255301 | 2601713630 | 518 |
| 528 | iso_pu_bacteria | 2600255302 | 2601717161 | 518 |
| 529 | iso_pu_bacteria | 2600255303 | 2601722054 | 518 |
| 530 | iso_pu_bacteria | 2600255304 | 2601724678 | 518 |
| 531 | iso_pu_bacteria | 2600255305 | 2601731959 | 518 |
| 532 | iso_pu_bacteria | 2600255306 | 2601738410 | 518 |
| 533 | iso_pu_bacteria | 2600255307 | 2601742741 | 518 |
| 534 | iso_pu_bacteria | 2600255309 | 2601751885 | 518 |
| 535 | iso_pu_bacteria | 2600255310 | 2601755824 | 518 |
| 536 | iso_pu_bacteria | 2600255311 | 2601761192 | 518 |
| 537 | iso_pu_bacteria | 2600255392 | 2602020216 | 518 |
| 538 | iso_pu_bacteria | 2602042046 | 2603638782 | 518 |
| 539 | iso_pu_bacteria | 2602042047 | 2603643312 | 518 |
| 540 | iso_pu_bacteria | 2602042052 | 2603663441 | 518 |
| 541 | iso_pu_bacteria | 2602042053 | 2603668051 | 518 |
| 542 | iso_pu_bacteria | 2602042066 | 2603699910 | 518 |
| 543 | iso_pu_bacteria | 2602042067 | 2603703890 | 518 |
| 544 | iso_pu_bacteria | 2602042103 | 2603839513 | 518 |
| 545 | iso_pu_bacteria | 2602042104 | 2603844438 | 518 |
| 546 | iso_pu_bacteria | 2602042105 | 2603849665 | 518 |
| 547 | iso_pu_bacteria | 2602042106 | 2603854731 | 518 |
| 548 | iso_pu_bacteria | 2602042110 | 2603869857 | 518 |
| 549 | iso_pu_bacteria | 2602042111 | 2603878968 | 518 |
| 550 | iso_pu_bacteria | 2603880178 | 2606047042 | 518 |
| 551 | iso_pu_bacteria | 2603880184 | 2606072474 | 518 |
| 552 | iso_pu_bacteria | 2603880202 | 2606146452 | 518 |
| 553 | iso_pu_bacteria | 2603880211 | 2606177377 | 518 |
| 554 | iso_pu_bacteria | 2608642108 | 2608668694 | 518 |
| 555 | iso_pu_bacteria | 2609459761 | 2609913860 | 518 |
| 556 | iso_pu_bacteria | 2636415599 | 2637226402 | 518 |
| 557 | iso_pu_bacteria | 2648501241 | 2649119765 | 518 |
| 558 | iso_pu_bacteria | 2648501241 | 2649121071 | 518 |
| 559 | iso_pu_bacteria | 2648501693 | 2650896622 | 518 |
| 560 | iso_pu_bacteria | 2651869818 | 2652973233 | 518 |
| 561 | iso_pu_bacteria | 2651869818 | 2652974604 | 518 |
| 562 | iso_pu_bacteria | 2667528172 | 2671102528 | 518 |
| 563 | iso_pu_bacteria | 2667528173 | 2671108222 | 518 |
| 564 | iso_pu_bacteria | 2671180115 | 2671586553 | 518 |
| 565 | iso_pu_bacteria | 2675903046 | 2676407440 | 518 |
| 566 | iso_pu_bacteria | 2681812866 | 2681995650 | 518 |
| 567 | iso_pu_bacteria | 2681812869 | 2682007445 | 518 |
| 568 | iso_pu_bacteria | 2684622997 | 2686352618 | 518 |
| 569 | iso_pu_bacteria | 2751185917 | 2753855168 | 518 |
| 570 | iso_pu_bacteria | 2765235842 | 2765588104 | 518 |
| 571 | iso_pu_bacteria | 2772190666 | 2772437791 | 518 |
| 572 | iso_pu_bacteria | 2775506706 | 2775541572 | 518 |
| 573 | iso_pu_bacteria | 2775507074 | 2777020281 | 518 |
| 574 | iso_pu_bacteria | 2791354903 | 2791923226 | 518 |
| 575 | iso_pu_bacteria | 2791355010 | 2792312400 | 518 |
| 576 | iso_pu_bacteria | 2791355275 | 2793406238 | 518 |
| 577 | iso_pu_bacteria | 2806310673 | 2807180477 | 518 |
| 578 | iso_pu_bacteria | 2808606414 | 2809124820 | 518 |
| 579 | iso_pu_bacteria | 2811995292 | 2813729844 | 518 |
| 580 | iso_pu_bacteria | 2814123068 | 2814697338 | 518 |
| 581 | iso_pu_bacteria | 2823373977 | 2823376808 | 518 |
| 582 | iso_pu_bacteria | 2844425489 | 2844426701 | 518 |
| 583 | iso_pu_bacteria | 2844528606 | 2844532180 | 518 |
| 584 | iso_pu_bacteria | 2847085930 | 2847088505 | 518 |
| 585 | iso_pu_bacteria | 2847797336 | 2847800704 | 518 |
| 586 | iso_pu_bacteria | 2852103415 | 2852103805 | 518 |
| 587 | iso_pu_bacteria | 2855195626 | 2855198723 | 518 |
| 588 | iso_pu_bacteria | 2858466076 | 2858470105 | 518 |
| 589 | iso_pu_bacteria | 2865014394 | 2865017723 | 518 |
| 590 | iso_pu_bacteria | 2871272651 | 2871277166 | 518 |
| 591 | iso_pu_bacteria | 2871282230 | 2871286678 | 518 |
| 592 | iso_pu_bacteria | 2876601092 | 2876602709 | 518 |
| 593 | iso_pu_bacteria | 2888366609 | 2888367781 | 518 |
| 594 | iso_pu_bacteria | 2888373701 | 2888374529 | 518 |
| 595 | iso_pu_bacteria | 2891670763 | 2891672319 | 518 |
| 596 | iso_pu_bacteria | 2900051742 | 2900054077 | 518 |
| 597 | iso_pu_bacteria | 2900051742 | 2900055743 | 518 |
| 598 | iso_pu_bacteria | 2904474040 | 2904475106 | 518 |
| 599 | iso_pu_bacteria | 2904504865 | 2904505486 | 518 |
| 600 | iso_pu_bacteria | 2908669403 | 2908670983 | 518 |
| 601 | iso_pu_bacteria | 2919150387 | 2919151452 | 518 |
| 602 | iso_pu_bacteria | 2923634449 | 2923638592 | 518 |
| 603 | iso_pu_bacteria | 2927143783 | 2927146326 | 518 |
| 604 | iso_pu_bacteria | 2937967321 | 2937969069 | 518 |
| 605 | iso_pu_bacteria | 2939602548 | 2939602871 | 518 |
| 606 | iso_pu_bacteria | 2939607340 | 2939608337 | 518 |
| 607 | iso_pu_bacteria | 2945951305 | 2945953796 | 518 |
| 608 | iso_pu_bacteria | 2974310843 | 2974312975 | 518 |
| 609 | iso_pu_bacteria | 2984494565 | 2984495837 | 518 |
| 610 | iso_pu_bacteria | 2990261002 | 2990262525 | 518 |
| 611 | iso_pu_bacteria | 3000376612 | 3000379919 | 518 |
| 612 | iso_pu_bacteria | 640753048 | 640936798 | 518 |
| 613 | iso_pu_bacteria | 8004592986 | 8004595001 | 518 |
| 614 | iso_pu_bacteria | 8015394850 | 8015399161 | 518 |
| 615 | iso_pu_bacteria | 8016733728 | 8016736701 | 518 |
| 616 | iso_pu_bacteria | 8018221730 | 8018225304 | 518 |
| 617 | iso_pu_bacteria | 8018405270 | 8018408109 | 518 |
| 618 | iso_pu_bacteria | 8019499862 | 8019501935 | 518 |
| 619 | iso_pu_bacteria | 8054844752 | 8054847080 | 518 |
| 620 | iso_pu_bacteria | 8055097453 | 8055102157 | 518 |
| 621 | iso_pu_bacteria | 2522572158 | 2523106204 | 519 |
| 622 | iso_pu_bacteria | 2523231067 | 2523468584 | 519 |
| 623 | iso_pu_bacteria | 2599185307 | 2599973577 | 519 |
| 624 | iso_pu_bacteria | 2738541271 | 2738688729 | 519 |
| 625 | iso_pu_bacteria | 2738543016 | 2739264960 | 519 |
| 626 | iso_pu_bacteria | 2738543031 | 2739352060 | 519 |
| 627 | iso_pu_bacteria | 2821118458 | 2821118942 | 519 |
| 628 | iso_pu_bacteria | 2884086401 | 2884089830 | 519 |
| 629 | iso_pu_bacteria | 2904513164 | 2904517405 | 519 |
| 630 | iso_pu_bacteria | 2919108558 | 2919109463 | 519 |
| 631 | iso_pu_bacteria | 2927833300 | 2927834909 | 519 |
| 632 | iso_pu_bacteria | 2935625433 | 2935627457 | 519 |
| 633 | iso_pu_bacteria | 2937539931 | 2937543461 | 519 |
| 634 | iso_pu_bacteria | 2939617950 | 2939621477 | 519 |
| 635 | iso_pu_bacteria | 2945874760 | 2945878940 | 519 |
| 636 | iso_pu_bacteria | 2969079654 | 2969083384 | 519 |
| 637 | iso_pu_bacteria | 2971820967 | 2971824815 | 519 |
| 638 | iso_pu_bacteria | 2974435778 | 2974437618 | 519 |
| 639 | iso_pu_bacteria | 2984559226 | 2984560401 | 519 |
| 640 | iso_pu_bacteria | 2984595703 | 2984598478 | 519 |
| 641 | iso_pu_bacteria | 8019504834 | 8019508381 | 519 |
| 642 | iso_pu_bacteria | 8055087960 | 8055088849 | 519 |
| 643 | iso_pu_bacteria | 8055092621 | 8055093805 | 519 |
| 644 | iso_pu_bacteria | 8057304971 | 8057305901 | 519 |
| 645 | 3300046506 | Ga0495583_0000499 | Ga0495583_0000499_12075_13661 | 521 |
| 646 | 3300046519 | Ga0495632_0000190 | Ga0495632_0000190_43383_44969 | 521 |
| 647 | 3300046665 | Ga0495661_0003364 | Ga0495661_0003364_8194_9780 | 521 |
| 648 | 2010549000 | RicEn_C5844 | RicEn_103700 | 522 |
| 649 | 3300002737 | JGI25162J39368_1000003 | JGI25162J39368_1000003445 | 522 |
| 650 | 3300002771 | JGI25163J39215_1000007 | JGI25163J39215_100000775 | 522 |
| 651 | 3300002772 | JGI25164J39214_1000014 | JGI25164J39214_100001463 | 522 |
| 652 | 3300002773 | JGI25152J39213_1000329 | JGI25152J39213_100032919 | 522 |
| 653 | 3300003751 | Ga0055538_1000005 | Ga0055538_1000005445 | 522 |
| 654 | 3300003752 | Ga0055539_1000007 | Ga0055539_1000007445 | 522 |
| 655 | 3300003756 | Ga0055533_1000009 | Ga0055533_1000009445 | 522 |
| 656 | 3300003759 | Ga0055525_1000010 | Ga0055525_1000010445 | 522 |
| 657 | 3300003841 | Ga0055541_1000005 | Ga0055541_1000005120 | 522 |
| 658 | 3300009011 | Ga0105251_10001518 | Ga0105251_100015189 | 522 |
| 659 | 3300009011 | Ga0105251_10066205 | Ga0105251_100662051 | 522 |
| 660 | 3300009036 | Ga0105244_10000006 | Ga0105244_10000006290 | 522 |
| 661 | 3300009036 | Ga0105244_10002108 | Ga0105244_100021081 | 522 |
| 662 | 3300009036 | Ga0105244_10005410 | Ga0105244_100054103 | 522 |
| 663 | 3300009092 | Ga0105250_10000861 | Ga0105250_1000086113 | 522 |
| 664 | 3300009092 | Ga0105250_10000873 | Ga0105250_100008737 | 522 |
| 665 | 3300013100 | Ga0157373_10001277 | Ga0157373_1000127711 | 522 |
| 666 | 3300013100 | Ga0157373_10002523 | Ga0157373_1000252310 | 522 |
| 667 | 3300013102 | Ga0157371_10000167 | Ga0157371_1000016747 | 522 |
| 668 | 3300013102 | Ga0157371_10001794 | Ga0157371_1000179414 | 522 |
| 669 | 3300013102 | Ga0157371_10004005 | Ga0157371_100040054 | 522 |
| 670 | 3300013104 | Ga0157370_10000093 | Ga0157370_1000009361 | 522 |
| 671 | 3300013104 | Ga0157370_10003123 | Ga0157370_1000312313 | 522 |
| 672 | 3300013105 | Ga0157369_10001855 | Ga0157369_1000185515 | 522 |
| 673 | 3300013306 | Ga0163162_10099014 | Ga0163162_100990142 | 522 |
| 674 | 3300013307 | Ga0157372_10006015 | Ga0157372_100060154 | 522 |
| 675 | 3300013307 | Ga0157372_10008044 | Ga0157372_100080448 | 522 |
| 676 | 3300013307 | Ga0157372_10068022 | Ga0157372_100680222 | 522 |
| 677 | 3300015261 | Ga0182006_1000063 | Ga0182006_100006399 | 522 |
| 678 | 3300015265 | Ga0182005_1014557 | Ga0182005_10145572 | 522 |
| 679 | 3300021384 | Ga0213876_10000095 | Ga0213876_1000009525 | 522 |
| 680 | 3300025207 | Ga0209760_100001 | Ga0209760_100001289 | 522 |
| 681 | 3300025224 | Ga0209784_100001 | Ga0209784_100001987 | 522 |
| 682 | 3300025225 | Ga0209566_100001 | Ga0209566_100001987 | 522 |
| 683 | 3300025226 | Ga0209674_100002 | Ga0209674_100002987 | 522 |
| 684 | 3300025230 | Ga0209563_100008 | Ga0209563_100008989 | 522 |
| 685 | 3300025231 | Ga0207427_100002 | Ga0207427_100002289 | 522 |
| 686 | 3300025233 | Ga0209437_100007 | Ga0209437_100007441 | 522 |
| 687 | 3300025253 | Ga0209677_100004 | Ga0209677_100004989 | 522 |
| 688 | 3300025258 | Ga0209129_1000015 | Ga0209129_1000015411 | 522 |
| 689 | 3300025711 | Ga0207696_1000489 | Ga0207696_100048920 | 522 |
| 690 | 3300025711 | Ga0207696_1000997 | Ga0207696_10009975 | 522 |
| 691 | 3300025728 | Ga0207655_1000157 | Ga0207655_1000157108 | 522 |
| 692 | 3300025735 | Ga0207713_1000006 | Ga0207713_1000006370 | 522 |
| 693 | 3300025735 | Ga0207713_1004111 | Ga0207713_10041117 | 522 |
| 694 | 3300025735 | Ga0207713_1013428 | Ga0207713_10134282 | 522 |
| 695 | 3300027111 | Ga0209281_1000041 | Ga0209281_1000041321 | 522 |
| 696 | 3300027312 | Ga0209371_1000047 | Ga0209371_1000047265 | 522 |
| 697 | 3300027312 | Ga0209371_1001366 | Ga0209371_100136610 | 522 |
| 698 | 3300030500 | Ga0268256_1000270 | Ga0268256_10002708 | 522 |
| 699 | 3300030500 | Ga0268256_1001173 | Ga0268256_10011737 | 522 |
| 700 | 3300031728 | Ga0316578_10000385 | Ga0316578_100003854 | 522 |
| 701 | 3300031733 | Ga0316577_10014017 | Ga0316577_100140172 | 522 |
| 702 | 3300031733 | Ga0316577_10043630 | Ga0316577_100436302 | 522 |
| 703 | 3300033524 | Ga0316592_1006238 | Ga0316592_10062381 | 522 |
| 704 | 3300033541 | Ga0316596_1000856 | Ga0316596_10008563 | 522 |
| 705 | 3300035398 | Ga0316574_0008426 | Ga0316574_0008426_3803_5401 | 522 |
| 706 | 3300036647 | Ga0316582_0049709 | Ga0316582_0049709_413_2011 | 522 |
| 707 | 3300036712 | Ga0316584_0000079 | Ga0316584_0000079_28378_29997 | 522 |
| 708 | 3300036712 | Ga0316584_0016210 | Ga0316584_0016210_3261_4862 | 522 |
| 709 | 3300036712 | Ga0316584_0092213 | Ga0316584_0092213_531_2132 | 522 |
| 710 | 3300039062 | Ga0400483_239719 | Ga0400483_239719_2589_4175 | 522 |
| 711 | 3300039437 | Ga0436365_0727636 | Ga0436365_0727636_16067_17635 | 522 |
| 712 | 3300041405 | Ga0439438_000001 | Ga0439438_000001_128123_129694 | 522 |
| 713 | 3300041407 | Ga0439447_008932 | Ga0439447_008932_1302_2873 | 522 |
| 714 | 3300042006 | Ga0439432_001341 | Ga0439432_001341_234_1805 | 522 |
| 715 | 3300042010 | Ga0439452_000001 | Ga0439452_000001_68731_70302 | 522 |
| 716 | 3300042010 | Ga0439452_000003 | Ga0439452_000003_461038_462606 | 522 |
| 717 | 3300042016 | Ga0439463_001202 | Ga0439463_001202_4501_6090 | 522 |
| 718 | 3300046453 | Ga0495627_010254 | Ga0495627_010254_1527_3116 | 522 |
| 719 | 3300046458 | Ga0495591_000009 | Ga0495591_000009_35307_36896 | 522 |
| 720 | 3300046458 | Ga0495591_004267 | Ga0495591_004267_1904_3493 | 522 |
| 721 | 3300046471 | Ga0495650_0000016 | Ga0495650_0000016_195262_196830 | 522 |
| 722 | 3300046471 | Ga0495650_0000581 | Ga0495650_0000581_32466_34055 | 522 |
| 723 | 3300046474 | Ga0495605_0000142 | Ga0495605_0000142_69010_70599 | 522 |
| 724 | 3300046474 | Ga0495605_0001220 | Ga0495605_0001220_3103_4692 | 522 |
| 725 | 3300046474 | Ga0495605_0008951 | Ga0495605_0008951_394_1983 | 522 |
| 726 | 3300046500 | Ga0495596_0001342 | Ga0495596_0001342_993_2582 | 522 |
| 727 | 3300046501 | Ga0495607_0000677 | Ga0495607_0000677_21995_23587 | 522 |
| 728 | 3300046506 | Ga0495583_0001458 | Ga0495583_0001458_21453_23042 | 522 |
| 729 | 3300046506 | Ga0495583_0001787 | Ga0495583_0001787_10404_11993 | 522 |
| 730 | 3300046507 | Ga0495606_0000206 | Ga0495606_0000206_34289_35878 | 522 |
| 731 | 3300046507 | Ga0495606_0021350 | Ga0495606_0021350_787_2376 | 522 |
| 732 | 3300046515 | Ga0495620_0000737 | Ga0495620_0000737_9173_10765 | 522 |
| 733 | 3300046519 | Ga0495632_0004112 | Ga0495632_0004112_1090_2679 | 522 |
| 734 | 3300046519 | Ga0495632_0038297 | Ga0495632_0038297_279_1847 | 522 |
| 735 | 3300046520 | Ga0495637_0000591 | Ga0495637_0000591_13725_15314 | 522 |
| 736 | 3300046524 | Ga0495648_0000219 | Ga0495648_0000219_5516_7105 | 522 |
| 737 | 3300046530 | Ga0495654_0005581 | Ga0495654_0005581_997_2565 | 522 |
| 738 | 3300046530 | Ga0495654_0031797 | Ga0495654_0031797_591_2180 | 522 |
| 739 | 3300046542 | Ga0495597_0001470 | Ga0495597_0001470_7607_9175 | 522 |
| 740 | 3300046616 | Ga0495668_0010851 | Ga0495668_0010851_52_1641 | 522 |
| 741 | 3300046616 | Ga0495668_0035552 | Ga0495668_0035552_378_1967 | 522 |
| 742 | 3300046648 | Ga0495611_0009172 | Ga0495611_0009172_95_1684 | 522 |
| 743 | 3300046660 | Ga0495625_0043223 | Ga0495625_0043223_224_1792 | 522 |
| 744 | 3300046665 | Ga0495661_0004215 | Ga0495661_0004215_8493_10082 | 522 |
| 745 | 3300046674 | Ga0495588_0010188 | Ga0495588_0010188_1788_3356 | 522 |
| 746 | 3300046692 | Ga0495671_0005016 | Ga0495671_0005016_591_2180 | 522 |
| 747 | 3300046694 | Ga0495649_0004050 | Ga0495649_0004050_109_1677 | 522 |
| 748 | 3300046810 | Ga0495660_0000007 | Ga0495660_0000007_151624_153192 | 522 |
| 749 | 3300046810 | Ga0495660_0001740 | Ga0495660_0001740_4809_6398 | 522 |
| 750 | 3300047321 | Ga0495676_0000042 | Ga0495676_0000042_59217_60806 | 522 |
| 751 | 3300047446 | Ga0495679_000027 | Ga0495679_000027_65705_67294 | 522 |
| 752 | 3300047446 | Ga0495679_000032 | Ga0495679_000032_104289_105857 | 522 |
| 753 | 3300047469 | Ga0495673_0000227 | Ga0495673_0000227_42935_44527 | 522 |
| 754 | 3300047469 | Ga0495673_0000813 | Ga0495673_0000813_15767_17356 | 522 |
| 755 | 3300047469 | Ga0495673_0001429 | Ga0495673_0001429_17467_19056 | 522 |
| 756 | 3300047469 | Ga0495673_0027138 | Ga0495673_0027138_947_2536 | 522 |
| 757 | 3300048907 | Ga0496104_0006179 | Ga0496104_0006179_2154_3722 | 522 |
| 758 | 3300048919 | Ga0496116_0000127 | Ga0496116_0000127_151257_152825 | 522 |
| 759 | 3300048919 | Ga0496116_0000572 | Ga0496116_0000572_39601_41172 | 522 |
| 760 | 3300048920 | Ga0496117_0005651 | Ga0496117_0005651_2558_4129 | 522 |
| 761 | 3300048920 | Ga0496117_0014392 | Ga0496117_0014392_5232_6800 | 522 |
| 762 | 3300048921 | Ga0496118_0004392 | Ga0496118_0004392_7035_8606 | 522 |
| 763 | 3300048921 | Ga0496118_0128651 | Ga0496118_0128651_20_1588 | 522 |
| 764 | 3300048922 | Ga0496119_0000524 | Ga0496119_0000524_44475_46043 | 522 |
| 765 | 3300048922 | Ga0496119_0007945 | Ga0496119_0007945_2400_3968 | 522 |
| 766 | 3300048923 | Ga0496120_0000009 | Ga0496120_0000009_379099_380667 | 522 |
| 767 | 3300048923 | Ga0496120_0008215 | Ga0496120_0008215_3254_4822 | 522 |
| 768 | 3300048923 | Ga0496120_0015232 | Ga0496120_0015232_1359_2927 | 522 |
| 769 | 3300048924 | Ga0496121_0002628 | Ga0496121_0002628_10591_12180 | 522 |
| 770 | 3300048924 | Ga0496121_0002922 | Ga0496121_0002922_20405_21994 | 522 |
| 771 | 3300048925 | Ga0496122_0000013 | Ga0496122_0000013_199613_201181 | 522 |
| 772 | 3300048925 | Ga0496122_0006414 | Ga0496122_0006414_4414_5982 | 522 |
| 773 | 3300048926 | Ga0496123_0000010 | Ga0496123_0000010_299859_301427 | 522 |
| 774 | 3300048926 | Ga0496123_0000621 | Ga0496123_0000621_51373_52941 | 522 |
| 775 | 3300048926 | Ga0496123_0010990 | Ga0496123_0010990_4134_5732 | 522 |
| 776 | 3300048926 | Ga0496123_0026914 | Ga0496123_0026914_1531_3120 | 522 |
| 777 | 3300048927 | Ga0496124_0000259 | Ga0496124_0000259_73455_75047 | 522 |
| 778 | 3300048927 | Ga0496124_0002333 | Ga0496124_0002333_8027_9595 | 522 |
| 779 | 3300048927 | Ga0496124_0016619 | Ga0496124_0016619_3411_4982 | 522 |
| 780 | 3300048928 | Ga0496125_0000019 | Ga0496125_0000019_141346_142914 | 522 |
| 781 | 3300048929 | Ga0496126_0002546 | Ga0496126_0002546_7921_9489 | 522 |
| 782 | 3300049459 | Ga0495678_000043 | Ga0495678_000043_102607_104196 | 522 |
| 783 | 3300049460 | Ga0495682_0000096 | Ga0495682_0000096_9584_11173 | 522 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rko-assembly1.cif.gz_A | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.9745 | 2 | 513 |
| 6rko-assembly1.cif.gz_A | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.9724 | 2 | 513 |
| 6rx4-assembly1.cif.gz_A | the structure of bd oxidase from escherichia coli | 0.968 | 2 | 515 |
| 7oy2-assembly1.cif.gz_C | high resolution structure of cytochrome bd-ii oxidase from e. coli | 0.9662 | 3 | 503 |
| 6rx4-assembly1.cif.gz_A | the structure of bd oxidase from escherichia coli | 0.9661 | 2 | 515 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.5657 | 12 | 441 | 1.20.1630.10 |
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.5528 | 12 | 441 | 1.20.1630.10 |
| af_I1KZ04_198_383_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.4439 | 12 | 236 | 1.20.120.1770 |
| af_I1KZ04_198_383_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.407 | 12 | 236 | 1.20.120.1770 |
| af_A0A1D8PLM4_14_243_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4055 | 20 | 234 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A376UDY2-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit 1 (EC 1.10.3.-) | 0.9846 | 128 | 238 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A7Y7DJR0-F1-model_v4 | Cytochrome ubiquinol oxidase subunit I | 0.9783 | 4 | 504 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A6N3U8U7-F1-model_v4 | deleted | 0.9781 | 11 | 514 |
|
| AF-A0A7Z8G990-F1-model_v4 | deleted | 0.9777 | 148 | 515 |
|
| AF-A0A6M1DKR8-F1-model_v4 | Cytochrome bd-I ubiquinol oxidase subunit CydA | 0.9773 | 311 | 451 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar