F480658

General Info

Members Datasets Scaffolds Average Seq Length
783 507 595 311

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10448022|Ga0157372_104480222
Length 347
Sequence MNATPIFRRIALIGFGLIGGSIARAARAQGLASEIVTTARSEKTRARVTELGIVDRVLETNAEAVQDADLVILCIPVQSYGAVMEKIGPYLEPGAILSDVGSVKEYVTKAMAPHIPKGVHLIPGHPIAGTEHSGPAAGFPELFINRWCVLTPGKTVPAEAIARLTAFWSDLGSNVELMEPTHHDMVLAITSHIPHLVAYNIVGTVSDLEQATQSEVIKFSASGFRDFTRIAASDPVMWRDVFLTNRDAVLEMLGRFLEDLSKLQRMVRVGDGPGMEDLFTRTRKIRRSIITAGQETAAADFGRPHGDVKTLSGPSGTALAEGTAAPLVDTNVEVASPVREHGGGDDA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
17 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
18 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
19 2643221580 Devosia sp. Root635 Isolate Unclassified
20 2643221591 Devosia sp. Root685 Isolate Unclassified
21 2643221629 Devosia sp. Root105 Isolate Unclassified
22 2643221662 Devosia sp. Root413D1 Isolate Unclassified
23 2643221674 Devosia sp. Root436 Isolate Unclassified
24 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
25 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
26 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
27 2773857925 Microvirga vignae BR3299 Isolate Unclassified
28 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
29 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
33 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
34 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
35 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
36 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
37 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
38 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
39 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
40 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
41 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
48 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
53 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
54 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
55 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
56 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
57 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
58 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
59 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
60 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
61 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
62 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
63 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
64 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
65 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
66 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
72 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
73 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
74 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
75 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
76 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
77 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
78 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
79 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
80 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
81 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
82 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
83 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
84 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
85 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
86 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
87 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
88 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
89 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
90 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
91 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
92 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
93 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
94 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
95 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
96 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
97 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
98 2909042592 Labrys sp. LIt4 Isolate Nodule
99 2922368715
100 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
101 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
102 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
103 2932401849 Devosia sp. 2618 Isolate Rhizosphere
104 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
105 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
106 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
107 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
108 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
109 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
110 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
111 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
112 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
113 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
114 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
115 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
116 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
117 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
118 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
119 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
120 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
121 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
122 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
123 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
124 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
125 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
126 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
127 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
128 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
129 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
130 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
131 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
132 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
133 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
134 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
135 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
136 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
137 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
138 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
139 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
140 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
141 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
142 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
143 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
144 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
145 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
146 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
147 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
148 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
149 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
150 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
151 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
152 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
153 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
154 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
155 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
156 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
157 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
158 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
159 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
160 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
161 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
162 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
163 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
164 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
165 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
166 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
167 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
168 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
169 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
170 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
171 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
172 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
173 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
174 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
175 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
176 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
177 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
178 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
179 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
180 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
184 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
185 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
186 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
187 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
188 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
189 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
190 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
191 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
192 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
193 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
194 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
195 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
196 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
197 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
198 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
199 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
200 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
201 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
202 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
203 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
204 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
205 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
206 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
207 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
208 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
209 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
210 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
211 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
212 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
213 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
214 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
215 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
216 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
217 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
218 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
219 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
220 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
221 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
222 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
223 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
224 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
225 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
226 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
227 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
228 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
229 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
230 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
231 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
232 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
233 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
234 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
235 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
236 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
237 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
238 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
239 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
240 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
241 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
242 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
243 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
244 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
245 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
246 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
247 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
248 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
249 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
250 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
251 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
252 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
253 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
254 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
257 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
260 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
262 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
263 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
304 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
305 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
309 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
310 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
311 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
312 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
313 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
314 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
315 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
316 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
317 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
318 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
319 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
320 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
321 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
322 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
323 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
324 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
325 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
326 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
327 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
328 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
329 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
330 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
331 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
332 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
333 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
334 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
335 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
337 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
338 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
339 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
340 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
341 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
342 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
343 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
344 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
345 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
346 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
347 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
348 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
349 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
350 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
351 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
352 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
353 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
354 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
355 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
356 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
357 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
358 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
359 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
360 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
361 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
362 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
363 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
364 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
365 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
366 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
367 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
368 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
369 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
372 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
373 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
374 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
375 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
378 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
379 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
380 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
381 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
382 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
383 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
384 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
385 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
386 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
387 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
388 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
389 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
390 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
391 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
394 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
395 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
396 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
397 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
398 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
399 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
400 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
401 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
402 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
403 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
404 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
405 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
406 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
407 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
408 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
427 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
428 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
429 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
430 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
431 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
432 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
433 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
434 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
435 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
436 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
437 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
438 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
439 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
444 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
445 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
446 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
447 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
448 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
449 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
453 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
454 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
455 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
456 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
457 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
458 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
459 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
460 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
461 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
462 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
463 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
464 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
467 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
468 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
469 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
470 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
471 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
472 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
473 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
474 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
475 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
476 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
477 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
478 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
479 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
480 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
481 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
484 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
485 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
486 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
487 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
488 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
489 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
490 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
491 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
492 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
493 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
494 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
495 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
496 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
497 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
498 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
499 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
500 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
501 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
502 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
503 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
504 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
505 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
506 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
507 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.96
Metatranscriptomes 0.13
Isolates 23.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.71
Nodule 16.48
Rhizoplane 2.81
Rhizosphere 60.54
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000364 3300003187 Bacteria 47703
2 JGI25406J46586_10004226 3300003203 Bacteria 6705
3 JGI25153J46596_10001434 3300003215 Bacteria 14270
4 rootH2_10066442 3300003320 Bacteria 8724
5 rootH2_10142552 3300003320 Bacteria 1590
6 JGI25160J50197_1001208 3300003354 Bacteria 13129
7 JGI25404J52841_10033949 3300003659 Bacteria 1087
8 Ga0065165_1000370 3300005262 Bacteria 73604
9 Ga0065165_1001957 3300005262 Bacteria 19507
10 Ga0065165_1005374 3300005262 Bacteria 7243
11 Ga0070658_10004155 3300005327 Bacteria 11854
12 Ga0070658_10047644 3300005327 Bacteria 3468
13 Ga0070658_10088141 3300005327 Bacteria 2555
14 Ga0070658_10166809 3300005327 Bacteria 1849
15 Ga0070683_100037482 3300005329 Bacteria 4438
16 Ga0068869_100037313 3300005334 Bacteria 3455
17 Ga0070680_100016995 3300005336 Bacteria 5729
18 Ga0070660_100078596 3300005339 Bacteria 2587
19 Ga0070660_100108955 3300005339 Bacteria 2202
20 Ga0070660_100120072 3300005339 Bacteria 2097
21 Ga0070661_100000296 3300005344 Bacteria 40209
22 Ga0070661_100052782 3300005344 Bacteria 2975
23 Ga0070692_10181832 3300005345 Bacteria 1219
24 Ga0070668_100006611 3300005347 Bacteria 8591
25 Ga0070674_100077375 3300005356 Bacteria 2368
26 Ga0070659_100019155 3300005366 Bacteria 5179
27 Ga0070659_100077345 3300005366 Bacteria 2654
28 Ga0070659_100230528 3300005366 Bacteria 1530
29 Ga0070667_100068854 3300005367 Bacteria 3012
30 Ga0070713_100289226 3300005436 Bacteria 1505
31 Ga0070711_100026226 3300005439 Bacteria 3818
32 Ga0070711_100305302 3300005439 Bacteria 1267
33 Ga0070700_100043939 3300005441 Bacteria 2750
34 Ga0070663_100352032 3300005455 Bacteria 1193
35 Ga0070662_100378642 3300005457 Bacteria 1165
36 Ga0068867_100053823 3300005459 Bacteria 2973
37 Ga0070685_10001551 3300005466 Bacteria 12107
38 Ga0070706_100190045 3300005467 Bacteria 1919
39 Ga0070707_100135995 3300005468 Bacteria 2391
40 Ga0070698_100190944 3300005471 Bacteria 1986
41 Ga0070679_100015177 3300005530 Bacteria 7401
42 Ga0070679_100068564 3300005530 Bacteria 3538
43 Ga0070697_100106840 3300005536 Bacteria 2329
44 Ga0068853_100003694 3300005539 Bacteria 11746
45 Ga0068853_100004956 3300005539 Bacteria 10373
46 Ga0068853_100039780 3300005539 Bacteria 4011
47 Ga0068853_100193669 3300005539 Bacteria 1848
48 Ga0068853_100382481 3300005539 Bacteria 1314
49 Ga0068853_100456238 3300005539 Bacteria 1202
50 Ga0070672_100051615 3300005543 Bacteria 3208
51 Ga0070672_100305665 3300005543 Bacteria 1349
52 Ga0070686_100118452 3300005544 Bacteria 1815
53 Ga0070695_100003415 3300005545 Bacteria 9279
54 Ga0070693_100125560 3300005547 Bacteria 1597
55 Ga0070693_100181357 3300005547 Bacteria 1356
56 Ga0070665_100036876 3300005548 Bacteria 4916
57 Ga0070665_100056839 3300005548 Bacteria 3923
58 Ga0070665_100104771 3300005548 Bacteria 2830
59 Ga0068855_100006841 3300005563 Bacteria 13833
60 Ga0068855_100008845 3300005563 Bacteria 12172
61 Ga0068855_100032594 3300005563 Bacteria 6220
62 Ga0068855_100117641 3300005563 Bacteria 3044
63 Ga0068855_100121746 3300005563 Bacteria 2986
64 Ga0068855_100173592 3300005563 Unclassified 2440
65 Ga0070664_100108745 3300005564 Bacteria 2418
66 Ga0068857_100008234 3300005577 Bacteria 9010
67 Ga0068857_100035375 3300005577 Bacteria 4424
68 Ga0068854_100022479 3300005578 Bacteria 4297
69 Ga0068854_100108470 3300005578 Bacteria 2091
70 Ga0068854_100135849 3300005578 Bacteria 1882
71 Ga0068856_100037083 3300005614 Bacteria 4783
72 Ga0068856_100113050 3300005614 Bacteria 2713
73 Ga0068856_100185382 3300005614 Bacteria 2095
74 Ga0068856_100335598 3300005614 Bacteria 1530
75 Ga0070702_100138826 3300005615 Bacteria 1546
76 Ga0068852_100006572 3300005616 Bacteria 8416
77 Ga0068852_100138707 3300005616 Bacteria 2248
78 Ga0068859_100032209 3300005617 Bacteria 5266
79 Ga0068859_100257204 3300005617 Bacteria 1837
80 Ga0068861_100026505 3300005719 Bacteria 4214
81 Ga0068851_10166874 3300005834 Bacteria 1212
82 Ga0068858_100090754 3300005842 Bacteria 2844
83 Ga0081455_10009815 3300005937 Bacteria 9803
84 Ga0081455_10013086 3300005937 Bacteria 8225
85 Ga0081455_10057249 3300005937 Bacteria 3304
86 Ga0081540_1000024 3300005983 Bacteria 158868
87 Ga0081540_1005059 3300005983 Bacteria 9895
88 Ga0081540_1008220 3300005983 Bacteria 7309
89 Ga0081539_10002797 3300005985 Bacteria 23391
90 Ga0075368_10033032 3300006042 Bacteria 2012
91 Ga0075363_100046010 3300006048 Bacteria 2314
92 Ga0070712_100240971 3300006175 Bacteria 1440
93 Ga0075362_10047135 3300006177 Bacteria 1919
94 Ga0075367_10055274 3300006178 Bacteria 2356
95 Ga0075367_10058420 3300006178 Bacteria 2295
96 Ga0075367_10182112 3300006178 Bacteria 1310
97 Ga0075366_10142314 3300006195 Bacteria 1450
98 Ga0097621_100125937 3300006237 Bacteria 2176
99 Ga0075428_100069849 3300006844 Bacteria 3840
100 Ga0075428_100310243 3300006844 Bacteria 1696
101 Ga0075433_10003359 3300006852 Bacteria 12372
102 Ga0075434_100007129 3300006871 Bacteria 10329
103 Ga0075434_100011459 3300006871 Bacteria 8367
104 Ga0075434_100014087 3300006871 Bacteria 7637
105 Ga0068865_100058248 3300006881 Bacteria 2698
106 Ga0068865_100060720 3300006881 Bacteria 2648
107 Ga0075436_100014041 3300006914 Bacteria 5481
108 Ga0075436_100377212 3300006914 Bacteria 1025
109 Ga0097620_100032204 3300006931 Bacteria 5266
110 Ga0097620_100257203 3300006931 Bacteria 1837
111 Ga0105240_10000330 3300009093 Bacteria 89049
112 Ga0105240_10000528 3300009093 Bacteria 70421
113 Ga0105240_10000580 3300009093 Bacteria 67901
114 Ga0105240_10006878 3300009093 Bacteria 16621
115 Ga0105240_10095611 3300009093 Bacteria 3622
116 Ga0105240_10149956 3300009093 Bacteria 2778
117 Ga0105240_10156006 3300009093 Bacteria 2715
118 Ga0105240_10503143 3300009093 Bacteria 1347
119 Ga0111539_10245669 3300009094 Bacteria 2084
120 Ga0105245_10084638 3300009098 Bacteria 2906
121 Ga0105247_10072812 3300009101 Bacteria 2151
122 Ga0105247_10174424 3300009101 Bacteria 1431
123 Ga0114129_10263995 3300009147 Bacteria 2306
124 Ga0105243_10271706 3300009148 Bacteria 1522
125 Ga0105243_10332332 3300009148 Bacteria 1389
126 Ga0105242_10201528 3300009176 Bacteria 1768
127 Ga0105248_10396834 3300009177 Bacteria 1553
128 Ga0105237_10000203 3300009545 Bacteria 84732
129 Ga0105237_10013295 3300009545 Bacteria 8634
130 Ga0105237_10061656 3300009545 Bacteria 3749
131 Ga0105237_10086902 3300009545 Bacteria 3117
132 Ga0105237_10088428 3300009545 Bacteria 3087
133 Ga0105237_10146577 3300009545 Bacteria 2355
134 Ga0105237_10280046 3300009545 Bacteria 1670
135 Ga0105237_10332517 3300009545 Bacteria 1523
136 Ga0105238_10036434 3300009551 Bacteria 5000
137 Ga0105238_10108214 3300009551 Bacteria 2761
138 Ga0105238_10191372 3300009551 Bacteria 2022
139 Ga0105238_10248726 3300009551 Bacteria 1756
140 Ga0105249_10268161 3300009553 Bacteria 1700
141 Ga0105239_10016961 3300010375 Bacteria 8050
142 Ga0105239_10017508 3300010375 Bacteria 7924
143 Ga0105239_10089786 3300010375 Bacteria 3389
144 Ga0105239_10092739 3300010375 Bacteria 3334
145 Ga0105239_10102866 3300010375 Bacteria 3161
146 Ga0105239_10497434 3300010375 Bacteria 1386
147 Ga0157370_10041917 3300013104 Bacteria 4413
148 Ga0157370_10191880 3300013104 Bacteria 1896
149 Ga0157369_10389341 3300013105 Bacteria 1446
150 Ga0157374_10038068 3300013296 Bacteria 4419
151 Ga0157378_10304938 3300013297 Bacteria 1542
152 Ga0157372_10021475 3300013307 Bacteria 6975
153 Ga0157372_10448022 3300013307 Bacteria 1504
154 Ga0157375_10256440 3300013308 Bacteria 1910
155 Ga0163163_10112189 3300014325 Bacteria 2756
156 Ga0163163_10565447 3300014325 Bacteria 1200
157 Ga0157377_10085211 3300014745 Bacteria 1855
158 Ga0157377_10116249 3300014745 Bacteria 1615
159 Ga0214544_1000003 3300021320 Bacteria 643752
160 Ga0214542_1000003 3300021321 Bacteria 435700
161 Ga0214545_1000004 3300021324 Bacteria 453352
162 Ga0214543_1000007 3300021327 Bacteria 414744
163 Ga0213876_10009961 3300021384 Bacteria 5109
164 Ga0213876_10117339 3300021384 Bacteria 1413
165 Ga0224572_1000989 3300024225 Bacteria 3923
166 Ga0209563_103333 3300025230 Bacteria 3351
167 Ga0209677_106867 3300025253 Bacteria 2582
168 Ga0209233_1005180 3300025261 Bacteria 4353
169 Ga0209130_1000662 3300025284 Bacteria 31434
170 Ga0209675_1000680 3300025291 Bacteria 23730
171 Ga0209025_1000936 3300025294 Bacteria 44418
172 Ga0209564_1007175 3300025295 Bacteria 5809
173 Ga0209564_1022974 3300025295 Bacteria 2183
174 Ga0209758_1000030 3300025297 Bacteria 509217
175 Ga0209758_1002104 3300025297 Bacteria 21134
176 Ga0209758_1003575 3300025297 Bacteria 13918
177 Ga0209758_1007165 3300025297 Bacteria 7693
178 Ga0209758_1044600 3300025297 Bacteria 1618
179 Ga0207426_1000066 3300025302 Bacteria 351182
180 Ga0207426_1000271 3300025302 Bacteria 108392
181 Ga0207426_1000913 3300025302 Bacteria 29549
182 Ga0209257_1000947 3300025304 Bacteria 40051
183 Ga0207692_10214171 3300025898 Bacteria 1139
184 Ga0207642_10034552 3300025899 Bacteria 2151
185 Ga0207710_10028594 3300025900 Bacteria 2420
186 Ga0207710_10091150 3300025900 Bacteria 1427
187 Ga0207645_10055751 3300025907 Bacteria 2523
188 Ga0207645_10070555 3300025907 Bacteria 2235
189 Ga0207643_10265495 3300025908 Bacteria 1061
190 Ga0207705_10008307 3300025909 Bacteria 7581
191 Ga0207705_10063998 3300025909 Bacteria 2658
192 Ga0207705_10079609 3300025909 Bacteria 2386
193 Ga0207684_10118574 3300025910 Bacteria 2268
194 Ga0207654_10015970 3300025911 Bacteria 3904
195 Ga0207707_10019821 3300025912 Bacteria 5871
196 Ga0207695_10000690 3300025913 Bacteria 66191
197 Ga0207695_10000905 3300025913 Bacteria 53386
198 Ga0207695_10005181 3300025913 Bacteria 17451
199 Ga0207695_10010385 3300025913 Bacteria 11392
200 Ga0207695_10010966 3300025913 Bacteria 11017
201 Ga0207695_10029626 3300025913 Bacteria 6042
202 Ga0207695_10051385 3300025913 Bacteria 4329
203 Ga0207671_10000177 3300025914 Bacteria 97072
204 Ga0207671_10028074 3300025914 Bacteria 4206
205 Ga0207671_10034193 3300025914 Bacteria 3778
206 Ga0207671_10060893 3300025914 Bacteria 2801
207 Ga0207671_10086095 3300025914 Bacteria 2362
208 Ga0207693_10235492 3300025915 Bacteria 1438
209 Ga0207660_10012501 3300025917 Bacteria 5556
210 Ga0207662_10044839 3300025918 Bacteria 2612
211 Ga0207657_10006065 3300025919 Bacteria 12571
212 Ga0207657_10025952 3300025919 Bacteria 5394
213 Ga0207657_10084537 3300025919 Bacteria 2659
214 Ga0207657_10116463 3300025919 Bacteria 2202
215 Ga0207649_10001647 3300025920 Bacteria 12960
216 Ga0207649_10031008 3300025920 Bacteria 3173
217 Ga0207652_10018718 3300025921 Bacteria 5683
218 Ga0207652_10509882 3300025921 Bacteria 1082
219 Ga0207646_10039151 3300025922 Bacteria 4266
220 Ga0207681_10188884 3300025923 Bacteria 1575
221 Ga0207694_10056003 3300025924 Bacteria 3062
222 Ga0207694_10081994 3300025924 Bacteria 2534
223 Ga0207659_10075811 3300025926 Bacteria 2469
224 Ga0207706_10385037 3300025933 Bacteria 1217
225 Ga0207686_10111085 3300025934 Bacteria 1849
226 Ga0207669_10024305 3300025937 Bacteria 3254
227 Ga0207669_10029063 3300025937 Bacteria 3051
228 Ga0207691_10197128 3300025940 Bacteria 1754
229 Ga0207691_10471918 3300025940 Bacteria 1067
230 Ga0207679_10019416 3300025945 Bacteria 4565
231 Ga0207667_10010129 3300025949 Bacteria 11039
232 Ga0207667_10016466 3300025949 Bacteria 8354
233 Ga0207667_10040989 3300025949 Bacteria 4928
234 Ga0207667_10128253 3300025949 Unclassified 2613
235 Ga0207667_10148394 3300025949 Bacteria 2414
236 Ga0207667_10214724 3300025949 Bacteria 1971
237 Ga0207667_10227228 3300025949 Bacteria 1912
238 Ga0207668_10003807 3300025972 Bacteria 8889
239 Ga0207668_10208381 3300025972 Bacteria 1562
240 Ga0207668_10316355 3300025972 Bacteria 1294
241 Ga0207640_10001371 3300025981 Bacteria 13177
242 Ga0207640_10114375 3300025981 Bacteria 1920
243 Ga0207640_10129385 3300025981 Bacteria 1822
244 Ga0207703_10084431 3300026035 Bacteria 2655
245 Ga0207639_10000742 3300026041 Bacteria 22258
246 Ga0207639_10002078 3300026041 Bacteria 13488
247 Ga0207639_10145638 3300026041 Bacteria 1978
248 Ga0207639_10188128 3300026041 Bacteria 1761
249 Ga0207639_10252376 3300026041 Bacteria 1539
250 Ga0207678_10066025 3300026067 Bacteria 3107
251 Ga0207678_10075164 3300026067 Bacteria 2894
252 Ga0207702_10059827 3300026078 Bacteria 3246
253 Ga0207702_10188310 3300026078 Bacteria 1905
254 Ga0207702_10233844 3300026078 Bacteria 1719
255 Ga0207641_10080653 3300026088 Bacteria 2824
256 Ga0207648_10067618 3300026089 Bacteria 3114
257 Ga0207674_10009842 3300026116 Bacteria 10885
258 Ga0207674_10017618 3300026116 Bacteria 7790
259 Ga0207674_10119808 3300026116 Bacteria 2600
260 Ga0207675_100029932 3300026118 Bacteria 5069
261 Ga0207675_100033029 3300026118 Bacteria 4822
262 Ga0207683_10071382 3300026121 Bacteria 3069
263 Ga0207683_10229177 3300026121 Bacteria 1694
264 Ga0207698_10037040 3300026142 Bacteria 3588
265 Ga0207698_10104687 3300026142 Bacteria 2355
266 Ga0207698_10133430 3300026142 Bacteria 2126
267 Ga0209998_10004564 3300027717 Bacteria 2938
268 Ga0207428_10076596 3300027907 Bacteria 2619
269 Ga0268266_10012948 3300028379 Bacteria 7192
270 Ga0268266_10048986 3300028379 Bacteria 3621
271 Ga0268266_10183564 3300028379 Bacteria 1906
272 Ga0268266_10275551 3300028379 Bacteria 1563
273 Ga0268265_10007551 3300028380 Bacteria 7339
274 Ga0268264_10040911 3300028381 Bacteria 3830
275 Ga0265319_1011945 3300028563 Bacteria 3530
276 Ga0265334_10000859 3300028573 Bacteria 15224
277 Ga0265334_10001692 3300028573 Bacteria 10542
278 Ga0265318_10000235 3300028577 Bacteria 48102
279 Ga0265318_10027425 3300028577 Bacteria 2238
280 Ga0265336_10029870 3300028666 Bacteria 1698
281 Ga0265338_10000231 3300028800 Bacteria 103805
282 Ga0265338_10063502 3300028800 Bacteria 3219
283 Ga0265338_10071491 3300028800 Bacteria 2967
284 Ga0265324_10019653 3300029957 Bacteria 2431
285 Ga0265324_10031827 3300029957 Bacteria 1846
286 Ga0316177_1090439 3300030731 Bacteria 1750
287 Ga0265325_10003040 3300031241 Bacteria 11100
288 Ga0265325_10015261 3300031241 Bacteria 4323
289 Ga0265325_10021367 3300031241 Bacteria 3556
290 Ga0265340_10024277 3300031247 Bacteria 3081
291 Ga0265339_10001183 3300031249 Bacteria 19723
292 Ga0265339_10003193 3300031249 Bacteria 11505
293 Ga0265339_10004646 3300031249 Bacteria 9334
294 Ga0265331_10022918 3300031250 Bacteria 3180
295 Ga0265331_10029199 3300031250 Bacteria 2754
296 Ga0265327_10004210 3300031251 Bacteria 12931
297 Ga0265327_10006360 3300031251 Bacteria 9469
298 Ga0265327_10009323 3300031251 Bacteria 7103
299 Ga0265316_10019755 3300031344 Bacteria 5753
300 Ga0265316_10084889 3300031344 Bacteria 2424
301 Ga0265316_10106930 3300031344 Bacteria 2122
302 Ga0265313_10000070 3300031595 Bacteria 99384
303 Ga0265313_10001097 3300031595 Bacteria 26024
304 Ga0307508_10108006 3300031616 Bacteria 2382
305 Ga0316575_10013558 3300031665 Bacteria 3046
306 Ga0265314_10022597 3300031711 Bacteria 4817
307 Ga0265314_10049410 3300031711 Bacteria 2945
308 Ga0265314_10160012 3300031711 Bacteria 1371
309 Ga0265342_10019942 3300031712 Bacteria 4312
310 Ga0316576_10040394 3300031727 Bacteria 3353
311 Ga0307405_10437692 3300031731 Bacteria 1033
312 Ga0307413_10030417 3300031824 Bacteria 3033
313 Ga0307410_10093016 3300031852 Bacteria 2145
314 Ga0307407_10072534 3300031903 Bacteria 2054
315 Ga0307407_10100881 3300031903 Bacteria 1791
316 Ga0307414_10040643 3300032004 Bacteria 3143
317 Ga0307414_10047596 3300032004 Bacteria 2952
318 Ga0307414_10390669 3300032004 Bacteria 1206
319 Ga0316585_10050231 3300032137 Bacteria 1339
320 Ga0316580_10018695 3300032139 Bacteria 2132
321 Ga0307510_10069558 3300033180 Bacteria 3524
322 Ga0307510_10168112 3300033180 Bacteria 1777
323 Ga0316596_1020632 3300033541 Bacteria 1677
324 Ga0373926_0057399 3300035083 Bacteria 1414
325 Ga0373928_0053371 3300035084 Bacteria 960
326 Ga0373952_0004512 3300035092 Bacteria 2527
327 Ga0373932_0011863 3300035112 Bacteria 2136
328 Ga0373936_0124052 3300035113 Bacteria 1106
329 Ga0373939_0023631 3300035114 Bacteria 1705
330 Ga0373960_0002357 3300035121 Bacteria 4242
331 Ga0373942_0021556 3300035207 Bacteria 1626
332 Ga0373962_0000511 3300035242 Bacteria 8651
333 Ga0373931_0000317 3300035691 Bacteria 20240
334 Ga0373931_0004250 3300035691 Bacteria 6519
335 Ga0373931_0056848 3300035691 Bacteria 2097
336 Ga0373931_0111734 3300035691 Bacteria 1551
337 Ga0373937_0292426 3300036401 Bacteria 1539
338 Ga0316584_0026886 3300036712 Bacteria 4231
339 Ga0395899_0090875 3300037312 Bacteria 2213
340 Ga0395899_0135921 3300037312 Bacteria 1752
341 Ga0395900_0088124 3300037418 Bacteria 3190
342 Ga0395900_0130332 3300037418 Bacteria 2577
343 Ga0395898_0015010 3300037466 Bacteria 7950
344 Ga0395898_0095492 3300037466 Bacteria 2856
345 Ga0395905_0001838 3300037471 Bacteria 24511
346 Ga0395905_0006347 3300037471 Bacteria 11914
347 Ga0395905_0038350 3300037471 Bacteria 4496
348 Ga0395901_0016268 3300038443 Bacteria 7576
349 Ga0395901_0596900 3300038443 Bacteria 1114
350 Ga0400486_20503 3300038742 Bacteria 1798
351 Ga0400483_205793 3300039062 Bacteria 1918
352 Ga0436365_1001561 3300039437 Bacteria 3202
353 Ga0436360_0818014 3300039438 Bacteria 5526
354 Ga0436360_1148784 3300039438 Bacteria 1050
355 Ga0436361_0660345 3300039447 Bacteria 3103
356 Ga0439465_0017313 3300041413 Bacteria 2250
357 Ga0439431_0010018 3300041997 Bacteria 2147
358 Ga0450898_033063 3300042134 Bacteria 956
359 Ga0466966_0000514 3300044684 Bacteria 24679
360 Ga0466961_0000065 3300044693 Bacteria 63259
361 Ga0453684_0309219 3300044712 Bacteria 1794
362 Ga0453684_0351520 3300044712 Bacteria 1662
363 Ga0453684_0793664 3300044712 Bacteria 1022
364 Ga0466960_0099565 3300044901 Bacteria 1495
365 Ga0466959_0034929 3300045049 Bacteria 3718
366 Ga0451576_0002723 3300045051 Bacteria 25665
367 Ga0495603_0014974 3300046455 Bacteria 4689
368 Ga0495629_0033520 3300046459 Bacteria 3632
369 Ga0495638_0004694 3300046460 Bacteria 10329
370 Ga0495638_0114179 3300046460 Bacteria 1602
371 Ga0495582_0137397 3300046473 Bacteria 1384
372 Ga0495605_0108500 3300046474 Bacteria 1269
373 Ga0495584_0033583 3300046491 Bacteria 2596
374 Ga0495606_0089469 3300046507 Bacteria 1896
375 Ga0495608_0046172 3300046511 Bacteria 2900
376 Ga0495610_0012643 3300046512 Bacteria 5065
377 Ga0495648_0009770 3300046524 Bacteria 7390
378 Ga0495642_0126784 3300046528 Bacteria 1097
379 Ga0495640_0046096 3300046533 Bacteria 3023
380 Ga0495622_0012727 3300046557 Bacteria 3901
381 Ga0495622_0018741 3300046557 Bacteria 3223
382 Ga0495634_0083755 3300046642 Bacteria 2081
383 Ga0495649_0102515 3300046694 Bacteria 1520
384 Ga0495589_0139462 3300046794 Bacteria 1162
385 Ga0495600_0035934 3300046809 Bacteria 3220
386 Ga0495604_0005237 3300047317 Bacteria 10272
387 Ga0495672_0008715 3300047320 Bacteria 7440
388 Ga0495676_0054208 3300047321 Bacteria 3189
389 Ga0495683_0156123 3300047323 Bacteria 1058
390 Ga0495685_011583 3300047447 Bacteria 2979
391 Ga0495686_0081092 3300047472 Bacteria 1982
392 Ga0496100_0031553 3300048903 Bacteria 3296
393 Ga0496100_0138828 3300048903 Bacteria 1720
394 Ga0496101_0351453 3300048904 Bacteria 1158
395 Ga0496102_0250076 3300048905 Bacteria 1671
396 Ga0496102_0291725 3300048905 Bacteria 1537
397 Ga0496102_0662700 3300048905 Bacteria 967
398 Ga0496104_0002953 3300048907 Bacteria 14655
399 Ga0496104_0017706 3300048907 Bacteria 6495
400 Ga0496104_0061414 3300048907 Bacteria 3563
401 Ga0496104_0136008 3300048907 Bacteria 2361
402 Ga0496105_0006535 3300048908 Bacteria 8969
403 Ga0496105_0046907 3300048908 Bacteria 3566
404 Ga0496106_0016353 3300048909 Bacteria 5488
405 Ga0496106_0236064 3300048909 Bacteria 1461
406 Ga0496107_0130036 3300048910 Bacteria 1858
407 Ga0496108_0130499 3300048911 Bacteria 2160
408 Ga0496109_0107931 3300048912 Bacteria 2587
409 Ga0496110_0064428 3300048913 Bacteria 3239
410 Ga0496111_0039403 3300048914 Bacteria 3387
411 Ga0496112_0048414 3300048915 Bacteria 4167
412 Ga0496113_0048761 3300048916 Bacteria 3152
413 Ga0496115_0013248 3300048918 Bacteria 6231
414 Ga0496118_0013220 3300048921 Bacteria 7828
415 Ga0496119_0003665 3300048922 Bacteria 15760
416 Ga0496120_0009533 3300048923 Bacteria 6874
417 Ga0496121_0009006 3300048924 Bacteria 11574
418 Ga0496121_0129656 3300048924 Bacteria 1890
419 Ga0496122_0165963 3300048925 Bacteria 1339
420 Ga0496124_0264997 3300048927 Bacteria 1262
421 Ga0496125_0000129 3300048928 Bacteria 163342
422 Ga0496125_0052412 3300048928 Bacteria 3355
423 Ga0496126_0060831 3300048929 Bacteria 3395
424 Ga0496126_0138968 3300048929 Bacteria 2093
425 Ga0496126_0172047 3300048929 Bacteria 1844
426 Ga0501031_0026839 3300049568 Bacteria 3754
427 Ga0501031_0046568 3300049568 Bacteria 2828
428 Ga0501032_0001280 3300049569 Bacteria 20167
429 Ga0501032_0002117 3300049569 Bacteria 15668
430 Ga0501032_0034381 3300049569 Bacteria 3470
431 Ga0501032_0149610 3300049569 Bacteria 1536
432 Ga0501032_0190931 3300049569 Bacteria 1339
433 Ga0501033_0278829 3300049570 Bacteria 1180
434 Ga0501034_0000014 3300049571 Bacteria 297798
435 Ga0501034_0002255 3300049571 Bacteria 23658
436 Ga0501034_0027234 3300049571 Bacteria 5815
437 Ga0501034_0035985 3300049571 Bacteria 5020
438 Ga0501034_0045903 3300049571 Bacteria 4414
439 Ga0501034_0048444 3300049571 Bacteria 4288
440 Ga0501034_0065054 3300049571 Bacteria 3659
441 Ga0501034_0082433 3300049571 Bacteria 3218
442 Ga0501034_0144197 3300049571 Bacteria 2359
443 Ga0501034_0150473 3300049571 Bacteria 2303
444 Ga0501034_0274711 3300049571 Bacteria 1625
445 Ga0501034_0283965 3300049571 Bacteria 1594
446 Ga0501034_0411917 3300049571 Bacteria 1274
447 Ga0501036_0005290 3300049572 Bacteria 10442
448 Ga0501036_0033700 3300049572 Bacteria 4331
449 Ga0501036_0049535 3300049572 Bacteria 3557
450 Ga0501036_0090811 3300049572 Bacteria 2580
451 Ga0501037_0001132 3300049573 Bacteria 19740
452 Ga0501037_0026272 3300049573 Bacteria 4303
453 Ga0501037_0040541 3300049573 Bacteria 3427
454 Ga0501037_0213251 3300049573 Bacteria 1361
455 Ga0501038_0025537 3300049574 Bacteria 5265
456 Ga0501038_0343538 3300049574 Bacteria 1164
457 Ga0501039_0000087 3300049575 Bacteria 69688
458 Ga0501039_0065716 3300049575 Bacteria 2814
459 Ga0501040_0128850 3300049576 Bacteria 1778
460 Ga0501040_0243381 3300049576 Bacteria 1283
461 Ga0501042_0068376 3300049578 Bacteria 2540
462 Ga0501043_0005072 3300049579 Bacteria 10653
463 Ga0501043_0207789 3300049579 Bacteria 1518
464 Ga0501043_0250460 3300049579 Bacteria 1364
465 Ga0501043_0318966 3300049579 Bacteria 1185
466 Ga0501046_0013316 3300049580 Bacteria 6967
467 Ga0501046_0031958 3300049580 Bacteria 4264
468 Ga0501046_0042249 3300049580 Bacteria 3635
469 Ga0501046_0167845 3300049580 Bacteria 1648
470 Ga0501047_0000684 3300049581 Bacteria 35329
471 Ga0501047_0020745 3300049581 Bacteria 6312
472 Ga0501047_0090564 3300049581 Bacteria 2936
473 Ga0501047_0272201 3300049581 Bacteria 1540
474 Ga0501047_0283361 3300049581 Bacteria 1501
475 Ga0501047_0448438 3300049581 Bacteria 1120
476 Ga0501048_0000662 3300049582 Bacteria 24880
477 Ga0501048_0039825 3300049582 Bacteria 3369
478 Ga0501048_0162808 3300049582 Bacteria 1579
479 Ga0501067_0000308 3300049583 Bacteria 26907
480 Ga0501067_0000499 3300049583 Bacteria 21525
481 Ga0501067_0024598 3300049583 Bacteria 3340
482 Ga0501068_0001071 3300049584 Bacteria 14464
483 Ga0501070_0019277 3300049586 Bacteria 5721
484 Ga0501070_0047767 3300049586 Bacteria 3556
485 Ga0501070_0107854 3300049586 Bacteria 2301
486 Ga0501070_0221803 3300049586 Bacteria 1550
487 Ga0501070_0276074 3300049586 Bacteria 1372
488 Ga0501070_0428406 3300049586 Bacteria 1068
489 Ga0501071_0195109 3300049587 Bacteria 1519
490 Ga0501072_0055628 3300049588 Bacteria 3118
491 Ga0501072_0253755 3300049588 Bacteria 1400
492 Ga0501072_0291288 3300049588 Bacteria 1298
493 Ga0501072_0329890 3300049588 Bacteria 1212
494 Ga0501072_0380144 3300049588 Bacteria 1121
495 Ga0501073_0000010 3300049589 Bacteria 171144
496 Ga0501073_0060766 3300049589 Bacteria 2637
497 Ga0501073_0076947 3300049589 Bacteria 2322
498 Ga0501074_0082193 3300049590 Bacteria 2310
499 Ga0501074_0109807 3300049590 Bacteria 1973
500 Ga0501074_0151443 3300049590 Bacteria 1658
501 Ga0501075_0056591 3300049591 Bacteria 2952
502 Ga0501075_0198885 3300049591 Bacteria 1528
503 Ga0501076_0184287 3300049592 Bacteria 1702
504 Ga0501077_0000020 3300049593 Bacteria 80360
505 Ga0501077_0008063 3300049593 Bacteria 6511
506 Ga0501077_0015004 3300049593 Bacteria 4870
507 Ga0501080_0000010 3300049742 Bacteria 115062
508 Ga0501080_0229534 3300049742 Bacteria 1697
509 Ga0501080_0294217 3300049742 Bacteria 1474
510 Ga0501081_0001600 3300049743 Bacteria 13983
511 Ga0501081_0080906 3300049743 Bacteria 2274
512 Ga0501081_0162116 3300049743 Bacteria 1611
513 Ga0501083_0086804 3300049744 Bacteria 2069
514 Ga0501083_0227693 3300049744 Bacteria 1214
515 Ga0501035_0000034 3300049822 Bacteria 174589
516 Ga0501044_0000039 3300049823 Bacteria 158218
517 Ga0501044_0005041 3300049823 Bacteria 14749
518 Ga0501044_0008445 3300049823 Bacteria 11289
519 Ga0501044_0029578 3300049823 Bacteria 5775
520 Ga0501044_0045934 3300049823 Bacteria 4523
521 Ga0501044_0152178 3300049823 Bacteria 2295
522 Ga0501044_0256049 3300049823 Bacteria 1690
523 Ga0501044_0355494 3300049823 Bacteria 1384
524 Ga0501045_0035496 3300049824 Bacteria 3620
525 Ga0501045_0089774 3300049824 Bacteria 2270
526 nmdc:mga03683_6846_c1 3300050489 Bacteria 3925
527 nmdc:mga03n38_41493_c1 3300050490 Bacteria 2006
528 nmdc:mga03n38_65694_c1 3300050490 Bacteria 1664
529 nmdc:mga0k408_79495_c1 3300050493 Bacteria 1919
530 nmdc:mga06z11_140066_c1 3300050494 Bacteria 1367
531 nmdc:mga06z11_65237_c1 3300050494 Bacteria 1910
532 nmdc:mga07m45_22760_c1 3300050496 Bacteria 3423
533 nmdc:mga05p37_260609_c1 3300050507 Bacteria 2075
534 nmdc:mga0qj67_129900_c1 3300050509 Bacteria 2040
535 nmdc:mga0qj67_141420_c1 3300050509 Bacteria 1951
536 nmdc:mga06r32_130964_c1 3300050510 Bacteria 2480
537 nmdc:mga06r32_388932_c1 3300050510 Bacteria 1377
538 nmdc:mga08y16_158892_c1 3300050511 Bacteria 2349
539 nmdc:mga0n895_108082_c1 3300050512 Bacteria 2796
540 nmdc:mga0n895_6477_c1 3300050512 Bacteria 9946
541 nmdc:mga0n895_66835_c1 3300050512 Bacteria 3559
542 nmdc:mga0n895_9018_c1 3300050512 Bacteria 8699
543 nmdc:mga08x19_336539_c1 3300050514 Bacteria 1052
544 nmdc:mga0a205_1693_c1 3300050515 Bacteria 19041
545 nmdc:mga0sz30_72508_c1 3300050516 Bacteria 1484
546 Ga0495601_0006336 3300053077 Bacteria 6914
547 Ga0500635_0001030 3300053080 Bacteria 6665
548 Ga0500635_0008518 3300053080 Bacteria 2815
549 Ga0500643_011377 3300053087 Bacteria 3250
550 Ga0500643_018319 3300053087 Bacteria 2327
551 Ga0500566_0000351 3300053094 Bacteria 25000
552 Ga0500566_0003690 3300053094 Bacteria 9142
553 Ga0500566_0004102 3300053094 Bacteria 8686
554 Ga0500566_0101534 3300053094 Bacteria 1576
555 Ga0500640_002238 3300053095 Bacteria 6318
556 Ga0500641_0000510 3300053096 Bacteria 13992
557 Ga0500641_0072540 3300053096 Bacteria 1451
558 Ga0500556_0002319 3300053104 Bacteria 6243
559 Ga0500572_000903 3300053111 Bacteria 9176
560 Ga0500591_050672 3300053115 Bacteria 1947
561 Ga0500593_000015 3300053117 Bacteria 58134
562 Ga0500595_000141 3300053119 Bacteria 46988
563 Ga0500595_012010 3300053119 Bacteria 3362
564 Ga0500595_016954 3300053119 Bacteria 2703
565 Ga0500607_038072 3300053121 Bacteria 2618
566 Ga0500608_018687 3300053122 Bacteria 3167
567 Ga0500652_065002 3300053131 Bacteria 1507
568 Ga0500568_0000004 3300053139 Bacteria 621666
569 Ga0500568_0034233 3300053139 Bacteria 2079
570 Ga0500577_0094289 3300053142 Bacteria 1215
571 Ga0500603_011934 3300053150 Bacteria 1986
572 Ga0500604_0003067 3300053151 Bacteria 4488
573 Ga0500616_0005500 3300053153 Bacteria 8590
574 Ga0500616_0023683 3300053153 Bacteria 3419
575 Ga0500630_000445 3300053159 Bacteria 18003
576 Ga0500634_0000017 3300053161 Bacteria 111983
577 Ga0500639_000103 3300053163 Bacteria 39784
578 Ga0500636_0021148 3300053177 Bacteria 3852
579 Ga0500636_0162035 3300053177 Bacteria 1218
580 Ga0500637_0000311 3300053178 Bacteria 18186
581 Ga0500637_0005785 3300053178 Bacteria 6018
582 Ga0500637_0093985 3300053178 Bacteria 1737
583 Ga0500599_005464 3300053736 Bacteria 1597
584 Ga0500601_000420 3300053737 Bacteria 7101
585 Ga0501084_0004495 3300054114 Bacteria 11396
586 Ga0501084_0278533 3300054114 Bacteria 1412
587 Ga0501084_0328188 3300054114 Bacteria 1292
588 Ga0501084_0636341 3300054114 Bacteria 901
589 Ga0501082_0019819 3300060353 Bacteria 5800
590 Ga0501082_0055412 3300060353 Bacteria 3416
591 Ga0501082_0180033 3300060353 Bacteria 1838
592 Ga0501082_0209574 3300060353 Bacteria 1696
593 Ga0501082_0266752 3300060353 Bacteria 1490
594 Ga0530510_0023645 3300061734 Bacteria 4381
595 Ga0530510_0027092 3300061734 Bacteria 4105

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0207789 Ga0501043_0207789_448_1428 244
2 3300049823 Ga0501044_0152178 Ga0501044_0152178_622_1602 245
3 3300054114 Ga0501084_0636341 Ga0501084_0636341_17_850 256
4 3300005577 Ga0068857_100035375 Ga0068857_1000353753 257
5 3300009551 Ga0105238_10191372 Ga0105238_101913722 257
6 3300025924 Ga0207694_10081994 Ga0207694_100819942 257
7 3300026116 Ga0207674_10017618 Ga0207674_100176184 257
8 3300005339 Ga0070660_100078596 Ga0070660_1000785962 258
9 3300005548 Ga0070665_100056839 Ga0070665_1000568393 258
10 3300009545 Ga0105237_10000203 Ga0105237_1000020322 258
11 3300010375 Ga0105239_10016961 Ga0105239_100169616 258
12 3300025914 Ga0207671_10000177 Ga0207671_1000017748 258
13 3300025919 Ga0207657_10116463 Ga0207657_101164632 258
14 3300028379 Ga0268266_10012948 Ga0268266_100129485 258
15 3300005563 Ga0068855_100173592 Ga0068855_1001735923 260
16 3300005530 Ga0070679_100068564 Ga0070679_1000685642 262
17 3300014325 Ga0163163_10112189 Ga0163163_101121892 262
18 3300038443 Ga0395901_0596900 Ga0395901_0596900_38_892 262
19 3300031250 Ga0265331_10022918 Ga0265331_100229183 264
20 3300031251 Ga0265327_10009323 Ga0265327_100093235 264
21 3300048905 Ga0496102_0662700 Ga0496102_0662700_12_878 266
22 3300045051 Ga0451576_0002723 Ga0451576_0002723_20001_20879 267
23 3300044712 Ga0453684_0309219 Ga0453684_0309219_434_1315 268
24 3300049586 Ga0501070_0221803 Ga0501070_0221803_289_1302 268
25 3300005539 Ga0068853_100004956 Ga0068853_10000495611 269
26 3300026041 Ga0207639_10002078 Ga0207639_1000207811 269
27 3300031251 Ga0265327_10006360 Ga0265327_100063605 269
28 3300035084 Ga0373928_0053371 Ga0373928_0053371_14_889 269
29 3300049568 Ga0501031_0046568 Ga0501031_0046568_1338_2309 269
30 3300049573 Ga0501037_0026272 Ga0501037_0026272_2195_3166 269
31 3300044712 Ga0453684_0351520 Ga0453684_0351520_91_984 270
32 3300044712 Ga0453684_0793664 Ga0453684_0793664_38_922 270
33 3300009093 Ga0105240_10000330 Ga0105240_1000033023 271
34 3300009093 Ga0105240_10000580 Ga0105240_1000058047 271
35 3300025913 Ga0207695_10000690 Ga0207695_1000069037 271
36 3300025913 Ga0207695_10000905 Ga0207695_1000090518 271
37 3300025949 Ga0207667_10128253 Ga0207667_101282533 271
38 3300031251 Ga0265327_10004210 Ga0265327_1000421014 271
39 3300031616 Ga0307508_10108006 Ga0307508_101080062 272
40 3300031711 Ga0265314_10160012 Ga0265314_101600122 275
41 3300042134 Ga0450898_033063 Ga0450898_033063_43_924 275
42 3300049570 Ga0501033_0278829 Ga0501033_0278829_167_1126 275
43 3300005468 Ga0070707_100135995 Ga0070707_1001359952 276
44 3300006844 Ga0075428_100310243 Ga0075428_1003102432 276
45 3300006914 Ga0075436_100014041 Ga0075436_1000140413 276
46 3300031665 Ga0316575_10013558 Ga0316575_100135583 276
47 3300031727 Ga0316576_10040394 Ga0316576_100403942 276
48 3300032137 Ga0316585_10050231 Ga0316585_100502311 276
49 3300032139 Ga0316580_10018695 Ga0316580_100186952 276
50 3300033541 Ga0316596_1020632 Ga0316596_10206321 276
51 3300035083 Ga0373926_0057399 Ga0373926_0057399_183_1067 276
52 3300036712 Ga0316584_0026886 Ga0316584_0026886_519_1445 276
53 3300050509 nmdc:mga0qj67_141420_c1 nmdc:mga0qj67_141420_c1_383_1267 276
54 3300029957 Ga0265324_10031827 Ga0265324_100318272 277
55 3300005539 Ga0068853_100456238 Ga0068853_1004562382 278
56 3300026041 Ga0207639_10145638 Ga0207639_101456382 278
57 3300005719 Ga0068861_100026505 Ga0068861_1000265052 279
58 3300006881 Ga0068865_100060720 Ga0068865_1000607202 279
59 3300025899 Ga0207642_10034552 Ga0207642_100345521 279
60 3300025937 Ga0207669_10024305 Ga0207669_100243053 279
61 3300026118 Ga0207675_100029932 Ga0207675_1000299322 279
62 3300028380 Ga0268265_10007551 Ga0268265_100075513 279
63 3300032004 Ga0307414_10040643 Ga0307414_100406432 279
64 3300053087 Ga0500643_011377 Ga0500643_011377_836_1729 279
65 3300060353 Ga0501082_0055412 Ga0501082_0055412_168_1130 279
66 iso_pu_bacteria 2643221629 2644169439 279
67 iso_pu_bacteria 2643221662 2644350837 279
68 3300033180 Ga0307510_10168112 Ga0307510_101681122 280
69 3300049581 Ga0501047_0272201 Ga0501047_0272201_553_1452 280
70 3300053119 Ga0500595_016954 Ga0500595_016954_490_1446 280
71 3300009093 Ga0105240_10000528 Ga0105240_1000052860 281
72 3300009545 Ga0105237_10086902 Ga0105237_100869021 281
73 3300010375 Ga0105239_10497434 Ga0105239_104974342 281
74 3300025913 Ga0207695_10010966 Ga0207695_100109667 281
75 3300025914 Ga0207671_10028074 Ga0207671_100280743 281
76 3300039447 Ga0436361_0660345 Ga0436361_0660345_2061_3002 281
77 3300046511 Ga0495608_0046172 Ga0495608_0046172_1459_2346 281
78 3300049572 Ga0501036_0090811 Ga0501036_0090811_268_1194 281
79 3300049575 Ga0501039_0065716 Ga0501039_0065716_487_1413 281
80 3300049582 Ga0501048_0039825 Ga0501048_0039825_972_1898 281
81 3300049586 Ga0501070_0276074 Ga0501070_0276074_269_1195 281
82 3300049588 Ga0501072_0055628 Ga0501072_0055628_664_1590 281
83 3300049824 Ga0501045_0035496 Ga0501045_0035496_1125_2051 281
84 3300061734 Ga0530510_0023645 Ga0530510_0023645_2745_3671 281
85 3300005563 Ga0068855_100006841 Ga0068855_1000068414 282
86 3300005937 Ga0081455_10009815 Ga0081455_100098153 282
87 3300005937 Ga0081455_10057249 Ga0081455_100572492 282
88 3300009093 Ga0105240_10149956 Ga0105240_101499562 282
89 3300009545 Ga0105237_10061656 Ga0105237_100616563 282
90 3300021320 Ga0214544_1000003 Ga0214544_1000003395 282
91 3300021321 Ga0214542_1000003 Ga0214542_1000003385 282
92 3300021324 Ga0214545_1000004 Ga0214545_1000004398 282
93 3300021327 Ga0214543_1000007 Ga0214543_100000719 282
94 3300025913 Ga0207695_10010385 Ga0207695_100103852 282
95 3300025949 Ga0207667_10010129 Ga0207667_100101293 282
96 3300048907 Ga0496104_0136008 Ga0496104_0136008_906_1817 282
97 3300053080 Ga0500635_0001030 Ga0500635_0001030_574_1515 282
98 3300053178 Ga0500637_0093985 Ga0500637_0093985_645_1586 282
99 3300053737 Ga0500601_000420 Ga0500601_000420_50_988 282
100 iso_pu_bacteria 2643221580 2643911770 282
101 iso_pu_bacteria 2643221591 2643965629 282
102 iso_pu_bacteria 2643221674 2644413138 282
103 iso_pu_bacteria 2932401849 2932406023 282
104 3300003320 rootH2_10066442 rootH2_1006644210 283
105 3300005327 Ga0070658_10004155 Ga0070658_100041558 283
106 3300005339 Ga0070660_100120072 Ga0070660_1001200722 283
107 3300005366 Ga0070659_100077345 Ga0070659_1000773452 283
108 3300005455 Ga0070663_100352032 Ga0070663_1003520322 283
109 3300005563 Ga0068855_100032594 Ga0068855_1000325945 283
110 3300005578 Ga0068854_100135849 Ga0068854_1001358492 283
111 3300005614 Ga0068856_100335598 Ga0068856_1003355982 283
112 3300006178 Ga0075367_10182112 Ga0075367_101821121 283
113 3300009093 Ga0105240_10006878 Ga0105240_100068786 283
114 3300009545 Ga0105237_10146577 Ga0105237_101465772 283
115 3300009545 Ga0105237_10332517 Ga0105237_103325172 283
116 3300009551 Ga0105238_10108214 Ga0105238_101082143 283
117 3300009553 Ga0105249_10268161 Ga0105249_102681612 283
118 3300013296 Ga0157374_10038068 Ga0157374_100380685 283
119 3300013297 Ga0157378_10304938 Ga0157378_103049382 283
120 3300025898 Ga0207692_10214171 Ga0207692_102141712 283
121 3300025909 Ga0207705_10008307 Ga0207705_100083075 283
122 3300025909 Ga0207705_10079609 Ga0207705_100796092 283
123 3300025913 Ga0207695_10029626 Ga0207695_100296265 283
124 3300025919 Ga0207657_10006065 Ga0207657_100060659 283
125 3300025921 Ga0207652_10509882 Ga0207652_105098822 283
126 3300025940 Ga0207691_10471918 Ga0207691_104719182 283
127 3300025949 Ga0207667_10040989 Ga0207667_100409896 283
128 3300025981 Ga0207640_10114375 Ga0207640_101143752 283
129 3300026067 Ga0207678_10075164 Ga0207678_100751643 283
130 3300028379 Ga0268266_10048986 Ga0268266_100489862 283
131 3300037312 Ga0395899_0090875 Ga0395899_0090875_540_1517 283
132 3300037466 Ga0395898_0015010 Ga0395898_0015010_2554_3531 283
133 3300038443 Ga0395901_0016268 Ga0395901_0016268_540_1517 283
134 3300041413 Ga0439465_0017313 Ga0439465_0017313_266_1225 283
135 3300046460 Ga0495638_0114179 Ga0495638_0114179_603_1544 283
136 3300046512 Ga0495610_0012643 Ga0495610_0012643_1895_2848 283
137 3300048921 Ga0496118_0013220 Ga0496118_0013220_6803_7744 283
138 3300048929 Ga0496126_0138968 Ga0496126_0138968_235_1218 283
139 3300049569 Ga0501032_0149610 Ga0501032_0149610_235_1221 283
140 3300049571 Ga0501034_0065054 Ga0501034_0065054_1318_2304 283
141 3300049581 Ga0501047_0283361 Ga0501047_0283361_397_1383 283
142 3300049742 Ga0501080_0294217 Ga0501080_0294217_314_1300 283
143 3300049823 Ga0501044_0045934 Ga0501044_0045934_2934_3920 283
144 3300003203 JGI25406J46586_10004226 JGI25406J46586_100042265 284
145 3300005457 Ga0070662_100378642 Ga0070662_1003786421 284
146 3300005985 Ga0081539_10002797 Ga0081539_100027978 284
147 3300025933 Ga0207706_10385037 Ga0207706_103850371 284
148 3300026121 Ga0207683_10229177 Ga0207683_102291772 284
149 3300031241 Ga0265325_10015261 Ga0265325_100152612 284
150 3300039062 Ga0400483_205793 Ga0400483_205793_206_1135 284
151 3300049571 Ga0501034_0144197 Ga0501034_0144197_336_1316 284
152 3300049571 Ga0501034_0283965 Ga0501034_0283965_357_1265 284
153 3300049586 Ga0501070_0047767 Ga0501070_0047767_1896_2804 284
154 3300049590 Ga0501074_0082193 Ga0501074_0082193_543_1451 284
155 3300049823 Ga0501044_0029578 Ga0501044_0029578_2859_3767 284
156 iso_pu_bacteria 2829745981 2829746515 284
157 3300005327 Ga0070658_10166809 Ga0070658_101668092 285
158 3300005336 Ga0070680_100016995 Ga0070680_1000169952 285
159 3300005439 Ga0070711_100026226 Ga0070711_1000262262 285
160 3300005563 Ga0068855_100008845 Ga0068855_1000088459 285
161 3300005614 Ga0068856_100113050 Ga0068856_1001130502 285
162 3300006175 Ga0070712_100240971 Ga0070712_1002409712 285
163 3300013104 Ga0157370_10041917 Ga0157370_100419171 285
164 3300025909 Ga0207705_10063998 Ga0207705_100639982 285
165 3300025912 Ga0207707_10019821 Ga0207707_100198211 285
166 3300025917 Ga0207660_10012501 Ga0207660_100125012 285
167 3300025949 Ga0207667_10227228 Ga0207667_102272281 285
168 3300026078 Ga0207702_10233844 Ga0207702_102338441 285
169 3300030731 Ga0316177_1090439 Ga0316177_10904392 285
170 3300031241 Ga0265325_10021367 Ga0265325_100213672 285
171 3300035113 Ga0373936_0124052 Ga0373936_0124052_58_996 285
172 3300048911 Ga0496108_0130499 Ga0496108_0130499_37_978 285
173 3300049588 Ga0501072_0291288 Ga0501072_0291288_257_1183 285
174 3300049588 Ga0501072_0380144 Ga0501072_0380144_38_1015 285
175 3300053094 Ga0500566_0004102 Ga0500566_0004102_243_1181 285
176 3300053119 Ga0500595_000141 Ga0500595_000141_4252_5190 285
177 3300053150 Ga0500603_011934 Ga0500603_011934_247_1185 285
178 3300053177 Ga0500636_0162035 Ga0500636_0162035_219_1160 285
179 3300053178 Ga0500637_0000311 Ga0500637_0000311_9195_10133 285
180 3300005347 Ga0070668_100006611 Ga0070668_10000661110 286
181 3300005367 Ga0070667_100068854 Ga0070667_1000688543 286
182 3300005530 Ga0070679_100015177 Ga0070679_1000151775 286
183 3300009176 Ga0105242_10201528 Ga0105242_102015282 286
184 3300025915 Ga0207693_10235492 Ga0207693_102354921 286
185 3300025921 Ga0207652_10018718 Ga0207652_100187184 286
186 3300025934 Ga0207686_10111085 Ga0207686_101110852 286
187 3300025972 Ga0207668_10003807 Ga0207668_1000380711 286
188 3300026041 Ga0207639_10252376 Ga0207639_102523761 286
189 3300028563 Ga0265319_1011945 Ga0265319_10119453 286
190 3300028573 Ga0265334_10001692 Ga0265334_100016925 286
191 3300028577 Ga0265318_10027425 Ga0265318_100274252 286
192 3300028666 Ga0265336_10029870 Ga0265336_100298702 286
193 3300028800 Ga0265338_10000231 Ga0265338_1000023112 286
194 3300029957 Ga0265324_10019653 Ga0265324_100196532 286
195 3300031249 Ga0265339_10004646 Ga0265339_100046469 286
196 3300031824 Ga0307413_10030417 Ga0307413_100304172 286
197 3300031852 Ga0307410_10093016 Ga0307410_100930162 286
198 3300031903 Ga0307407_10072534 Ga0307407_100725342 286
199 3300032004 Ga0307414_10047596 Ga0307414_100475962 286
200 3300032004 Ga0307414_10390669 Ga0307414_103906692 286
201 3300036401 Ga0373937_0292426 Ga0373937_0292426_223_1155 286
202 3300048914 Ga0496111_0039403 Ga0496111_0039403_1228_2199 286
203 3300048928 Ga0496125_0000129 Ga0496125_0000129_29078_30049 286
204 3300048928 Ga0496125_0052412 Ga0496125_0052412_1271_2245 286
205 3300048929 Ga0496126_0060831 Ga0496126_0060831_635_1609 286
206 3300049571 Ga0501034_0002255 Ga0501034_0002255_17305_18276 286
207 3300049571 Ga0501034_0411917 Ga0501034_0411917_283_1257 286
208 3300053151 Ga0500604_0003067 Ga0500604_0003067_3395_4366 286
209 3300053161 Ga0500634_0000017 Ga0500634_0000017_66639_67613 286
210 iso_pu_bacteria 2671180139 2671693828 286
211 3300003354 JGI25160J50197_1001208 JGI25160J50197_10012087 287
212 3300005327 Ga0070658_10047644 Ga0070658_100476443 287
213 3300005327 Ga0070658_10088141 Ga0070658_100881411 287
214 3300005329 Ga0070683_100037482 Ga0070683_1000374823 287
215 3300005344 Ga0070661_100000296 Ga0070661_10000029644 287
216 3300005344 Ga0070661_100052782 Ga0070661_1000527822 287
217 3300005356 Ga0070674_100077375 Ga0070674_1000773752 287
218 3300005366 Ga0070659_100019155 Ga0070659_1000191552 287
219 3300005459 Ga0068867_100053823 Ga0068867_1000538233 287
220 3300005466 Ga0070685_10001551 Ga0070685_1000155114 287
221 3300005539 Ga0068853_100003694 Ga0068853_1000036947 287
222 3300005539 Ga0068853_100039780 Ga0068853_1000397803 287
223 3300005543 Ga0070672_100051615 Ga0070672_1000516152 287
224 3300005547 Ga0070693_100125560 Ga0070693_1001255602 287
225 3300005548 Ga0070665_100036876 Ga0070665_1000368764 287
226 3300005563 Ga0068855_100117641 Ga0068855_1001176412 287
227 3300005563 Ga0068855_100121746 Ga0068855_1001217463 287
228 3300005564 Ga0070664_100108745 Ga0070664_1001087452 287
229 3300005577 Ga0068857_100008234 Ga0068857_10000823410 287
230 3300005578 Ga0068854_100022479 Ga0068854_1000224792 287
231 3300005578 Ga0068854_100108470 Ga0068854_1001084702 287
232 3300005614 Ga0068856_100037083 Ga0068856_1000370835 287
233 3300005614 Ga0068856_100185382 Ga0068856_1001853822 287
234 3300005616 Ga0068852_100006572 Ga0068852_1000065726 287
235 3300005616 Ga0068852_100138707 Ga0068852_1001387073 287
236 3300005834 Ga0068851_10166874 Ga0068851_101668742 287
237 3300005983 Ga0081540_1005059 Ga0081540_100505912 287
238 3300006042 Ga0075368_10033032 Ga0075368_100330321 287
239 3300006048 Ga0075363_100046010 Ga0075363_1000460102 287
240 3300006177 Ga0075362_10047135 Ga0075362_100471352 287
241 3300006178 Ga0075367_10055274 Ga0075367_100552743 287
242 3300006178 Ga0075367_10058420 Ga0075367_100584202 287
243 3300006195 Ga0075366_10142314 Ga0075366_101423142 287
244 3300006237 Ga0097621_100125937 Ga0097621_1001259372 287
245 3300006881 Ga0068865_100058248 Ga0068865_1000582483 287
246 3300009093 Ga0105240_10156006 Ga0105240_101560063 287
247 3300009093 Ga0105240_10503143 Ga0105240_105031431 287
248 3300009551 Ga0105238_10036434 Ga0105238_100364344 287
249 3300010375 Ga0105239_10089786 Ga0105239_100897862 287
250 3300013104 Ga0157370_10191880 Ga0157370_101918802 287
251 3300013105 Ga0157369_10389341 Ga0157369_103893412 287
252 3300013307 Ga0157372_10021475 Ga0157372_100214755 287
253 3300014325 Ga0163163_10565447 Ga0163163_105654472 287
254 3300025291 Ga0209675_1000680 Ga0209675_100068018 287
255 3300025302 Ga0207426_1000271 Ga0207426_100027113 287
256 3300025907 Ga0207645_10055751 Ga0207645_100557512 287
257 3300025907 Ga0207645_10070555 Ga0207645_100705551 287
258 3300025913 Ga0207695_10051385 Ga0207695_100513852 287
259 3300025914 Ga0207671_10086095 Ga0207671_100860952 287
260 3300025919 Ga0207657_10025952 Ga0207657_100259522 287
261 3300025920 Ga0207649_10001647 Ga0207649_100016478 287
262 3300025920 Ga0207649_10031008 Ga0207649_100310083 287
263 3300025924 Ga0207694_10056003 Ga0207694_100560032 287
264 3300025926 Ga0207659_10075811 Ga0207659_100758112 287
265 3300025937 Ga0207669_10029063 Ga0207669_100290631 287
266 3300025945 Ga0207679_10019416 Ga0207679_100194163 287
267 3300025949 Ga0207667_10016466 Ga0207667_100164666 287
268 3300025949 Ga0207667_10148394 Ga0207667_101483942 287
269 3300025949 Ga0207667_10214724 Ga0207667_102147242 287
270 3300025981 Ga0207640_10001371 Ga0207640_100013719 287
271 3300025981 Ga0207640_10129385 Ga0207640_101293852 287
272 3300026041 Ga0207639_10000742 Ga0207639_1000074222 287
273 3300026041 Ga0207639_10188128 Ga0207639_101881282 287
274 3300026067 Ga0207678_10066025 Ga0207678_100660252 287
275 3300026078 Ga0207702_10059827 Ga0207702_100598274 287
276 3300026078 Ga0207702_10188310 Ga0207702_101883102 287
277 3300026089 Ga0207648_10067618 Ga0207648_100676183 287
278 3300026116 Ga0207674_10009842 Ga0207674_1000984210 287
279 3300026116 Ga0207674_10119808 Ga0207674_101198083 287
280 3300026121 Ga0207683_10071382 Ga0207683_100713822 287
281 3300026142 Ga0207698_10037040 Ga0207698_100370401 287
282 3300026142 Ga0207698_10104687 Ga0207698_101046872 287
283 3300026142 Ga0207698_10133430 Ga0207698_101334302 287
284 3300028379 Ga0268266_10183564 Ga0268266_101835642 287
285 3300031241 Ga0265325_10003040 Ga0265325_100030406 287
286 3300031249 Ga0265339_10003193 Ga0265339_1000319315 287
287 3300031250 Ga0265331_10029199 Ga0265331_100291993 287
288 3300031344 Ga0265316_10019755 Ga0265316_100197554 287
289 3300031344 Ga0265316_10106930 Ga0265316_101069302 287
290 3300031595 Ga0265313_10000070 Ga0265313_1000007034 287
291 3300031711 Ga0265314_10049410 Ga0265314_100494102 287
292 3300031712 Ga0265342_10019942 Ga0265342_100199422 287
293 3300035691 Ga0373931_0056848 Ga0373931_0056848_921_1949 287
294 3300037312 Ga0395899_0135921 Ga0395899_0135921_162_1190 287
295 3300037418 Ga0395900_0130332 Ga0395900_0130332_390_1418 287
296 3300039438 Ga0436360_1148784 Ga0436360_1148784_26_991 287
297 3300044901 Ga0466960_0099565 Ga0466960_0099565_150_1178 287
298 3300047472 Ga0495686_0081092 Ga0495686_0081092_899_1927 287
299 3300049568 Ga0501031_0026839 Ga0501031_0026839_2682_3710 287
300 3300049569 Ga0501032_0034381 Ga0501032_0034381_1170_2198 287
301 3300049571 Ga0501034_0027234 Ga0501034_0027234_2057_3085 287
302 3300049571 Ga0501034_0035985 Ga0501034_0035985_2678_3706 287
303 3300049571 Ga0501034_0150473 Ga0501034_0150473_1079_2107 287
304 3300049582 Ga0501048_0000662 Ga0501048_0000662_6061_6987 287
305 3300049586 Ga0501070_0107854 Ga0501070_0107854_344_1372 287
306 3300049586 Ga0501070_0428406 Ga0501070_0428406_10_939 287
307 3300049823 Ga0501044_0355494 Ga0501044_0355494_229_1257 287
308 3300050493 nmdc:mga0k408_79495_c1 nmdc:mga0k408_79495_c1_204_1232 287
309 3300050494 nmdc:mga06z11_140066_c1 nmdc:mga06z11_140066_c1_92_1120 287
310 3300050496 nmdc:mga07m45_22760_c1 nmdc:mga07m45_22760_c1_1461_2489 287
311 3300050512 nmdc:mga0n895_6477_c1 nmdc:mga0n895_6477_c1_8855_9778 287
312 iso_pu_bacteria 2513237087 2513590631 287
313 iso_pu_bacteria 2513237092 2513624236 287
314 iso_pu_bacteria 2513237094 2513638724 287
315 iso_pu_bacteria 2513237095 2513649196 287
316 iso_pu_bacteria 2513237102 2513702124 287
317 iso_pu_bacteria 2513237161 2514010055 287
318 iso_pu_bacteria 2617270735 2617350306 287
319 iso_pu_bacteria 2617270741 2617374392 287
320 iso_pu_bacteria 2816332527 2818240583 287
321 iso_pu_bacteria 2824600985 2824604689 287
322 iso_pu_bacteria 2824609381 2824615392 287
323 iso_pu_bacteria 2824617872 2824618848 287
324 iso_pu_bacteria 2824626560 2824628954 287
325 iso_pu_bacteria 2824635225 2824639247 287
326 iso_pu_bacteria 2824644064 2824648833 287
327 iso_pu_bacteria 2824653114 2824658638 287
328 iso_pu_bacteria 2824671348 2824675095 287
329 iso_pu_bacteria 2824687955 2824692542 287
330 iso_pu_bacteria 2824704595 2824711305 287
331 iso_pu_bacteria 2824714736 2824717532 287
332 iso_pu_bacteria 2824723954 2824726776 287
333 iso_pu_bacteria 2824732956 2824737694 287
334 iso_pu_bacteria 2824746037 2824751197 287
335 iso_pu_bacteria 2824753945 2824759679 287
336 iso_pu_bacteria 2824763712 2824769940 287
337 iso_pu_bacteria 2828305725 2828306445 287
338 iso_pu_bacteria 2838122688 2838126036 287
339 iso_pu_bacteria 2841941048 2841942570 287
340 iso_pu_bacteria 2841949485 2841953080 287
341 iso_pu_bacteria 2841957949 2841963933 287
342 iso_pu_bacteria 2841966195 2841970895 287
343 iso_pu_bacteria 2841974524 2841977845 287
344 iso_pu_bacteria 2841983080 2841984591 287
345 iso_pu_bacteria 2847930680 2847931976 287
346 iso_pu_bacteria 2849076700 2849076952 287
347 iso_pu_bacteria 2857509624 2857514779 287
348 iso_pu_bacteria 2874612657 2874620382 287
349 iso_pu_bacteria 2876761206 2876769224 287
350 iso_pu_bacteria 2879083081 2879085658 287
351 iso_pu_bacteria 2881364244 2881364626 287
352 iso_pu_bacteria 2881665667 2881671358 287
353 iso_pu_bacteria 2885366525 2885374392 287
354 iso_pu_bacteria 2885409591 2885413477 287
355 iso_pu_bacteria 2888378607 2888387262 287
356 iso_pu_bacteria 2888388044 2888391439 287
357 iso_pu_bacteria 2888419890 2888426944 287
358 iso_pu_bacteria 2903727486 2903727996 287
359 iso_pu_bacteria 2904711408 2904713650 287
360 iso_pu_bacteria 2906602504 2906602520 287
361 iso_pu_bacteria 2906626472 2906635103 287
362 iso_pu_bacteria 2906643746 2906649701 287
363 iso_pu_bacteria 2908775508 2908776873 287
364 iso_pu_bacteria 2909042592 2909046936 287
365 iso_pu_bacteria 2922393267 2922398862 287
366 iso_pu_bacteria 2932794094 2932800696 287
367 iso_pu_bacteria 2932801729 2932808427 287
368 iso_pu_bacteria 2935608549 2935613165 287
369 iso_pu_bacteria 2935769743 2935774815 287
370 iso_pu_bacteria 2935777560 2935779999 287
371 iso_pu_bacteria 2935785616 2935792985 287
372 iso_pu_bacteria 2935793552 2935798563 287
373 iso_pu_bacteria 2935810662 2935818816 287
374 iso_pu_bacteria 2935819856 2935824983 287
375 iso_pu_bacteria 2935847175 2935852202 287
376 iso_pu_bacteria 2935883170 2935883534 287
377 iso_pu_bacteria 2935908558 2935910636 287
378 iso_pu_bacteria 2935916978 2935921816 287
379 iso_pu_bacteria 2935926038 2935930045 287
380 iso_pu_bacteria 2935934488 2935937713 287
381 iso_pu_bacteria 2935942939 2935949817 287
382 iso_pu_bacteria 2935951376 2935956913 287
383 iso_pu_bacteria 2935959822 2935965370 287
384 iso_pu_bacteria 2935967501 2935970830 287
385 iso_pu_bacteria 2936037263 2936045498 287
386 iso_pu_bacteria 3005483717 3005490835 287
387 iso_pu_bacteria 3005506211 3005506573 287
388 iso_pu_bacteria 3005594810 3005601788 287
389 iso_pu_bacteria 3005718088 3005724469 287
390 iso_pu_bacteria 643348564 643603436 287
391 iso_pu_bacteria 8016539877 8016543076 287
392 iso_pu_bacteria 8016548790 8016550216 287
393 iso_pu_bacteria 8016557553 8016558620 287
394 iso_pu_bacteria 8016566248 8016568483 287
395 iso_pu_bacteria 8016575299 8016581133 287
396 iso_pu_bacteria 8016583857 8016587576 287
397 iso_pu_bacteria 8016595262 8016596604 287
398 iso_pu_bacteria 8016613128 8016619269 287
399 iso_pu_bacteria 8019530166 8019538459 287
400 iso_pu_bacteria 8019687851 8019695396 287
401 iso_pu_bacteria 8045864390 8045869063 287
402 iso_pu_bacteria 8056967851 8056975298 287
403 3300003215 JGI25153J46596_10001434 JGI25153J46596_1000143414 288
404 3300003659 JGI25404J52841_10033949 JGI25404J52841_100339491 288
405 3300005545 Ga0070695_100003415 Ga0070695_1000034157 288
406 3300005983 Ga0081540_1000024 Ga0081540_100002492 288
407 3300006844 Ga0075428_100069849 Ga0075428_1000698494 288
408 3300006852 Ga0075433_10003359 Ga0075433_100033592 288
409 3300009094 Ga0111539_10245669 Ga0111539_102456692 288
410 3300025295 Ga0209564_1007175 Ga0209564_10071754 288
411 3300025297 Ga0209758_1003575 Ga0209758_10035752 288
412 3300025940 Ga0207691_10197128 Ga0207691_101971282 288
413 3300025972 Ga0207668_10316355 Ga0207668_103163551 288
414 3300027907 Ga0207428_10076596 Ga0207428_100765962 288
415 3300033180 Ga0307510_10069558 Ga0307510_100695584 288
416 3300035092 Ga0373952_0004512 Ga0373952_0004512_122_1057 288
417 3300035112 Ga0373932_0011863 Ga0373932_0011863_444_1379 288
418 3300035121 Ga0373960_0002357 Ga0373960_0002357_1161_2096 288
419 3300035207 Ga0373942_0021556 Ga0373942_0021556_188_1123 288
420 3300035242 Ga0373962_0000511 Ga0373962_0000511_6863_7798 288
421 3300035691 Ga0373931_0000317 Ga0373931_0000317_4461_5396 288
422 3300035691 Ga0373931_0004250 Ga0373931_0004250_4233_5168 288
423 3300049569 Ga0501032_0001280 Ga0501032_0001280_1557_2486 288
424 3300049572 Ga0501036_0033700 Ga0501036_0033700_1843_2772 288
425 3300049573 Ga0501037_0040541 Ga0501037_0040541_1117_2046 288
426 3300049579 Ga0501043_0005072 Ga0501043_0005072_3922_4851 288
427 3300049583 Ga0501067_0000308 Ga0501067_0000308_5035_5964 288
428 3300049584 Ga0501068_0001071 Ga0501068_0001071_11535_12464 288
429 3300049589 Ga0501073_0000010 Ga0501073_0000010_64687_65616 288
430 3300049589 Ga0501073_0076947 Ga0501073_0076947_1010_1930 288
431 3300049593 Ga0501077_0000020 Ga0501077_0000020_38079_39008 288
432 3300049823 Ga0501044_0008445 Ga0501044_0008445_1061_1990 288
433 3300050489 nmdc:mga03683_6846_c1 nmdc:mga03683_6846_c1_1378_2409 288
434 3300050490 nmdc:mga03n38_41493_c1 nmdc:mga03n38_41493_c1_178_1209 288
435 3300050494 nmdc:mga06z11_65237_c1 nmdc:mga06z11_65237_c1_608_1639 288
436 3300050511 nmdc:mga08y16_158892_c1 nmdc:mga08y16_158892_c1_974_1909 288
437 3300050512 nmdc:mga0n895_108082_c1 nmdc:mga0n895_108082_c1_567_1502 288
438 3300050515 nmdc:mga0a205_1693_c1 nmdc:mga0a205_1693_c1_3354_4289 288
439 iso_pu_bacteria 2507262055 2507504430 288
440 iso_pu_bacteria 2508501009 2508545858 288
441 iso_pu_bacteria 2508501042 2508694685 288
442 iso_pu_bacteria 2511231028 2511396414 288
443 iso_pu_bacteria 2513237139 2513874187 288
444 iso_pu_bacteria 2515154112 2515624396 288
445 iso_pu_bacteria 2517093001 2517103087 288
446 iso_pu_bacteria 2528768022 2528849429 288
447 iso_pu_bacteria 2791355196 2793059307 288
448 iso_pu_bacteria 2802429603 2805920905 288
449 iso_pu_bacteria 2824661429 2824665830 288
450 iso_pu_bacteria 2824696289 2824700895 288
451 iso_pu_bacteria 2824773399 2824780312 288
452 iso_pu_bacteria 2842038055 2842041685 288
453 iso_pu_bacteria 2842045827 2842049727 288
454 iso_pu_bacteria 2842698319 2842699745 288
455 iso_pu_bacteria 2847939898 2847943223 288
456 iso_pu_bacteria 2874590934 2874595623 288
457 iso_pu_bacteria 2874620515 2874621870 288
458 iso_pu_bacteria 2874628541 2874629646 288
459 iso_pu_bacteria 2874645413 2874651743 288
460 iso_pu_bacteria 2876771140 2876775818 288
461 iso_pu_bacteria 2876818435 2876821639 288
462 iso_pu_bacteria 2879074833 2879079909 288
463 iso_pu_bacteria 2879099564 2879104497 288
464 iso_pu_bacteria 2879127579 2879133994 288
465 iso_pu_bacteria 2879142872 2879148479 288
466 iso_pu_bacteria 2904666416 2904669537 288
467 iso_pu_bacteria 2922368715 2922370314 288
468 iso_pu_bacteria 2929615660 2929622630 288
469 iso_pu_bacteria 2929624759 2929632267 288
470 iso_pu_bacteria 2932784394 2932790028 288
471 iso_pu_bacteria 2932809354 2932815571 288
472 iso_pu_bacteria 2932818245 2932824853 288
473 iso_pu_bacteria 2932828146 2932829115 288
474 iso_pu_bacteria 2933577622 2933584739 288
475 iso_pu_bacteria 2935616580 2935617591 288
476 iso_pu_bacteria 2935638405 2935643636 288
477 iso_pu_bacteria 2935648319 2935654123 288
478 iso_pu_bacteria 2935656913 2935662775 288
479 iso_pu_bacteria 2935665750 2935671054 288
480 iso_pu_bacteria 2935675223 2935681697 288
481 iso_pu_bacteria 2935684952 2935692674 288
482 iso_pu_bacteria 2935694250 2935702661 288
483 iso_pu_bacteria 2935703347 2935711948 288
484 iso_pu_bacteria 2935713505 2935721292 288
485 iso_pu_bacteria 2935722832 2935730714 288
486 iso_pu_bacteria 2935732158 2935739982 288
487 iso_pu_bacteria 2935741537 2935749020 288
488 iso_pu_bacteria 2935750917 2935758890 288
489 iso_pu_bacteria 2935760218 2935767155 288
490 iso_pu_bacteria 2935801545 2935806919 288
491 iso_pu_bacteria 2935827899 2935834321 288
492 iso_pu_bacteria 2935837841 2935843954 288
493 iso_pu_bacteria 2935855204 2935856910 288
494 iso_pu_bacteria 2935864058 2935868437 288
495 iso_pu_bacteria 2935873716 2935879747 288
496 iso_pu_bacteria 2935975950 2935980145 288
497 iso_pu_bacteria 2935984226 2935984314 288
498 iso_pu_bacteria 2935992306 2935997254 288
499 iso_pu_bacteria 2936002035 2936010000 288
500 iso_pu_bacteria 2936011229 2936017028 288
501 iso_pu_bacteria 2936019824 2936025564 288
502 iso_pu_bacteria 2936028420 2936034406 288
503 iso_pu_bacteria 2936046547 2936052560 288
504 iso_pu_bacteria 2936055302 2936055394 288
505 iso_pu_bacteria 2940556831 2940564520 288
506 iso_pu_bacteria 2941538514 2941545202 288
507 iso_pu_bacteria 8001845381 8001846938 288
508 iso_pu_bacteria 8006926726 8006927552 288
509 iso_pu_bacteria 8016511872 8016519103 288
510 iso_pu_bacteria 8017057580 8017057598 288
511 iso_pu_bacteria 8019576017 8019578221 288
512 iso_pu_bacteria 8019586578 8019596255 288
513 iso_pu_bacteria 8019608314 8019613099 288
514 iso_pu_bacteria 8019629233 8019638250 288
515 iso_pu_bacteria 8019638758 8019641389 288
516 iso_pu_bacteria 8019668869 8019675676 288
517 iso_pu_bacteria 8055742211 8055750513 288
518 3300005436 Ga0070713_100289226 Ga0070713_1002892262 289
519 3300005544 Ga0070686_100118452 Ga0070686_1001184521 289
520 3300005617 Ga0068859_100257204 Ga0068859_1002572042 289
521 3300005842 Ga0068858_100090754 Ga0068858_1000907543 289
522 3300006931 Ga0097620_100257203 Ga0097620_1002572032 289
523 3300009148 Ga0105243_10271706 Ga0105243_102717062 289
524 3300014745 Ga0157377_10085211 Ga0157377_100852112 289
525 3300024225 Ga0224572_1000989 Ga0224572_10009894 289
526 3300025900 Ga0207710_10091150 Ga0207710_100911501 289
527 3300028577 Ga0265318_10000235 Ga0265318_100002354 289
528 3300028800 Ga0265338_10071491 Ga0265338_100714913 289
529 3300031249 Ga0265339_10001183 Ga0265339_100011836 289
530 3300031595 Ga0265313_10001097 Ga0265313_100010978 289
531 3300037471 Ga0395905_0038350 Ga0395905_0038350_967_1902 289
532 3300049569 Ga0501032_0002117 Ga0501032_0002117_834_1796 289
533 3300049571 Ga0501034_0000014 Ga0501034_0000014_65585_66547 289
534 3300049571 Ga0501034_0045903 Ga0501034_0045903_76_1035 289
535 3300049572 Ga0501036_0005290 Ga0501036_0005290_1732_2694 289
536 3300049573 Ga0501037_0001132 Ga0501037_0001132_18133_19095 289
537 3300049574 Ga0501038_0025537 Ga0501038_0025537_3500_4462 289
538 3300049575 Ga0501039_0000087 Ga0501039_0000087_15955_16917 289
539 3300049579 Ga0501043_0250460 Ga0501043_0250460_234_1196 289
540 3300049580 Ga0501046_0031958 Ga0501046_0031958_583_1545 289
541 3300049581 Ga0501047_0000684 Ga0501047_0000684_8010_8972 289
542 3300049583 Ga0501067_0000499 Ga0501067_0000499_3972_4934 289
543 3300049586 Ga0501070_0019277 Ga0501070_0019277_1054_2016 289
544 3300049589 Ga0501073_0060766 Ga0501073_0060766_1066_2028 289
545 3300049742 Ga0501080_0000010 Ga0501080_0000010_76745_77707 289
546 3300049822 Ga0501035_0000034 Ga0501035_0000034_154350_155312 289
547 3300049823 Ga0501044_0000039 Ga0501044_0000039_151287_152249 289
548 3300053096 Ga0500641_0072540 Ga0500641_0072540_74_1009 289
549 3300053119 Ga0500595_012010 Ga0500595_012010_1737_2684 289
550 3300053131 Ga0500652_065002 Ga0500652_065002_303_1241 289
551 3300053139 Ga0500568_0034233 Ga0500568_0034233_492_1427 289
552 3300060353 Ga0501082_0180033 Ga0501082_0180033_805_1767 289
553 iso_pu_bacteria 2738541281 2738744894 289
554 iso_pu_bacteria 2738543032 2739354124 289
555 3300005345 Ga0070692_10181832 Ga0070692_101818322 290
556 3300005366 Ga0070659_100230528 Ga0070659_1002305281 290
557 3300005441 Ga0070700_100043939 Ga0070700_1000439392 290
558 3300005539 Ga0068853_100382481 Ga0068853_1003824811 290
559 3300005543 Ga0070672_100305665 Ga0070672_1003056652 290
560 3300005547 Ga0070693_100181357 Ga0070693_1001813571 290
561 3300005615 Ga0070702_100138826 Ga0070702_1001388262 290
562 3300005937 Ga0081455_10013086 Ga0081455_100130863 290
563 3300006871 Ga0075434_100007129 Ga0075434_1000071292 290
564 3300006871 Ga0075434_100011459 Ga0075434_1000114595 290
565 3300006914 Ga0075436_100377212 Ga0075436_1003772121 290
566 3300009098 Ga0105245_10084638 Ga0105245_100846383 290
567 3300009101 Ga0105247_10072812 Ga0105247_100728122 290
568 3300009101 Ga0105247_10174424 Ga0105247_101744242 290
569 3300009147 Ga0114129_10263995 Ga0114129_102639954 290
570 3300009148 Ga0105243_10332332 Ga0105243_103323322 290
571 3300009177 Ga0105248_10396834 Ga0105248_103968342 290
572 3300010375 Ga0105239_10092739 Ga0105239_100927393 290
573 3300013308 Ga0157375_10256440 Ga0157375_102564402 290
574 3300014745 Ga0157377_10116249 Ga0157377_101162492 290
575 3300025230 Ga0209563_103333 Ga0209563_1033332 290
576 3300025253 Ga0209677_106867 Ga0209677_1068672 290
577 3300025297 Ga0209758_1044600 Ga0209758_10446002 290
578 3300025900 Ga0207710_10028594 Ga0207710_100285943 290
579 3300025918 Ga0207662_10044839 Ga0207662_100448392 290
580 3300025972 Ga0207668_10208381 Ga0207668_102083812 290
581 3300026035 Ga0207703_10084431 Ga0207703_100844312 290
582 3300026118 Ga0207675_100033029 Ga0207675_1000330292 290
583 3300027717 Ga0209998_10004564 Ga0209998_100045642 290
584 3300028381 Ga0268264_10040911 Ga0268264_100409112 290
585 3300035114 Ga0373939_0023631 Ga0373939_0023631_248_1174 290
586 3300035691 Ga0373931_0111734 Ga0373931_0111734_127_1053 290
587 3300046491 Ga0495584_0033583 Ga0495584_0033583_1193_2119 290
588 3300046528 Ga0495642_0126784 Ga0495642_0126784_160_1086 290
589 3300046557 Ga0495622_0012727 Ga0495622_0012727_2293_3219 290
590 3300046694 Ga0495649_0102515 Ga0495649_0102515_442_1368 290
591 3300046794 Ga0495589_0139462 Ga0495589_0139462_11_937 290
592 3300047320 Ga0495672_0008715 Ga0495672_0008715_4074_5000 290
593 3300047323 Ga0495683_0156123 Ga0495683_0156123_68_994 290
594 3300047447 Ga0495685_011583 Ga0495685_011583_1007_1966 290
595 3300048905 Ga0496102_0291725 Ga0496102_0291725_505_1431 290
596 3300048909 Ga0496106_0016353 Ga0496106_0016353_4173_5099 290
597 3300048910 Ga0496107_0130036 Ga0496107_0130036_134_1060 290
598 3300048912 Ga0496109_0107931 Ga0496109_0107931_383_1309 290
599 3300048915 Ga0496112_0048414 Ga0496112_0048414_643_1578 290
600 3300048924 Ga0496121_0129656 Ga0496121_0129656_161_1099 290
601 3300048927 Ga0496124_0264997 Ga0496124_0264997_293_1228 290
602 3300049572 Ga0501036_0049535 Ga0501036_0049535_1991_2917 290
603 3300049573 Ga0501037_0213251 Ga0501037_0213251_413_1339 290
604 3300049576 Ga0501040_0128850 Ga0501040_0128850_833_1759 290
605 3300049578 Ga0501042_0068376 Ga0501042_0068376_1231_2157 290
606 3300049579 Ga0501043_0318966 Ga0501043_0318966_246_1172 290
607 3300049580 Ga0501046_0042249 Ga0501046_0042249_1980_2906 290
608 3300049580 Ga0501046_0167845 Ga0501046_0167845_438_1364 290
609 3300049582 Ga0501048_0162808 Ga0501048_0162808_640_1566 290
610 3300049587 Ga0501071_0195109 Ga0501071_0195109_439_1365 290
611 3300049588 Ga0501072_0253755 Ga0501072_0253755_19_945 290
612 3300049588 Ga0501072_0329890 Ga0501072_0329890_83_1030 290
613 3300049590 Ga0501074_0109807 Ga0501074_0109807_1020_1946 290
614 3300049590 Ga0501074_0151443 Ga0501074_0151443_698_1624 290
615 3300049591 Ga0501075_0056591 Ga0501075_0056591_1309_2235 290
616 3300049591 Ga0501075_0198885 Ga0501075_0198885_31_957 290
617 3300049593 Ga0501077_0015004 Ga0501077_0015004_1624_2550 290
618 3300049742 Ga0501080_0229534 Ga0501080_0229534_349_1311 290
619 3300049743 Ga0501081_0080906 Ga0501081_0080906_788_1714 290
620 3300049743 Ga0501081_0162116 Ga0501081_0162116_31_957 290
621 3300049744 Ga0501083_0086804 Ga0501083_0086804_694_1620 290
622 3300049744 Ga0501083_0227693 Ga0501083_0227693_174_1100 290
623 3300049824 Ga0501045_0089774 Ga0501045_0089774_484_1431 290
624 3300050490 nmdc:mga03n38_65694_c1 nmdc:mga03n38_65694_c1_610_1545 290
625 3300050507 nmdc:mga05p37_260609_c1 nmdc:mga05p37_260609_c1_70_996 290
626 3300050509 nmdc:mga0qj67_129900_c1 nmdc:mga0qj67_129900_c1_868_1794 290
627 3300050510 nmdc:mga06r32_130964_c1 nmdc:mga06r32_130964_c1_910_1836 290
628 3300050512 nmdc:mga0n895_66835_c1 nmdc:mga0n895_66835_c1_1846_2772 290
629 3300050514 nmdc:mga08x19_336539_c1 nmdc:mga08x19_336539_c1_75_1010 290
630 3300050516 nmdc:mga0sz30_72508_c1 nmdc:mga0sz30_72508_c1_199_1134 290
631 3300053077 Ga0495601_0006336 Ga0495601_0006336_2684_3610 290
632 3300053080 Ga0500635_0008518 Ga0500635_0008518_1580_2506 290
633 3300053115 Ga0500591_050672 Ga0500591_050672_175_1101 290
634 3300053178 Ga0500637_0005785 Ga0500637_0005785_145_1071 290
635 3300054114 Ga0501084_0278533 Ga0501084_0278533_310_1236 290
636 3300054114 Ga0501084_0328188 Ga0501084_0328188_66_1013 290
637 3300060353 Ga0501082_0209574 Ga0501082_0209574_231_1157 290
638 3300005262 Ga0065165_1000370 Ga0065165_100037057 291
639 3300005262 Ga0065165_1001957 Ga0065165_10019572 291
640 3300005262 Ga0065165_1005374 Ga0065165_10053748 291
641 3300005334 Ga0068869_100037313 Ga0068869_1000373132 291
642 3300005467 Ga0070706_100190045 Ga0070706_1001900452 291
643 3300005471 Ga0070698_100190944 Ga0070698_1001909442 291
644 3300005536 Ga0070697_100106840 Ga0070697_1001068402 291
645 3300005617 Ga0068859_100032209 Ga0068859_1000322095 291
646 3300006871 Ga0075434_100014087 Ga0075434_1000140878 291
647 3300006931 Ga0097620_100032204 Ga0097620_1000322045 291
648 3300009093 Ga0105240_10095611 Ga0105240_100956113 291
649 3300009545 Ga0105237_10013295 Ga0105237_100132958 291
650 3300009551 Ga0105238_10248726 Ga0105238_102487262 291
651 3300010375 Ga0105239_10017508 Ga0105239_100175087 291
652 3300010375 Ga0105239_10102866 Ga0105239_101028663 291
653 3300013307 Ga0157372_10448022 Ga0157372_104480222 291
654 3300025261 Ga0209233_1005180 Ga0209233_10051802 291
655 3300025295 Ga0209564_1022974 Ga0209564_10229742 291
656 3300025297 Ga0209758_1000030 Ga0209758_1000030465 291
657 3300025297 Ga0209758_1002104 Ga0209758_100210420 291
658 3300025302 Ga0207426_1000913 Ga0207426_100091311 291
659 3300025304 Ga0209257_1000947 Ga0209257_100094718 291
660 3300025908 Ga0207643_10265495 Ga0207643_102654951 291
661 3300025910 Ga0207684_10118574 Ga0207684_101185742 291
662 3300025911 Ga0207654_10015970 Ga0207654_100159702 291
663 3300025913 Ga0207695_10005181 Ga0207695_1000518111 291
664 3300025914 Ga0207671_10034193 Ga0207671_100341933 291
665 3300025922 Ga0207646_10039151 Ga0207646_100391513 291
666 3300025923 Ga0207681_10188884 Ga0207681_101888842 291
667 3300026088 Ga0207641_10080653 Ga0207641_100806532 291
668 3300031731 Ga0307405_10437692 Ga0307405_104376921 291
669 3300031903 Ga0307407_10100881 Ga0307407_101008812 291
670 3300037471 Ga0395905_0001838 Ga0395905_0001838_18820_19758 291
671 3300037471 Ga0395905_0006347 Ga0395905_0006347_78_1028 291
672 3300038742 Ga0400486_20503 Ga0400486_20503_305_1234 291
673 3300044684 Ga0466966_0000514 Ga0466966_0000514_5911_6849 291
674 3300044693 Ga0466961_0000065 Ga0466961_0000065_3379_4317 291
675 3300045049 Ga0466959_0034929 Ga0466959_0034929_931_1869 291
676 3300046459 Ga0495629_0033520 Ga0495629_0033520_2659_3600 291
677 3300046460 Ga0495638_0004694 Ga0495638_0004694_8011_8946 291
678 3300046473 Ga0495582_0137397 Ga0495582_0137397_202_1143 291
679 3300046474 Ga0495605_0108500 Ga0495605_0108500_178_1113 291
680 3300046507 Ga0495606_0089469 Ga0495606_0089469_147_1088 291
681 3300046524 Ga0495648_0009770 Ga0495648_0009770_4974_5915 291
682 3300046533 Ga0495640_0046096 Ga0495640_0046096_354_1295 291
683 3300046557 Ga0495622_0018741 Ga0495622_0018741_294_1235 291
684 3300046642 Ga0495634_0083755 Ga0495634_0083755_106_1047 291
685 3300046809 Ga0495600_0035934 Ga0495600_0035934_2097_3038 291
686 3300047317 Ga0495604_0005237 Ga0495604_0005237_7065_8006 291
687 3300047321 Ga0495676_0054208 Ga0495676_0054208_1224_2165 291
688 3300048903 Ga0496100_0031553 Ga0496100_0031553_450_1409 291
689 3300048904 Ga0496101_0351453 Ga0496101_0351453_91_1029 291
690 3300048907 Ga0496104_0002953 Ga0496104_0002953_7174_8115 291
691 3300048907 Ga0496104_0017706 Ga0496104_0017706_3925_4884 291
692 3300048907 Ga0496104_0061414 Ga0496104_0061414_815_1753 291
693 3300048908 Ga0496105_0006535 Ga0496105_0006535_7456_8397 291
694 3300048908 Ga0496105_0046907 Ga0496105_0046907_1125_2084 291
695 3300048916 Ga0496113_0048761 Ga0496113_0048761_954_1895 291
696 3300048922 Ga0496119_0003665 Ga0496119_0003665_10711_11652 291
697 3300048923 Ga0496120_0009533 Ga0496120_0009533_553_1494 291
698 3300048924 Ga0496121_0009006 Ga0496121_0009006_9475_10413 291
699 3300048925 Ga0496122_0165963 Ga0496122_0165963_205_1146 291
700 3300048929 Ga0496126_0172047 Ga0496126_0172047_167_1108 291
701 3300049571 Ga0501034_0082433 Ga0501034_0082433_1297_2238 291
702 3300049571 Ga0501034_0274711 Ga0501034_0274711_111_1049 291
703 3300049576 Ga0501040_0243381 Ga0501040_0243381_277_1206 291
704 3300049581 Ga0501047_0448438 Ga0501047_0448438_98_1036 291
705 3300050510 nmdc:mga06r32_388932_c1 nmdc:mga06r32_388932_c1_136_1068 291
706 3300050512 nmdc:mga0n895_9018_c1 nmdc:mga0n895_9018_c1_3683_4651 291
707 3300053094 Ga0500566_0000351 Ga0500566_0000351_14883_15827 291
708 3300053094 Ga0500566_0003690 Ga0500566_0003690_1843_2784 291
709 3300053094 Ga0500566_0101534 Ga0500566_0101534_33_971 291
710 3300053095 Ga0500640_002238 Ga0500640_002238_3535_4476 291
711 3300053104 Ga0500556_0002319 Ga0500556_0002319_507_1442 291
712 3300053111 Ga0500572_000903 Ga0500572_000903_1848_2789 291
713 3300053117 Ga0500593_000015 Ga0500593_000015_14640_15593 291
714 3300053121 Ga0500607_038072 Ga0500607_038072_608_1546 291
715 3300053122 Ga0500608_018687 Ga0500608_018687_664_1605 291
716 3300053139 Ga0500568_0000004 Ga0500568_0000004_17909_18892 291
717 3300053142 Ga0500577_0094289 Ga0500577_0094289_163_1098 291
718 3300053153 Ga0500616_0023683 Ga0500616_0023683_1886_2821 291
719 3300053159 Ga0500630_000445 Ga0500630_000445_10222_11163 291
720 3300053163 Ga0500639_000103 Ga0500639_000103_15520_16461 291
721 3300053177 Ga0500636_0021148 Ga0500636_0021148_2191_3129 291
722 3300053736 Ga0500599_005464 Ga0500599_005464_215_1150 291
723 3300060353 Ga0501082_0266752 Ga0501082_0266752_269_1216 291
724 iso_pu_bacteria 2508501050 2508734279 291
725 iso_pu_bacteria 2508501114 2509079177 291
726 iso_pu_bacteria 2773857925 2774871670 291
727 iso_pu_bacteria 2775506901 2776257822 291
728 iso_pu_bacteria 2882456835 2882457303 291
729 3300005548 Ga0070665_100104771 Ga0070665_1001047712 292
730 3300009545 Ga0105237_10280046 Ga0105237_102800462 292
731 3300025914 Ga0207671_10060893 Ga0207671_100608932 292
732 3300028379 Ga0268266_10275551 Ga0268266_102755512 292
733 3300028573 Ga0265334_10000859 Ga0265334_100008593 292
734 3300028800 Ga0265338_10063502 Ga0265338_100635022 292
735 3300031711 Ga0265314_10022597 Ga0265314_100225975 292
736 3300046455 Ga0495603_0014974 Ga0495603_0014974_187_1122 292
737 3300053087 Ga0500643_018319 Ga0500643_018319_1262_2194 292
738 iso_pu_bacteria 2835312727 2835315581 292
739 3300049592 Ga0501076_0184287 Ga0501076_0184287_210_1178 293
740 3300049593 Ga0501077_0008063 Ga0501077_0008063_5455_6423 293
741 3300049743 Ga0501081_0001600 Ga0501081_0001600_11088_12056 293
742 3300054114 Ga0501084_0004495 Ga0501084_0004495_6503_7471 293
743 3300060353 Ga0501082_0019819 Ga0501082_0019819_2609_3577 293
744 3300061734 Ga0530510_0027092 Ga0530510_0027092_2296_3264 293
745 iso_pu_bacteria 2821443989 2821450797 293
746 3300053096 Ga0500641_0000510 Ga0500641_0000510_10371_11315 295
747 3300003320 rootH2_10142552 rootH2_101425523 296
748 3300005539 Ga0068853_100193669 Ga0068853_1001936692 297
749 3300021384 Ga0213876_10117339 Ga0213876_101173391 297
750 3300037418 Ga0395900_0088124 Ga0395900_0088124_1583_2545 297
751 3300037466 Ga0395898_0095492 Ga0395898_0095492_1445_2407 297
752 3300049569 Ga0501032_0190931 Ga0501032_0190931_35_997 297
753 3300049571 Ga0501034_0048444 Ga0501034_0048444_420_1382 297
754 3300049574 Ga0501038_0343538 Ga0501038_0343538_186_1148 297
755 3300049580 Ga0501046_0013316 Ga0501046_0013316_2021_2983 297
756 3300049581 Ga0501047_0020745 Ga0501047_0020745_2725_3687 297
757 3300049581 Ga0501047_0090564 Ga0501047_0090564_266_1228 297
758 3300049583 Ga0501067_0024598 Ga0501067_0024598_2155_3117 297
759 3300049823 Ga0501044_0005041 Ga0501044_0005041_3281_4243 297
760 3300049823 Ga0501044_0256049 Ga0501044_0256049_65_1027 297
761 3300053153 Ga0500616_0005500 Ga0500616_0005500_1147_2097 297
762 3300003187 JGI25151J46595_10000364 JGI25151J46595_1000036439 298
763 3300005339 Ga0070660_100108955 Ga0070660_1001089552 298
764 3300005439 Ga0070711_100305302 Ga0070711_1003053021 298
765 3300005983 Ga0081540_1008220 Ga0081540_10082203 298
766 3300009545 Ga0105237_10088428 Ga0105237_100884282 298
767 3300021384 Ga0213876_10009961 Ga0213876_100099614 298
768 3300025284 Ga0209130_1000662 Ga0209130_100066210 298
769 3300025294 Ga0209025_1000936 Ga0209025_100093638 298
770 3300025297 Ga0209758_1007165 Ga0209758_10071655 298
771 3300025302 Ga0207426_1000066 Ga0207426_100006612 298
772 3300025919 Ga0207657_10084537 Ga0207657_100845372 298
773 3300031247 Ga0265340_10024277 Ga0265340_100242772 298
774 3300031344 Ga0265316_10084889 Ga0265316_100848892 298
775 3300039437 Ga0436365_1001561 Ga0436365_1001561_1070_2032 298
776 3300039438 Ga0436360_0818014 Ga0436360_0818014_3512_4483 298
777 3300041997 Ga0439431_0010018 Ga0439431_0010018_691_1641 298
778 3300048903 Ga0496100_0138828 Ga0496100_0138828_206_1168 298
779 3300048905 Ga0496102_0250076 Ga0496102_0250076_267_1232 298
780 3300048909 Ga0496106_0236064 Ga0496106_0236064_103_1065 298
781 3300048913 Ga0496110_0064428 Ga0496110_0064428_1718_2680 298
782 3300048918 Ga0496115_0013248 Ga0496115_0013248_4012_4974 298
783 iso_pu_bacteria 2844533157 2844533975 298

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02153

PDH_N

Prephenate dehydrogenase, nucleotide-binding domain

22

177

0.98

PF20463

PDH_C

Prephenate dehydrogenase, dimerization domain

179

281

0.93

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

9

138

0.83

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

9

102

0.82

PF07991

IlvN

Acetohydroxy acid isomeroreductase, NADPH-binding domain

7

107

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wji-assembly1.cif.gz_A-2 crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with nadp and tyrosine 0.9492 10 283
3ggp-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase from a. aeolicus in complex with hydroxyphenyl propionate and nad+ 0.9155 14 283
5uyy-assembly2.cif.gz_D crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine 0.9133 14 284
3b1f-assembly1.cif.gz_A-2 crystal structure of prephenate dehydrogenase from streptococcus mutans 0.9098 14 285
2g5c-assembly1.cif.gz_A crystal structure of prephenate dehydrogenase from aquifex aeolicus 0.9088 16 283
ID Description Score Start End Superfamily
2f1kB02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9326 179 283 1.10.3660.10
2f1kC02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.9176 179 283 1.10.3660.10
af_Q2FYS1_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9155 14 180 3.40.50.720
2g5cC02 Mainly Alpha;Orthogonal Bundle;6-phosphogluconate dehydrogenase C-terminal fold;6-phosphogluconate dehydrogenase C-terminal like domain 0.8952 179 285 1.10.3660.10
af_Q9Y7N4_8_341_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.894 14 47 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A257QIA3-F1-model_v4 Cyclohexadienyl dehydrogenase 0.9925 9 101 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A840ARH8-F1-model_v4 Cyclohexadieny/prephenate dehydrogenase (EC 1.3.1.12, EC 1.3.1.43) 0.974 10 283 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A353IQS3-F1-model_v4 Prephenate/arogenate dehydrogenase family protein 0.9725 9 282 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A176RXM8-F1-model_v4 Prephenate dehydrogenase (EC 1.3.1.12) 0.972 122 272 GO:0004665
GO:0006571
GO:0008977
GO:0070403
AF-A0A6L7S3G0-F1-model_v4 Prephenate dehydrogenase/arogenate dehydrogenase family protein 0.9719 11 207 GO:0004665
GO:0006571
GO:0008977
GO:0070403

Feature Viewer

pLDDT pTM Quality
89.93 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map