F480652

General Info

Members Datasets Scaffolds Average Seq Length
783 447 680 233

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10032257|Ga0081538_100322573
Length 268
Sequence MLTLYSYPELFGVADNNGYGLKVFAFLRLAGVAFRHEHIFDAASAPRGQLPYIVDDGETIGDSDTIIAHLIAKYRLTIDAKLTGAERDTDHLITRMLDDLYWVMSYSRWKDERFWPLFRDALMRTHPSLTPEGLDKAREYNAQRYYFQGIGRYAPDAAYRRGVKDLQVLADLVPASDYLHGETPTSIDAGIYGFIANIHFYDIDTPLKQFVSSHANLVRHCNAIHAAVTAPPQFLDRGYPRGVFLYIAACALVAIATVAFGMSGRRTA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
12 2791355199
13 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
14 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
15 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
16 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
17 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
18 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
19 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
20 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
21 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
22 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
23 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
24 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
25 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
26 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
27 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
28 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
29 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
30 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
31 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
32 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
33 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
34 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
35 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
36 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
37 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
38 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
39 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
40 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
41 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
42 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
43 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
44 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
45 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
46 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
47 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
48 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
49 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
50 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
51 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
52 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
53 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
54 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
55 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
56 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
57 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
58 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
59 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
60 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
61 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
62 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
63 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
64 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
65 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
66 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
67 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
68 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
69 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
70 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
71 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
72 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
73 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
74 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
75 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
76 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
77 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
78 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
79 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
80 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
81 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
82 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
83 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
84 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
86 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
89 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
90 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
91 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
92 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
93 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
94 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
95 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
96 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
97 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
98 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
99 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
100 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
101 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
102 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
103 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
104 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
105 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
106 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
107 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
108 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
109 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
110 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
111 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
112 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
113 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
114 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
115 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
116 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
119 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
120 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
121 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
122 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
123 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
124 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
125 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
126 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
127 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
128 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
129 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
130 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
131 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
132 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
133 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
134 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
135 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
136 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
137 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
138 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
139 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
140 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
141 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
142 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
143 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
144 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
145 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
146 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
147 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
148 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
149 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
150 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
151 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
152 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
153 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
154 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
155 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
156 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
157 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
158 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
159 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
160 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
161 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
162 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
163 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
167 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
168 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
189 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
190 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
191 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
192 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
193 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
194 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
195 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
198 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
245 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
246 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
247 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
250 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
251 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
252 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
253 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
254 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
255 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
256 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
257 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
258 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
259 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
260 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
261 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
262 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
263 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
264 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
270 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
271 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
274 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
275 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
276 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
277 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
278 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
279 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
281 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
282 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
283 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
289 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
290 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
292 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
293 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
294 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
295 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
296 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
297 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
298 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
299 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
300 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
301 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
302 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
303 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
306 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
307 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
308 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
309 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
310 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
311 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
312 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
313 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
318 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
319 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
322 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
323 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
324 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
325 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
326 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
330 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
331 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
332 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
333 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
334 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
335 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
336 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
337 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
338 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
345 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
352 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
356 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
357 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
363 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
366 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
367 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
385 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
386 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
395 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
416 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
417 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
418 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
419 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
420 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
421 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
422 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
423 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
424 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
425 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
426 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
427 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
428 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
429 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
430 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
431 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
432 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
433 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
434 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
435 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
436 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
437 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
438 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
439 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
440 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
441 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
442 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
443 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
444 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
445 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
446 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
447 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.83
Metatranscriptomes 0.13
Isolates 13.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 11.37
Rhizoplane 8.3
Rhizosphere 67.69
Stem 0
Stem Tuber 0
Unclassified 5.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10028247 3300003320 Bacteria 1450
2 JGI25404J52841_10027507 3300003659 Bacteria 1223
3 Ga0065707_10305448 3300005295 Bacteria 995
4 Ga0070658_10200690 3300005327 Bacteria 1683
5 Ga0070683_100146343 3300005329 Bacteria 2239
6 Ga0070683_100656872 3300005329 Bacteria 1004
7 Ga0070670_100002724 3300005331 Bacteria 14600
8 Ga0070670_100275170 3300005331 Bacteria 1469
9 Ga0068869_100040507 3300005334 Bacteria 3331
10 Ga0070680_100451117 3300005336 Bacteria 1098
11 Ga0070682_100012744 3300005337 Bacteria 4826
12 Ga0070682_100266355 3300005337 Bacteria 1243
13 Ga0070682_100408638 3300005337 Bacteria 1029
14 Ga0068868_100143996 3300005338 Bacteria 1959
15 Ga0070660_100130480 3300005339 Bacteria 2011
16 Ga0070689_100058900 3300005340 Bacteria 2984
17 Ga0070691_10080048 3300005341 Bacteria 1598
18 Ga0070691_10091580 3300005341 Bacteria 1500
19 Ga0070668_100045408 3300005347 Bacteria 3370
20 Ga0070668_100102316 3300005347 Bacteria 2271
21 Ga0070668_100115575 3300005347 Bacteria 2139
22 Ga0070671_100001622 3300005355 Bacteria 16950
23 Ga0070671_100264152 3300005355 Bacteria 1463
24 Ga0070673_100044017 3300005364 Bacteria 3454
25 Ga0070667_100392065 3300005367 Bacteria 1263
26 Ga0070667_100645944 3300005367 Bacteria 977
27 Ga0070709_10073029 3300005434 Bacteria 2220
28 Ga0070709_10164477 3300005434 Bacteria 1545
29 Ga0070714_100063519 3300005435 Bacteria 3176
30 Ga0070713_100039420 3300005436 Bacteria 3834
31 Ga0070713_100064482 3300005436 Bacteria 3075
32 Ga0070713_100093832 3300005436 Bacteria 2586
33 Ga0070713_100934834 3300005436 Bacteria 835
34 Ga0070710_10017367 3300005437 Bacteria 3680
35 Ga0070710_10035714 3300005437 Bacteria 2712
36 Ga0070710_10039921 3300005437 Bacteria 2584
37 Ga0070710_10380793 3300005437 Bacteria 941
38 Ga0070701_10239926 3300005438 Bacteria 1090
39 Ga0070711_100010047 3300005439 Bacteria 5844
40 Ga0070711_100029291 3300005439 Bacteria 3632
41 Ga0070711_100404802 3300005439 Bacteria 1108
42 Ga0070708_100335683 3300005445 Bacteria 1424
43 Ga0070663_100017934 3300005455 Bacteria 4629
44 Ga0070663_100063699 3300005455 Bacteria 2663
45 Ga0070663_100087030 3300005455 Bacteria 2308
46 Ga0070678_100056739 3300005456 Bacteria 2866
47 Ga0070678_100237225 3300005456 Bacteria 1523
48 Ga0070662_100195506 3300005457 Bacteria 1602
49 Ga0070681_10008226 3300005458 Bacteria 10206
50 Ga0070681_10056108 3300005458 Bacteria 3921
51 Ga0070681_10157638 3300005458 Bacteria 2194
52 Ga0070681_10162326 3300005458 Bacteria 2159
53 Ga0070706_100035478 3300005467 Bacteria 4606
54 Ga0070698_100105128 3300005471 Bacteria 2793
55 Ga0070699_100004291 3300005518 Bacteria 12600
56 Ga0070679_100023223 3300005530 Bacteria 6069
57 Ga0070679_100039928 3300005530 Bacteria 4666
58 Ga0070679_100213053 3300005530 Bacteria 1895
59 Ga0070684_100758929 3300005535 Bacteria 906
60 Ga0070697_100040568 3300005536 Bacteria 3767
61 Ga0068853_100179252 3300005539 Bacteria 1921
62 Ga0070672_100306571 3300005543 Bacteria 1347
63 Ga0070686_100099082 3300005544 Bacteria 1966
64 Ga0070693_100130027 3300005547 Bacteria 1573
65 Ga0070693_100170425 3300005547 Bacteria 1394
66 Ga0070693_100178127 3300005547 Bacteria 1367
67 Ga0070665_100005813 3300005548 Bacteria 12652
68 Ga0070665_100152404 3300005548 Bacteria 2314
69 Ga0068855_100132560 3300005563 Bacteria 2845
70 Ga0068855_101256767 3300005563 Bacteria 768
71 Ga0070664_100743647 3300005564 Bacteria 915
72 Ga0068857_100031867 3300005577 Bacteria 4658
73 Ga0068854_100185586 3300005578 Bacteria 1627
74 Ga0068856_100607371 3300005614 Bacteria 1115
75 Ga0068856_100848407 3300005614 Bacteria 933
76 Ga0068852_100180838 3300005616 Bacteria 1983
77 Ga0068852_100621572 3300005616 Bacteria 1086
78 Ga0068859_100124845 3300005617 Bacteria 2642
79 Ga0068864_100526009 3300005618 Bacteria 1141
80 Ga0068866_10066524 3300005718 Bacteria 1889
81 Ga0068861_100223271 3300005719 Bacteria 1593
82 Ga0068863_100321751 3300005841 Bacteria 1502
83 Ga0068858_100224480 3300005842 Bacteria 1780
84 Ga0068860_100193494 3300005843 Bacteria 1969
85 Ga0068862_100131061 3300005844 Bacteria 2217
86 Ga0081455_10000227 3300005937 Bacteria 72665
87 Ga0081455_10002386 3300005937 Bacteria 22424
88 Ga0081455_10007051 3300005937 Bacteria 11930
89 Ga0081455_10014446 3300005937 Bacteria 7737
90 Ga0081455_10019827 3300005937 Bacteria 6351
91 Ga0081455_10043015 3300005937 Bacteria 3957
92 Ga0081538_10032257 3300005981 Bacteria 3514
93 Ga0081540_1000099 3300005983 Bacteria 91686
94 Ga0081540_1002490 3300005983 Bacteria 14987
95 Ga0081540_1042412 3300005983 Bacteria 2347
96 Ga0081540_1044297 3300005983 Bacteria 2273
97 Ga0081540_1059942 3300005983 Bacteria 1824
98 Ga0081540_1080010 3300005983 Bacteria 1475
99 Ga0081540_1138740 3300005983 Bacteria 980
100 Ga0081539_10025006 3300005985 Bacteria 3858
101 Ga0070717_10000895 3300006028 Bacteria 19768
102 Ga0070717_10008142 3300006028 Bacteria 7824
103 Ga0070717_10042605 3300006028 Bacteria 3703
104 Ga0070717_10058356 3300006028 Bacteria 3191
105 Ga0070717_10063182 3300006028 Bacteria 3072
106 Ga0070717_10069176 3300006028 Bacteria 2939
107 Ga0070717_10114897 3300006028 Bacteria 2300
108 Ga0070717_10147787 3300006028 Bacteria 2031
109 Ga0070717_10163763 3300006028 Bacteria 1931
110 Ga0075365_10026360 3300006038 Bacteria 3689
111 Ga0075365_10028679 3300006038 Bacteria 3551
112 Ga0075365_10099836 3300006038 Bacteria 1987
113 Ga0075365_10278175 3300006038 Bacteria 1177
114 Ga0075368_10042960 3300006042 Bacteria 1780
115 Ga0075363_100126406 3300006048 Bacteria 1432
116 Ga0075363_100309072 3300006048 Bacteria 918
117 Ga0075364_10040862 3300006051 Bacteria 3009
118 Ga0075364_10087071 3300006051 Bacteria 2070
119 Ga0070715_10130893 3300006163 Bacteria 1207
120 Ga0070715_10163309 3300006163 Bacteria 1102
121 Ga0070715_10273906 3300006163 Bacteria 892
122 Ga0070716_100184947 3300006173 Bacteria 1371
123 Ga0070716_100432576 3300006173 Bacteria 955
124 Ga0070712_100147218 3300006175 Bacteria 1804
125 Ga0070712_100164924 3300006175 Bacteria 1714
126 Ga0070712_100326682 3300006175 Bacteria 1249
127 Ga0075362_10191814 3300006177 Bacteria 993
128 Ga0075367_10010099 3300006178 Bacteria 4950
129 Ga0075367_10013716 3300006178 Bacteria 4367
130 Ga0075367_10451172 3300006178 Bacteria 815
131 Ga0075369_10151354 3300006186 Bacteria 1061
132 Ga0075366_10125556 3300006195 Bacteria 1547
133 Ga0097621_100458819 3300006237 Bacteria 1149
134 Ga0097621_100747993 3300006237 Bacteria 903
135 Ga0075370_10005125 3300006353 Bacteria 6462
136 Ga0075370_10010731 3300006353 Bacteria 4802
137 Ga0075370_10325207 3300006353 Bacteria 916
138 Ga0068871_100022452 3300006358 Bacteria 4864
139 Ga0075428_100003372 3300006844 Bacteria 17480
140 Ga0075428_100152509 3300006844 Bacteria 2510
141 Ga0075428_100393302 3300006844 Bacteria 1486
142 Ga0075430_100001211 3300006846 Bacteria 20749
143 Ga0075430_100020849 3300006846 Bacteria 5572
144 Ga0075431_100001495 3300006847 Bacteria 21638
145 Ga0075431_100065085 3300006847 Bacteria 3764
146 Ga0075431_100452409 3300006847 Bacteria 1279
147 Ga0075433_10027057 3300006852 Bacteria 4862
148 Ga0075433_10078430 3300006852 Bacteria 2910
149 Ga0075433_10480241 3300006852 Bacteria 1095
150 Ga0075434_100099957 3300006871 Bacteria 2906
151 Ga0075434_100173104 3300006871 Bacteria 2179
152 Ga0075434_100251039 3300006871 Bacteria 1788
153 Ga0075429_100004770 3300006880 Bacteria 11675
154 Ga0075429_100115583 3300006880 Bacteria 2345
155 Ga0075436_100015554 3300006914 Bacteria 5208
156 Ga0075436_100254605 3300006914 Bacteria 1251
157 Ga0075436_100279843 3300006914 Bacteria 1193
158 Ga0097620_100124846 3300006931 Bacteria 2642
159 Ga0075435_100140860 3300007076 Bacteria 2023
160 Ga0075435_100408255 3300007076 Bacteria 1169
161 Ga0105240_10010565 3300009093 Bacteria 12967
162 Ga0111539_10001922 3300009094 Bacteria 27676
163 Ga0111539_10058559 3300009094 Bacteria 4570
164 Ga0111539_10347643 3300009094 Bacteria 1726
165 Ga0111539_11126531 3300009094 Bacteria 912
166 Ga0105245_10692637 3300009098 Bacteria 1052
167 Ga0105247_10077572 3300009101 Bacteria 2088
168 Ga0114129_10000170 3300009147 Bacteria 70817
169 Ga0114129_10434751 3300009147 Bacteria 1724
170 Ga0114129_10490105 3300009147 Bacteria 1607
171 Ga0114129_10614156 3300009147 Bacteria 1407
172 Ga0105242_10311142 3300009176 Bacteria 1441
173 Ga0105242_10514350 3300009176 Bacteria 1141
174 Ga0105248_10059889 3300009177 Bacteria 4276
175 Ga0105237_10062535 3300009545 Bacteria 3722
176 Ga0105237_10314527 3300009545 Bacteria 1569
177 Ga0105237_10467588 3300009545 Bacteria 1267
178 Ga0105237_10487599 3300009545 Bacteria 1239
179 Ga0105238_10213366 3300009551 Bacteria 1907
180 Ga0105238_10616479 3300009551 Bacteria 1094
181 Ga0105238_10751049 3300009551 Bacteria 989
182 Ga0105238_10933843 3300009551 Bacteria 887
183 Ga0105249_10179723 3300009553 Bacteria 2057
184 Ga0105239_10122697 3300010375 Bacteria 2887
185 Ga0105239_10172832 3300010375 Bacteria 2416
186 Ga0105239_10293053 3300010375 Bacteria 1832
187 Ga0105239_10323382 3300010375 Bacteria 1739
188 Ga0105239_10359454 3300010375 Bacteria 1644
189 Ga0105246_10051839 3300011119 Bacteria 2819
190 Ga0105246_10091520 3300011119 Bacteria 2193
191 Ga0105246_10167963 3300011119 Bacteria 1677
192 Ga0157370_10178684 3300013104 Bacteria 1972
193 Ga0157370_10352481 3300013104 Bacteria 1356
194 Ga0157369_10021893 3300013105 Bacteria 7145
195 Ga0157374_10161013 3300013296 Bacteria 2186
196 Ga0157374_10755476 3300013296 Bacteria 987
197 Ga0157378_10554981 3300013297 Bacteria 1154
198 Ga0163162_10152800 3300013306 Bacteria 2427
199 Ga0157372_10089010 3300013307 Bacteria 3507
200 Ga0157372_10783253 3300013307 Bacteria 1108
201 Ga0157372_11369876 3300013307 Bacteria 816
202 Ga0157375_10801305 3300013308 Bacteria 1091
203 Ga0163163_10029708 3300014325 Bacteria 5260
204 Ga0163163_10147746 3300014325 Bacteria 2395
205 Ga0163163_10235335 3300014325 Bacteria 1881
206 Ga0157380_10064387 3300014326 Bacteria 2943
207 Ga0157380_10437610 3300014326 Bacteria 1252
208 Ga0157379_10206485 3300014968 Bacteria 1777
209 Ga0157376_10100881 3300014969 Bacteria 2521
210 Ga0157376_10140860 3300014969 Bacteria 2163
211 Ga0157376_10471469 3300014969 Bacteria 1228
212 Ga0163161_10326359 3300017792 Bacteria 1214
213 Ga0214544_1000001 3300021320 Bacteria 783667
214 Ga0214544_1020777 3300021320 Bacteria 4531
215 Ga0214542_1000005 3300021321 Bacteria 389646
216 Ga0214545_1000003 3300021324 Bacteria 720274
217 Ga0214545_1013953 3300021324 Bacteria 9654
218 Ga0214543_1000002 3300021327 Bacteria 712733
219 Ga0213876_10040880 3300021384 Bacteria 2450
220 Ga0213871_10001289 3300021441 Bacteria 4116
221 Ga0224572_1042443 3300024225 Bacteria 855
222 Ga0209148_1000253 3300025254 Bacteria 84643
223 Ga0209455_1001670 3300025272 Bacteria 9565
224 Ga0207426_1059801 3300025302 Bacteria 1100
225 Ga0207688_10078323 3300025901 Bacteria 1884
226 Ga0207680_10098431 3300025903 Bacteria 1875
227 Ga0207685_10066216 3300025905 Bacteria 1449
228 Ga0207685_10067789 3300025905 Bacteria 1436
229 Ga0207699_10003139 3300025906 Bacteria 7855
230 Ga0207699_10031686 3300025906 Bacteria 2971
231 Ga0207684_10030611 3300025910 Bacteria 4581
232 Ga0207654_10038930 3300025911 Bacteria 2671
233 Ga0207707_10001008 3300025912 Bacteria 27003
234 Ga0207707_10028450 3300025912 Bacteria 4885
235 Ga0207707_10309467 3300025912 Bacteria 1365
236 Ga0207671_10100582 3300025914 Bacteria 2189
237 Ga0207671_10131838 3300025914 Bacteria 1919
238 Ga0207693_10016343 3300025915 Bacteria 5932
239 Ga0207693_10102352 3300025915 Bacteria 2246
240 Ga0207693_10107498 3300025915 Bacteria 2188
241 Ga0207693_10115637 3300025915 Bacteria 2106
242 Ga0207693_10159007 3300025915 Bacteria 1777
243 Ga0207693_10159174 3300025915 Bacteria 1776
244 Ga0207663_10000176 3300025916 Bacteria 28557
245 Ga0207663_10005873 3300025916 Bacteria 6225
246 Ga0207663_10356415 3300025916 Bacteria 1109
247 Ga0207663_10371044 3300025916 Bacteria 1088
248 Ga0207660_10066272 3300025917 Bacteria 2612
249 Ga0207660_10244469 3300025917 Bacteria 1415
250 Ga0207649_10471870 3300025920 Bacteria 950
251 Ga0207652_10003168 3300025921 Bacteria 13699
252 Ga0207652_10102428 3300025921 Bacteria 2530
253 Ga0207646_10383587 3300025922 Bacteria 1269
254 Ga0207694_10171119 3300025924 Bacteria 1759
255 Ga0207694_10788624 3300025924 Bacteria 802
256 Ga0207650_10005078 3300025925 Bacteria 8983
257 Ga0207659_10396611 3300025926 Bacteria 1153
258 Ga0207687_10121184 3300025927 Bacteria 1956
259 Ga0207700_10004711 3300025928 Bacteria 8085
260 Ga0207700_10010008 3300025928 Bacteria 5958
261 Ga0207700_10071083 3300025928 Bacteria 2678
262 Ga0207700_10080128 3300025928 Bacteria 2545
263 Ga0207700_10111884 3300025928 Bacteria 2199
264 Ga0207700_10278264 3300025928 Bacteria 1439
265 Ga0207664_10432393 3300025929 Bacteria 1173
266 Ga0207644_10032854 3300025931 Bacteria 3623
267 Ga0207686_10636689 3300025934 Bacteria 842
268 Ga0207670_10153331 3300025936 Bacteria 1712
269 Ga0207669_10372645 3300025937 Bacteria 1110
270 Ga0207665_10036681 3300025939 Bacteria 3261
271 Ga0207665_10177424 3300025939 Bacteria 1541
272 Ga0207665_10215327 3300025939 Bacteria 1405
273 Ga0207665_10341117 3300025939 Bacteria 1129
274 Ga0207691_10372723 3300025940 Bacteria 1219
275 Ga0207711_10174233 3300025941 Bacteria 1953
276 Ga0207711_10797363 3300025941 Bacteria 880
277 Ga0207689_10052872 3300025942 Bacteria 3346
278 Ga0207689_10466343 3300025942 Bacteria 1056
279 Ga0207679_10267936 3300025945 Bacteria 1459
280 Ga0207679_10547672 3300025945 Bacteria 1038
281 Ga0207679_10617170 3300025945 Bacteria 978
282 Ga0207667_10022616 3300025949 Bacteria 6939
283 Ga0207667_10236509 3300025949 Bacteria 1870
284 Ga0207651_10187315 3300025960 Bacteria 1648
285 Ga0207712_10089281 3300025961 Bacteria 2265
286 Ga0207668_10052856 3300025972 Bacteria 2812
287 Ga0207640_10216643 3300025981 Bacteria 1463
288 Ga0207677_10103539 3300026023 Bacteria 2101
289 Ga0207677_10110142 3300026023 Bacteria 2049
290 Ga0207703_10030186 3300026035 Bacteria 4282
291 Ga0207703_10255840 3300026035 Bacteria 1581
292 Ga0207639_10131532 3300026041 Bacteria 2072
293 Ga0207678_10009140 3300026067 Bacteria 8728
294 Ga0207678_10020284 3300026067 Bacteria 5833
295 Ga0207678_10044698 3300026067 Bacteria 3831
296 Ga0207678_10060513 3300026067 Bacteria 3257
297 Ga0207708_10317722 3300026075 Bacteria 1270
298 Ga0207702_10206469 3300026078 Bacteria 1824
299 Ga0207702_10585384 3300026078 Bacteria 1094
300 Ga0207648_10086563 3300026089 Bacteria 2734
301 Ga0207676_10229815 3300026095 Bacteria 1657
302 Ga0207676_10770580 3300026095 Bacteria 937
303 Ga0207674_10027595 3300026116 Bacteria 6003
304 Ga0207675_100318339 3300026118 Bacteria 1518
305 Ga0207683_10077845 3300026121 Bacteria 2937
306 Ga0207698_10105611 3300026142 Bacteria 2347
307 Ga0209489_100385 3300027361 Bacteria 79532
308 Ga0209700_100013 3300027363 Bacteria 341906
309 Ga0207428_10002205 3300027907 Bacteria 19581
310 Ga0268266_10000670 3300028379 Bacteria 46181
311 Ga0268266_10026030 3300028379 Bacteria 4976
312 Ga0268266_10109961 3300028379 Bacteria 2441
313 Ga0268264_10118230 3300028381 Bacteria 2332
314 Ga0265334_10106273 3300028573 Bacteria 1012
315 Ga0265330_10004363 3300031235 Bacteria 7190
316 Ga0265332_10000106 3300031238 Bacteria 71076
317 Ga0265328_10000333 3300031239 Bacteria 22080
318 Ga0265325_10161933 3300031241 Bacteria 1052
319 Ga0265329_10004026 3300031242 Bacteria 6253
320 Ga0265340_10033578 3300031247 Bacteria 2554
321 Ga0265340_10042217 3300031247 Bacteria 2240
322 Ga0265340_10058756 3300031247 Bacteria 1846
323 Ga0265339_10000906 3300031249 Bacteria 22779
324 Ga0265339_10180646 3300031249 Bacteria 1051
325 Ga0265331_10000074 3300031250 Bacteria 149282
326 Ga0265331_10011481 3300031250 Bacteria 4847
327 Ga0265327_10111438 3300031251 Bacteria 1307
328 Ga0265316_10000037 3300031344 Bacteria 149295
329 Ga0265313_10002554 3300031595 Bacteria 15551
330 Ga0265314_10001545 3300031711 Bacteria 25384
331 Ga0265314_10003230 3300031711 Bacteria 15933
332 Ga0265314_10078333 3300031711 Bacteria 2189
333 Ga0265342_10000473 3300031712 Bacteria 43592
334 Ga0307405_10093321 3300031731 Bacteria 1999
335 Ga0307413_10358918 3300031824 Bacteria 1127
336 Ga0307407_10536995 3300031903 Bacteria 862
337 Ga0307409_100020254 3300031995 Bacteria 4529
338 Ga0307416_100730541 3300032002 Bacteria 1081
339 Ga0307411_10056323 3300032005 Bacteria 2591
340 Ga0307415_100016685 3300032126 Bacteria 4384
341 Ga0307415_100136824 3300032126 Bacteria 1864
342 Ga0307510_10037129 3300033180 Bacteria 5411
343 Ga0307510_10098175 3300033180 Bacteria 2734
344 Ga0315911_1000011 3300033442 Bacteria 264678
345 Ga0373959_0028355 3300034820 Bacteria 1117
346 Ga0373926_0033752 3300035083 Bacteria 1810
347 Ga0373934_0036665 3300035086 Bacteria 1932
348 Ga0373949_0004015 3300035090 Bacteria 3411
349 Ga0373951_0003883 3300035091 Bacteria 3593
350 Ga0373952_0009142 3300035092 Bacteria 1890
351 Ga0373932_0004447 3300035112 Bacteria 3313
352 Ga0373936_0031239 3300035113 Bacteria 2103
353 Ga0373936_0159721 3300035113 Bacteria 981
354 Ga0373939_0001937 3300035114 Bacteria 4951
355 Ga0373941_0007347 3300035115 Bacteria 2693
356 Ga0373945_0014672 3300035116 Bacteria 2629
357 Ga0373945_0022918 3300035116 Bacteria 2155
358 Ga0373954_0041571 3300035118 Bacteria 2144
359 Ga0373954_0062124 3300035118 Bacteria 1764
360 Ga0373960_0128651 3300035121 Bacteria 847
361 Ga0373943_0021497 3300035170 Bacteria 2981
362 Ga0373943_0160679 3300035170 Bacteria 1223
363 Ga0373946_0011011 3300035171 Bacteria 3363
364 Ga0373946_0050353 3300035171 Bacteria 1740
365 Ga0373946_0151310 3300035171 Bacteria 1083
366 Ga0373955_0017708 3300035172 Bacteria 3530
367 Ga0373955_0063343 3300035172 Bacteria 2047
368 Ga0373955_0263014 3300035172 Bacteria 1036
369 Ga0373955_0482825 3300035172 Bacteria 756
370 Ga0373962_0005121 3300035242 Bacteria 3167
371 Ga0373931_0017987 3300035691 Bacteria 3506
372 Ga0373935_0000359 3300035692 Bacteria 23236
373 Ga0373935_0015920 3300035692 Bacteria 4550
374 Ga0373935_0235732 3300035692 Bacteria 1276
375 Ga0373935_0539055 3300035692 Bacteria 850
376 Ga0373927_0012622 3300035695 Bacteria 5620
377 Ga0373927_0042198 3300035695 Bacteria 2956
378 Ga0373927_0060943 3300035695 Bacteria 2441
379 Ga0373933_0001892 3300035724 Bacteria 12075
380 Ga0373933_0568666 3300035724 Bacteria 744
381 Ga0373947_0000490 3300035725 Bacteria 22794
382 Ga0373947_0014978 3300035725 Bacteria 4451
383 Ga0373947_0063833 3300035725 Bacteria 2244
384 Ga0373947_0105860 3300035725 Bacteria 1772
385 Ga0373937_0011820 3300036401 Bacteria 7665
386 Ga0373937_0113974 3300036401 Bacteria 2516
387 Ga0373937_0122815 3300036401 Bacteria 2421
388 Ga0373937_0123962 3300036401 Bacteria 2409
389 Ga0372808_008576 3300036459 Bacteria 1419
390 Ga0373925_0004226 3300037068 Bacteria 10894
391 Ga0373925_0064468 3300037068 Bacteria 2758
392 Ga0373925_0204720 3300037068 Bacteria 1570
393 Ga0373925_0427076 3300037068 Bacteria 1083
394 Ga0373925_0517504 3300037068 Bacteria 980
395 Ga0395900_0006562 3300037418 Bacteria 12123
396 Ga0395898_0055110 3300037466 Bacteria 3878
397 Ga0395898_0127296 3300037466 Bacteria 2440
398 Ga0395898_0276925 3300037466 Bacteria 1600
399 Ga0395901_0091033 3300038443 Bacteria 3193
400 Ga0395901_0226645 3300038443 Bacteria 1952
401 Ga0436365_0968052 3300039437 Bacteria 2798
402 Ga0436365_1039646 3300039437 Bacteria 1232
403 Ga0436365_1540042 3300039437 Bacteria 70665
404 Ga0436360_1067866 3300039438 Bacteria 3628
405 Ga0436361_0161816 3300039447 Bacteria 1291
406 Ga0436361_0894340 3300039447 Bacteria 3899
407 Ga0436361_1082876 3300039447 Bacteria 6083
408 Ga0436362_0265151 3300039453 Bacteria 2896
409 Ga0436362_0443038 3300039453 Bacteria 903
410 Ga0439465_0012372 3300041413 Bacteria 2669
411 Ga0451791_1145985 3300041451 Bacteria 1092
412 Ga0451851_1218237 3300041507 Bacteria 837
413 Ga0439456_049285 3300042013 Bacteria 919
414 Ga0439460_0097950 3300042461 Bacteria 939
415 Ga0466965_0074731 3300044683 Bacteria 1708
416 Ga0466963_0053342 3300044694 Bacteria 2685
417 Ga0466967_0018740 3300045976 Bacteria 5543
418 Ga0466967_0115901 3300045976 Bacteria 2468
419 Ga0466967_0601992 3300045976 Bacteria 1085
420 Ga0466967_0977870 3300045976 Bacteria 842
421 Ga0495592_0165055 3300046454 Bacteria 1520
422 Ga0495592_0284011 3300046454 Bacteria 1081
423 Ga0495603_0010445 3300046455 Bacteria 5623
424 Ga0495603_0072989 3300046455 Bacteria 2016
425 Ga0495603_0078331 3300046455 Bacteria 1938
426 Ga0495590_0091811 3300046457 Bacteria 1075
427 Ga0495629_0000169 3300046459 Bacteria 57783
428 Ga0495629_0101680 3300046459 Bacteria 2005
429 Ga0495629_0382837 3300046459 Bacteria 957
430 Ga0495638_0199033 3300046460 Bacteria 1132
431 Ga0495641_0028285 3300046461 Bacteria 2715
432 Ga0495641_0088227 3300046461 Bacteria 1387
433 Ga0495651_0002891 3300046462 Bacteria 13294
434 Ga0495651_0056073 3300046462 Bacteria 3027
435 Ga0495653_0022577 3300046463 Bacteria 5089
436 Ga0495580_0011387 3300046472 Bacteria 6883
437 Ga0495582_0000501 3300046473 Bacteria 21420
438 Ga0495582_0089465 3300046473 Bacteria 1716
439 Ga0495582_0417403 3300046473 Bacteria 774
440 Ga0495605_0177650 3300046474 Bacteria 938
441 Ga0495639_0027794 3300046475 Bacteria 2504
442 Ga0495639_0188273 3300046475 Bacteria 1007
443 Ga0495662_0086996 3300046476 Bacteria 1522
444 Ga0495662_0090129 3300046476 Bacteria 1495
445 Ga0495664_0015502 3300046477 Bacteria 4333
446 Ga0495664_0021658 3300046477 Bacteria 3713
447 Ga0495664_0228647 3300046477 Bacteria 1126
448 Ga0495584_0010790 3300046491 Bacteria 4690
449 Ga0495585_0027420 3300046492 Bacteria 3251
450 Ga0495594_0070183 3300046499 Bacteria 1947
451 Ga0495608_0223573 3300046511 Bacteria 1180
452 Ga0495610_0190666 3300046512 Bacteria 846
453 Ga0495616_0202560 3300046513 Bacteria 872
454 Ga0495618_0004599 3300046514 Bacteria 8450
455 Ga0495618_0009970 3300046514 Bacteria 5748
456 Ga0495618_0077440 3300046514 Bacteria 2119
457 Ga0495628_0128569 3300046516 Bacteria 1939
458 Ga0495628_0135778 3300046516 Bacteria 1880
459 Ga0495630_0255414 3300046517 Bacteria 1339
460 Ga0495630_0259225 3300046517 Bacteria 1328
461 Ga0495648_0005936 3300046524 Bacteria 10049
462 Ga0495652_0066385 3300046529 Bacteria 3028
463 Ga0495665_0040425 3300046531 Bacteria 2483
464 Ga0495665_0068113 3300046531 Bacteria 1877
465 Ga0495640_0007530 3300046533 Bacteria 8555
466 Ga0495640_0022380 3300046533 Bacteria 4620
467 Ga0495640_0024977 3300046533 Bacteria 4341
468 Ga0495587_0000396 3300046536 Bacteria 30853
469 Ga0495645_0106082 3300046543 Bacteria 1993
470 Ga0495622_0020201 3300046557 Bacteria 3102
471 Ga0495622_0041478 3300046557 Bacteria 2140
472 Ga0495622_0091622 3300046557 Bacteria 1396
473 Ga0495622_0168477 3300046557 Bacteria 986
474 Ga0495667_0013334 3300046559 Bacteria 5563
475 Ga0495667_0027673 3300046559 Bacteria 3818
476 Ga0495656_0025225 3300046615 Bacteria 2355
477 Ga0495668_0241899 3300046616 Bacteria 988
478 Ga0495634_0033866 3300046642 Bacteria 3508
479 Ga0495634_0079328 3300046642 Bacteria 2150
480 Ga0495635_0012411 3300046663 Bacteria 5970
481 Ga0495635_0015552 3300046663 Bacteria 5318
482 Ga0495635_0108705 3300046663 Bacteria 1894
483 Ga0495657_0023962 3300046675 Bacteria 4354
484 Ga0495657_0130826 3300046675 Bacteria 1572
485 Ga0495599_0037602 3300046678 Bacteria 3040
486 Ga0495599_0105775 3300046678 Bacteria 1753
487 Ga0495623_0004013 3300046679 Bacteria 9685
488 Ga0495623_0054972 3300046679 Bacteria 2511
489 Ga0495646_0039725 3300046680 Bacteria 2900
490 Ga0495647_0016441 3300046681 Bacteria 2605
491 Ga0495658_0001748 3300046683 Bacteria 11230
492 Ga0495658_0041125 3300046683 Bacteria 2573
493 Ga0495658_0077268 3300046683 Bacteria 1947
494 Ga0495658_0164366 3300046683 Bacteria 1370
495 Ga0495613_0033167 3300046689 Bacteria 3837
496 Ga0495613_0136671 3300046689 Bacteria 1753
497 Ga0495613_0222069 3300046689 Bacteria 1326
498 Ga0495624_0108776 3300046690 Bacteria 1705
499 Ga0495624_0329531 3300046690 Bacteria 919
500 Ga0495600_0004521 3300046809 Bacteria 8333
501 Ga0495581_0022126 3300047315 Bacteria 3684
502 Ga0495581_0070608 3300047315 Bacteria 2020
503 Ga0495581_0075949 3300047315 Bacteria 1944
504 Ga0495581_0175731 3300047315 Bacteria 1252
505 Ga0495604_0006104 3300047317 Bacteria 9561
506 Ga0495604_0115230 3300047317 Bacteria 1953
507 Ga0495604_0167937 3300047317 Bacteria 1546
508 Ga0495674_0000860 3300047319 Bacteria 29012
509 Ga0495674_0018990 3300047319 Bacteria 6391
510 Ga0495674_0062241 3300047319 Bacteria 3250
511 Ga0495672_0087168 3300047320 Bacteria 1724
512 Ga0495672_0173842 3300047320 Bacteria 1096
513 Ga0495672_0194228 3300047320 Bacteria 1019
514 Ga0495676_0040825 3300047321 Bacteria 3826
515 Ga0495676_0289593 3300047321 Bacteria 1107
516 Ga0495676_0301533 3300047321 Bacteria 1080
517 Ga0495680_0008674 3300047322 Bacteria 9225
518 Ga0495680_0057823 3300047322 Bacteria 2998
519 Ga0495675_0035181 3300047444 Bacteria 3199
520 Ga0495679_077690 3300047446 Bacteria 947
521 Ga0495684_0011622 3300047471 Bacteria 6797
522 Ga0495684_0024897 3300047471 Bacteria 4603
523 Ga0495686_0110474 3300047472 Bacteria 1649
524 Ga0495686_0129427 3300047472 Bacteria 1498
525 Ga0495593_0042881 3300047673 Bacteria 2427
526 Ga0495593_0061530 3300047673 Bacteria 1963
527 Ga0495593_0105535 3300047673 Bacteria 1442
528 Ga0495602_0015443 3300048088 Bacteria 7705
529 Ga0496100_0056160 3300048903 Bacteria 2575
530 Ga0496100_0203112 3300048903 Bacteria 1445
531 Ga0496101_0007208 3300048904 Bacteria 7198
532 Ga0496101_0162974 3300048904 Bacteria 1711
533 Ga0496102_0152736 3300048905 Bacteria 2170
534 Ga0496102_0409370 3300048905 Bacteria 1274
535 Ga0496103_0089496 3300048906 Bacteria 1941
536 Ga0496104_0000069 3300048907 Bacteria 107511
537 Ga0496104_0001421 3300048907 Bacteria 20741
538 Ga0496104_0005194 3300048907 Bacteria 11383
539 Ga0496104_0333963 3300048907 Bacteria 1428
540 Ga0496104_0352896 3300048907 Bacteria 1383
541 Ga0496104_0369104 3300048907 Bacteria 1348
542 Ga0496104_0375570 3300048907 Bacteria 1334
543 Ga0496105_0000062 3300048908 Bacteria 85187
544 Ga0496105_0006775 3300048908 Bacteria 8808
545 Ga0496105_0060429 3300048908 Bacteria 3127
546 Ga0496105_0071969 3300048908 Bacteria 2858
547 Ga0496105_0075153 3300048908 Bacteria 2790
548 Ga0496105_0316595 3300048908 Bacteria 1251
549 Ga0496106_0002088 3300048909 Bacteria 14981
550 Ga0496106_0025435 3300048909 Bacteria 4406
551 Ga0496106_0072788 3300048909 Bacteria 2628
552 Ga0496106_0105469 3300048909 Bacteria 2190
553 Ga0496106_0114497 3300048909 Bacteria 2103
554 Ga0496106_0236097 3300048909 Bacteria 1461
555 Ga0496107_0004186 3300048910 Bacteria 9746
556 Ga0496107_0004453 3300048910 Bacteria 9497
557 Ga0496108_0001075 3300048911 Bacteria 21328
558 Ga0496108_0014318 3300048911 Bacteria 6474
559 Ga0496108_0173761 3300048911 Bacteria 1864
560 Ga0496109_0002544 3300048912 Bacteria 15291
561 Ga0496109_0196000 3300048912 Bacteria 1898
562 Ga0496109_0310379 3300048912 Bacteria 1488
563 Ga0496109_0364960 3300048912 Bacteria 1364
564 Ga0496110_0026785 3300048913 Bacteria 4937
565 Ga0496110_0135186 3300048913 Bacteria 2227
566 Ga0496110_0355967 3300048913 Bacteria 1334
567 Ga0496110_0623592 3300048913 Bacteria 977
568 Ga0496111_0055575 3300048914 Bacteria 2863
569 Ga0496111_0282636 3300048914 Bacteria 1231
570 Ga0496112_0003616 3300048915 Bacteria 12875
571 Ga0496112_0040721 3300048915 Bacteria 4543
572 Ga0496112_0078923 3300048915 Bacteria 3255
573 Ga0496112_0168277 3300048915 Bacteria 2157
574 Ga0496112_0177789 3300048915 Bacteria 2092
575 Ga0496112_0257938 3300048915 Bacteria 1693
576 Ga0496112_0788288 3300048915 Bacteria 875
577 Ga0496113_0000949 3300048916 Bacteria 15428
578 Ga0496113_0020463 3300048916 Bacteria 4652
579 Ga0496113_0075829 3300048916 Bacteria 2567
580 Ga0496113_0243344 3300048916 Bacteria 1436
581 Ga0496114_0026910 3300048917 Bacteria 4711
582 Ga0496114_0111821 3300048917 Bacteria 2341
583 Ga0496114_0206816 3300048917 Bacteria 1721
584 Ga0496114_0435070 3300048917 Bacteria 1162
585 Ga0496115_0018802 3300048918 Bacteria 5311
586 Ga0496115_0043919 3300048918 Bacteria 3564
587 Ga0496115_0064899 3300048918 Bacteria 2948
588 Ga0496115_0111816 3300048918 Bacteria 2244
589 Ga0496115_0167639 3300048918 Bacteria 1816
590 Ga0496115_0229266 3300048918 Bacteria 1532
591 Ga0496115_0270767 3300048918 Bacteria 1395
592 Ga0496115_0378098 3300048918 Bacteria 1152
593 Ga0496118_0030366 3300048921 Bacteria 4512
594 Ga0496119_0012629 3300048922 Bacteria 6837
595 Ga0496120_0030873 3300048923 Bacteria 3252
596 Ga0496121_0039412 3300048924 Bacteria 4164
597 Ga0496121_0059965 3300048924 Bacteria 3134
598 Ga0496124_0057877 3300048927 Bacteria 3263
599 Ga0496125_0051128 3300048928 Bacteria 3412
600 Ga0496126_0007749 3300048929 Bacteria 11708
601 Ga0496126_0047853 3300048929 Bacteria 3913
602 Ga0496126_0065391 3300048929 Bacteria 3255
603 Ga0496126_0088727 3300048929 Bacteria 2723
604 Ga0496126_0089186 3300048929 Bacteria 2715
605 Ga0496126_0218791 3300048929 Bacteria 1601
606 Ga0501034_0313442 3300049571 Bacteria 1503
607 Ga0501036_0593806 3300049572 Bacteria 919
608 Ga0501048_0000115 3300049582 Bacteria 45729
609 Ga0501069_0135581 3300049585 Bacteria 1411
610 nmdc:mga03683_24331_c2 3300050489 Bacteria 1672
611 nmdc:mga00v17_133351_c1 3300050491 Bacteria 1589
612 nmdc:mga00v17_30266_c1 3300050491 Bacteria 3184
613 nmdc:mga00v17_32317_c1 3300050491 Bacteria 3092
614 nmdc:mga00v17_325276_c1 3300050491 Bacteria 999
615 nmdc:mga0yw44_11952_c1 3300050492 Bacteria 4506
616 nmdc:mga0yw44_126266_c1 3300050492 Bacteria 1652
617 nmdc:mga0yw44_34727_c1 3300050492 Bacteria 2957
618 nmdc:mga0yw44_9567_c1 3300050492 Bacteria 4911
619 nmdc:mga0k408_139207_c1 3300050493 Bacteria 1443
620 nmdc:mga06z11_13060_c1 3300050494 Bacteria 3633
621 nmdc:mga06z11_23452_c1 3300050494 Bacteria 2899
622 nmdc:mga06z11_59498_c1 3300050494 Bacteria 1986
623 nmdc:mga07m45_5386_c1 3300050496 Bacteria 6367
624 nmdc:mga05p37_124_c1 3300050507 Bacteria 69907
625 nmdc:mga05p37_333562_c1 3300050507 Bacteria 1791
626 nmdc:mga09592_547888_c1 3300050508 Bacteria 993
627 nmdc:mga09592_5518_c1 3300050508 Bacteria 10293
628 nmdc:mga0qj67_16363_c1 3300050509 Bacteria 5623
629 nmdc:mga0qj67_316236_c1 3300050509 Bacteria 1264
630 nmdc:mga0qj67_3618_c1 3300050509 Bacteria 11152
631 nmdc:mga06r32_145140_c1 3300050510 Bacteria 2351
632 nmdc:mga06r32_847_c1 3300050510 Bacteria 27075
633 nmdc:mga08y16_2124_c1 3300050511 Bacteria 20307
634 nmdc:mga08y16_233220_c1 3300050511 Bacteria 1903
635 nmdc:mga08y16_238003_c1 3300050511 Bacteria 1882
636 nmdc:mga0n895_18346_c1 3300050512 Bacteria 6471
637 nmdc:mga0n895_426935_c1 3300050512 Bacteria 1339
638 nmdc:mga0n895_45308_c1 3300050512 Bacteria 4292
639 nmdc:mga0n895_56526_c1 3300050512 Bacteria 3866
640 nmdc:mga0n895_790415_c1 3300050512 Bacteria 940
641 nmdc:mga0rr50_353686_c1 3300050513 Bacteria 1236
642 nmdc:mga0rr50_678961_c1 3300050513 Bacteria 879
643 nmdc:mga0rr50_73213_c1 3300050513 Bacteria 2619
644 nmdc:mga08x19_206289_c1 3300050514 Bacteria 1348
645 nmdc:mga08x19_209816_c1 3300050514 Bacteria 1337
646 nmdc:mga08x19_23380_c1 3300050514 Bacteria 3834
647 nmdc:mga0a205_154174_c1 3300050515 Bacteria 2196
648 nmdc:mga0a205_469041_c1 3300050515 Bacteria 1118
649 nmdc:mga0a205_543441_c1 3300050515 Bacteria 1017
650 nmdc:mga0a205_97632_c1 3300050515 Bacteria 2837
651 nmdc:mga0sz30_98102_c1 3300050516 Bacteria 1278
652 Ga0495601_0010338 3300053077 Bacteria 5551
653 Ga0495601_0060130 3300053077 Bacteria 2411
654 Ga0495601_0195387 3300053077 Bacteria 1322
655 Ga0495612_0021763 3300053078 Bacteria 2571
656 Ga0495619_0001572 3300053085 Bacteria 15017
657 Ga0495619_0003276 3300053085 Bacteria 10468
658 Ga0495619_0006981 3300053085 Bacteria 7146
659 Ga0495619_0027144 3300053085 Bacteria 3688
660 Ga0495619_0200622 3300053085 Bacteria 1381
661 Ga0500641_0001698 3300053096 Bacteria 7831
662 Ga0500595_000941 3300053119 Bacteria 16447
663 Ga0500595_006818 3300053119 Bacteria 4807
664 Ga0500595_019376 3300053119 Bacteria 2470
665 Ga0500595_052847 3300053119 Bacteria 1253
666 Ga0500607_050885 3300053121 Bacteria 2205
667 Ga0500608_197859 3300053122 Bacteria 834
668 Ga0500559_0002260 3300053136 Bacteria 10172
669 Ga0500586_016591 3300053145 Bacteria 2238
670 Ga0500603_001309 3300053150 Bacteria 5711
671 Ga0500603_026355 3300053150 Bacteria 1469
672 Ga0500616_0027152 3300053153 Bacteria 3163
673 Ga0500616_0034208 3300053153 Bacteria 2769
674 Ga0500620_063141 3300053155 Bacteria 1264
675 Ga0500638_000054 3300053162 Bacteria 23606
676 Ga0500637_0000775 3300053178 Bacteria 12832
677 Ga0500637_0013609 3300053178 Bacteria 4271
678 Ga0500661_000301 3300055283 Bacteria 8965
679 Ga0530510_0094293 3300061734 Bacteria 2186
680 Ga0530510_0292637 3300061734 Bacteria 1218

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037068 Ga0373925_0427076 Ga0373925_0427076_211_933 209
2 3300005434 Ga0070709_10073029 Ga0070709_100730293 214
3 3300005437 Ga0070710_10039921 Ga0070710_100399212 214
4 3300005439 Ga0070711_100029291 Ga0070711_1000292912 214
5 3300006028 Ga0070717_10114897 Ga0070717_101148973 214
6 3300025915 Ga0207693_10159174 Ga0207693_101591742 214
7 3300025928 Ga0207700_10010008 Ga0207700_100100082 214
8 3300045976 Ga0466967_0977870 Ga0466967_0977870_33_725 214
9 3300046524 Ga0495648_0005936 Ga0495648_0005936_1037_1705 218
10 3300005563 Ga0068855_101256767 Ga0068855_1012567671 219
11 3300021441 Ga0213871_10001289 Ga0213871_100012896 219
12 3300039438 Ga0436360_1067866 Ga0436360_1067866_2754_3443 219
13 3300039447 Ga0436361_0894340 Ga0436361_0894340_1998_2687 219
14 3300025939 Ga0207665_10341117 Ga0207665_103411171 220
15 3300021384 Ga0213876_10040880 Ga0213876_100408803 221
16 3300039437 Ga0436365_0968052 Ga0436365_0968052_1105_1797 221
17 3300049572 Ga0501036_0593806 Ga0501036_0593806_11_685 221
18 3300006914 Ga0075436_100254605 Ga0075436_1002546051 223
19 3300037466 Ga0395898_0276925 Ga0395898_0276925_778_1470 223
20 3300050514 nmdc:mga08x19_209816_c1 nmdc:mga08x19_209816_c1_496_1188 223
21 3300006175 Ga0070712_100326682 Ga0070712_1003266822 225
22 3300031247 Ga0265340_10058756 Ga0265340_100587562 225
23 3300031249 Ga0265339_10000906 Ga0265339_1000090611 225
24 3300035171 Ga0373946_0050353 Ga0373946_0050353_443_1141 225
25 3300035172 Ga0373955_0482825 Ga0373955_0482825_37_735 225
26 3300035695 Ga0373927_0060943 Ga0373927_0060943_434_1132 225
27 3300046475 Ga0495639_0188273 Ga0495639_0188273_234_932 225
28 3300046476 Ga0495662_0090129 Ga0495662_0090129_341_1039 225
29 3300046681 Ga0495647_0016441 Ga0495647_0016441_1865_2563 225
30 3300046683 Ga0495658_0077268 Ga0495658_0077268_1153_1851 225
31 3300047315 Ga0495581_0175731 Ga0495581_0175731_506_1204 225
32 3300047673 Ga0495593_0105535 Ga0495593_0105535_433_1131 225
33 3300048918 Ga0496115_0167639 Ga0496115_0167639_755_1453 225
34 3300053085 Ga0495619_0003276 Ga0495619_0003276_3341_4039 225
35 iso_pu_bacteria 2508501042 2508696872 225
36 iso_pu_bacteria 8006926726 8006929832 225
37 iso_pu_bacteria 2507262055 2507511086 226
38 iso_pu_bacteria 2508501009 2508544900 226
39 iso_pu_bacteria 2513237092 2513623545 226
40 iso_pu_bacteria 2513237096 2513661269 226
41 iso_pu_bacteria 2513237137 2513858182 226
42 iso_pu_bacteria 2513237141 2513892151 226
43 iso_pu_bacteria 2513237145 2513922990 226
44 iso_pu_bacteria 2517572143 2517893926 226
45 iso_pu_bacteria 2524023205 2524438126 226
46 iso_pu_bacteria 2617270741 2617373209 226
47 iso_pu_bacteria 2791355199 2793081987 226
48 iso_pu_bacteria 2821443989 2821446318 226
49 iso_pu_bacteria 2824661429 2824667975 226
50 iso_pu_bacteria 2824704595 2824712081 226
51 iso_pu_bacteria 2824732956 2824738728 226
52 iso_pu_bacteria 2824746037 2824752407 226
53 iso_pu_bacteria 2824753945 2824761481 226
54 iso_pu_bacteria 2824763712 2824771356 226
55 iso_pu_bacteria 2824773399 2824780506 226
56 iso_pu_bacteria 2841957949 2841961942 226
57 iso_pu_bacteria 2847930680 2847938627 226
58 iso_pu_bacteria 2849076700 2849081600 226
59 iso_pu_bacteria 2879083081 2879088399 226
60 iso_pu_bacteria 2881364244 2881370745 226
61 iso_pu_bacteria 2881665667 2881671273 226
62 iso_pu_bacteria 2885374607 2885382427 226
63 iso_pu_bacteria 2885409591 2885411872 226
64 iso_pu_bacteria 2889033259 2889037265 226
65 iso_pu_bacteria 2903768456 2903777904 226
66 iso_pu_bacteria 2904711408 2904719302 226
67 iso_pu_bacteria 2906635258 2906635976 226
68 iso_pu_bacteria 2906643746 2906649146 226
69 iso_pu_bacteria 2906660503 2906663925 226
70 iso_pu_bacteria 2908739725 2908744330 226
71 iso_pu_bacteria 2908775508 2908781666 226
72 iso_pu_bacteria 2922393267 2922401026 226
73 iso_pu_bacteria 2932784394 2932785832 226
74 iso_pu_bacteria 2932828146 2932830877 226
75 iso_pu_bacteria 2935608549 2935612685 226
76 iso_pu_bacteria 2935616580 2935620920 226
77 iso_pu_bacteria 2935638405 2935640003 226
78 iso_pu_bacteria 2935648319 2935655199 226
79 iso_pu_bacteria 2935656913 2935664080 226
80 iso_pu_bacteria 2935665750 2935667143 226
81 iso_pu_bacteria 2935684952 2935690273 226
82 iso_pu_bacteria 2935703347 2935704899 226
83 iso_pu_bacteria 2935713505 2935718031 226
84 iso_pu_bacteria 2935722832 2935726819 226
85 iso_pu_bacteria 2935732158 2935735589 226
86 iso_pu_bacteria 2935741537 2935745140 226
87 iso_pu_bacteria 2935750917 2935755283 226
88 iso_pu_bacteria 2935769743 2935773577 226
89 iso_pu_bacteria 2935777560 2935784519 226
90 iso_pu_bacteria 2935785616 2935788518 226
91 iso_pu_bacteria 2935793552 2935796674 226
92 iso_pu_bacteria 2935801545 2935803699 226
93 iso_pu_bacteria 2935819856 2935824174 226
94 iso_pu_bacteria 2935827899 2935829486 226
95 iso_pu_bacteria 2935837841 2935842537 226
96 iso_pu_bacteria 2935847175 2935852679 226
97 iso_pu_bacteria 2935855204 2935858728 226
98 iso_pu_bacteria 2935864058 2935866850 226
99 iso_pu_bacteria 2935873716 2935876981 226
100 iso_pu_bacteria 2935908558 2935912167 226
101 iso_pu_bacteria 2935916978 2935922380 226
102 iso_pu_bacteria 2935926038 2935929196 226
103 iso_pu_bacteria 2935934488 2935935827 226
104 iso_pu_bacteria 2935942939 2935947393 226
105 iso_pu_bacteria 2935951376 2935953513 226
106 iso_pu_bacteria 2935959822 2935961977 226
107 iso_pu_bacteria 2935967501 2935968539 226
108 iso_pu_bacteria 2935984226 2935990656 226
109 iso_pu_bacteria 2936002035 2936004274 226
110 iso_pu_bacteria 2936011229 2936015422 226
111 iso_pu_bacteria 2936019824 2936024056 226
112 iso_pu_bacteria 2936028420 2936033071 226
113 iso_pu_bacteria 2936046547 2936051164 226
114 iso_pu_bacteria 2936055302 2936058541 226
115 iso_pu_bacteria 2940556831 2940561436 226
116 iso_pu_bacteria 2941538514 2941544616 226
117 iso_pu_bacteria 3005718088 3005719605 226
118 iso_pu_bacteria 8016511872 8016516512 226
119 iso_pu_bacteria 8016530956 8016537451 226
120 iso_pu_bacteria 8016539877 8016541722 226
121 iso_pu_bacteria 8016566248 8016567108 226
122 iso_pu_bacteria 8016575299 8016579827 226
123 iso_pu_bacteria 8016595262 8016597864 226
124 iso_pu_bacteria 8016603502 8016604002 226
125 iso_pu_bacteria 8016613128 8016620583 226
126 iso_pu_bacteria 8016622563 8016629408 226
127 iso_pu_bacteria 8016630954 8016633921 226
128 iso_pu_bacteria 8017057580 8017060028 226
129 iso_pu_bacteria 8019530166 8019537135 226
130 iso_pu_bacteria 8019538911 8019542412 226
131 iso_pu_bacteria 8019547302 8019548346 226
132 iso_pu_bacteria 8019576017 8019579532 226
133 iso_pu_bacteria 8019586578 8019587242 226
134 iso_pu_bacteria 8019597564 8019604096 226
135 iso_pu_bacteria 8019608314 8019614433 226
136 iso_pu_bacteria 8019687851 8019694192 226
137 iso_pu_bacteria 8056967851 8056969645 226
138 3300050494 nmdc:mga06z11_13060_c1 nmdc:mga06z11_13060_c1_139_825 227
139 3300005577 Ga0068857_100031867 Ga0068857_1000318674 229
140 3300009545 Ga0105237_10487599 Ga0105237_104875992 229
141 3300009551 Ga0105238_10933843 Ga0105238_109338431 229
142 3300025302 Ga0207426_1059801 Ga0207426_10598012 229
143 3300026116 Ga0207674_10027595 Ga0207674_100275955 229
144 3300042013 Ga0439456_049285 Ga0439456_049285_168_857 229
145 3300042461 Ga0439460_0097950 Ga0439460_0097950_189_878 229
146 3300045976 Ga0466967_0115901 Ga0466967_0115901_1683_2378 229
147 3300047317 Ga0495604_0167937 Ga0495604_0167937_22_741 229
148 3300061734 Ga0530510_0094293 Ga0530510_0094293_257_946 229
149 3300003320 rootH2_10028247 rootH2_100282472 230
150 3300003659 JGI25404J52841_10027507 JGI25404J52841_100275071 230
151 3300005295 Ga0065707_10305448 Ga0065707_103054481 230
152 3300005327 Ga0070658_10200690 Ga0070658_102006902 230
153 3300005329 Ga0070683_100146343 Ga0070683_1001463432 230
154 3300005329 Ga0070683_100656872 Ga0070683_1006568722 230
155 3300005331 Ga0070670_100002724 Ga0070670_1000027247 230
156 3300005331 Ga0070670_100275170 Ga0070670_1002751702 230
157 3300005334 Ga0068869_100040507 Ga0068869_1000405073 230
158 3300005336 Ga0070680_100451117 Ga0070680_1004511171 230
159 3300005337 Ga0070682_100012744 Ga0070682_1000127442 230
160 3300005337 Ga0070682_100266355 Ga0070682_1002663551 230
161 3300005337 Ga0070682_100408638 Ga0070682_1004086381 230
162 3300005338 Ga0068868_100143996 Ga0068868_1001439963 230
163 3300005339 Ga0070660_100130480 Ga0070660_1001304802 230
164 3300005340 Ga0070689_100058900 Ga0070689_1000589002 230
165 3300005341 Ga0070691_10080048 Ga0070691_100800482 230
166 3300005341 Ga0070691_10091580 Ga0070691_100915802 230
167 3300005347 Ga0070668_100045408 Ga0070668_1000454085 230
168 3300005347 Ga0070668_100102316 Ga0070668_1001023162 230
169 3300005347 Ga0070668_100115575 Ga0070668_1001155752 230
170 3300005355 Ga0070671_100001622 Ga0070671_1000016228 230
171 3300005355 Ga0070671_100264152 Ga0070671_1002641521 230
172 3300005364 Ga0070673_100044017 Ga0070673_1000440173 230
173 3300005367 Ga0070667_100392065 Ga0070667_1003920651 230
174 3300005367 Ga0070667_100645944 Ga0070667_1006459441 230
175 3300005434 Ga0070709_10164477 Ga0070709_101644772 230
176 3300005435 Ga0070714_100063519 Ga0070714_1000635192 230
177 3300005436 Ga0070713_100039420 Ga0070713_1000394205 230
178 3300005436 Ga0070713_100064482 Ga0070713_1000644823 230
179 3300005436 Ga0070713_100093832 Ga0070713_1000938322 230
180 3300005436 Ga0070713_100934834 Ga0070713_1009348341 230
181 3300005437 Ga0070710_10017367 Ga0070710_100173672 230
182 3300005437 Ga0070710_10035714 Ga0070710_100357142 230
183 3300005437 Ga0070710_10380793 Ga0070710_103807931 230
184 3300005438 Ga0070701_10239926 Ga0070701_102399261 230
185 3300005439 Ga0070711_100010047 Ga0070711_1000100478 230
186 3300005439 Ga0070711_100404802 Ga0070711_1004048022 230
187 3300005445 Ga0070708_100335683 Ga0070708_1003356831 230
188 3300005455 Ga0070663_100017934 Ga0070663_1000179345 230
189 3300005455 Ga0070663_100063699 Ga0070663_1000636991 230
190 3300005455 Ga0070663_100087030 Ga0070663_1000870302 230
191 3300005456 Ga0070678_100056739 Ga0070678_1000567392 230
192 3300005456 Ga0070678_100237225 Ga0070678_1002372251 230
193 3300005457 Ga0070662_100195506 Ga0070662_1001955061 230
194 3300005458 Ga0070681_10008226 Ga0070681_1000822615 230
195 3300005458 Ga0070681_10056108 Ga0070681_100561083 230
196 3300005458 Ga0070681_10157638 Ga0070681_101576383 230
197 3300005458 Ga0070681_10162326 Ga0070681_101623262 230
198 3300005467 Ga0070706_100035478 Ga0070706_1000354782 230
199 3300005471 Ga0070698_100105128 Ga0070698_1001051282 230
200 3300005518 Ga0070699_100004291 Ga0070699_10000429113 230
201 3300005530 Ga0070679_100023223 Ga0070679_10002322311 230
202 3300005530 Ga0070679_100039928 Ga0070679_1000399284 230
203 3300005530 Ga0070679_100213053 Ga0070679_1002130531 230
204 3300005535 Ga0070684_100758929 Ga0070684_1007589291 230
205 3300005536 Ga0070697_100040568 Ga0070697_1000405684 230
206 3300005539 Ga0068853_100179252 Ga0068853_1001792523 230
207 3300005543 Ga0070672_100306571 Ga0070672_1003065712 230
208 3300005544 Ga0070686_100099082 Ga0070686_1000990821 230
209 3300005547 Ga0070693_100130027 Ga0070693_1001300272 230
210 3300005547 Ga0070693_100170425 Ga0070693_1001704252 230
211 3300005547 Ga0070693_100178127 Ga0070693_1001781271 230
212 3300005548 Ga0070665_100005813 Ga0070665_1000058135 230
213 3300005548 Ga0070665_100152404 Ga0070665_1001524043 230
214 3300005563 Ga0068855_100132560 Ga0068855_1001325602 230
215 3300005564 Ga0070664_100743647 Ga0070664_1007436471 230
216 3300005578 Ga0068854_100185586 Ga0068854_1001855862 230
217 3300005614 Ga0068856_100607371 Ga0068856_1006073711 230
218 3300005614 Ga0068856_100848407 Ga0068856_1008484071 230
219 3300005616 Ga0068852_100180838 Ga0068852_1001808382 230
220 3300005616 Ga0068852_100621572 Ga0068852_1006215722 230
221 3300005617 Ga0068859_100124845 Ga0068859_1001248453 230
222 3300005618 Ga0068864_100526009 Ga0068864_1005260092 230
223 3300005718 Ga0068866_10066524 Ga0068866_100665243 230
224 3300005719 Ga0068861_100223271 Ga0068861_1002232712 230
225 3300005841 Ga0068863_100321751 Ga0068863_1003217512 230
226 3300005842 Ga0068858_100224480 Ga0068858_1002244802 230
227 3300005843 Ga0068860_100193494 Ga0068860_1001934942 230
228 3300005844 Ga0068862_100131061 Ga0068862_1001310612 230
229 3300005937 Ga0081455_10000227 Ga0081455_1000022728 230
230 3300005937 Ga0081455_10002386 Ga0081455_1000238623 230
231 3300005937 Ga0081455_10007051 Ga0081455_100070516 230
232 3300005937 Ga0081455_10014446 Ga0081455_100144461 230
233 3300005937 Ga0081455_10019827 Ga0081455_100198273 230
234 3300005937 Ga0081455_10043015 Ga0081455_100430156 230
235 3300005981 Ga0081538_10032257 Ga0081538_100322573 230
236 3300005983 Ga0081540_1000099 Ga0081540_100009938 230
237 3300005983 Ga0081540_1002490 Ga0081540_10024902 230
238 3300005983 Ga0081540_1042412 Ga0081540_10424124 230
239 3300005983 Ga0081540_1044297 Ga0081540_10442971 230
240 3300005983 Ga0081540_1059942 Ga0081540_10599422 230
241 3300005983 Ga0081540_1080010 Ga0081540_10800102 230
242 3300005983 Ga0081540_1138740 Ga0081540_11387401 230
243 3300005985 Ga0081539_10025006 Ga0081539_100250067 230
244 3300006028 Ga0070717_10000895 Ga0070717_100008952 230
245 3300006028 Ga0070717_10008142 Ga0070717_100081423 230
246 3300006028 Ga0070717_10042605 Ga0070717_100426051 230
247 3300006028 Ga0070717_10058356 Ga0070717_100583563 230
248 3300006028 Ga0070717_10063182 Ga0070717_100631824 230
249 3300006028 Ga0070717_10069176 Ga0070717_100691762 230
250 3300006028 Ga0070717_10147787 Ga0070717_101477872 230
251 3300006028 Ga0070717_10163763 Ga0070717_101637633 230
252 3300006038 Ga0075365_10026360 Ga0075365_100263602 230
253 3300006038 Ga0075365_10028679 Ga0075365_100286795 230
254 3300006038 Ga0075365_10099836 Ga0075365_100998362 230
255 3300006038 Ga0075365_10278175 Ga0075365_102781752 230
256 3300006042 Ga0075368_10042960 Ga0075368_100429602 230
257 3300006048 Ga0075363_100126406 Ga0075363_1001264062 230
258 3300006048 Ga0075363_100309072 Ga0075363_1003090721 230
259 3300006051 Ga0075364_10040862 Ga0075364_100408623 230
260 3300006051 Ga0075364_10087071 Ga0075364_100870712 230
261 3300006163 Ga0070715_10130893 Ga0070715_101308931 230
262 3300006163 Ga0070715_10163309 Ga0070715_101633091 230
263 3300006163 Ga0070715_10273906 Ga0070715_102739061 230
264 3300006173 Ga0070716_100184947 Ga0070716_1001849471 230
265 3300006173 Ga0070716_100432576 Ga0070716_1004325761 230
266 3300006175 Ga0070712_100147218 Ga0070712_1001472182 230
267 3300006175 Ga0070712_100164924 Ga0070712_1001649242 230
268 3300006177 Ga0075362_10191814 Ga0075362_101918141 230
269 3300006178 Ga0075367_10010099 Ga0075367_100100995 230
270 3300006178 Ga0075367_10013716 Ga0075367_100137164 230
271 3300006178 Ga0075367_10451172 Ga0075367_104511721 230
272 3300006186 Ga0075369_10151354 Ga0075369_101513542 230
273 3300006195 Ga0075366_10125556 Ga0075366_101255563 230
274 3300006237 Ga0097621_100458819 Ga0097621_1004588192 230
275 3300006237 Ga0097621_100747993 Ga0097621_1007479931 230
276 3300006353 Ga0075370_10005125 Ga0075370_100051252 230
277 3300006353 Ga0075370_10010731 Ga0075370_100107313 230
278 3300006353 Ga0075370_10325207 Ga0075370_103252072 230
279 3300006358 Ga0068871_100022452 Ga0068871_1000224523 230
280 3300006844 Ga0075428_100003372 Ga0075428_10000337216 230
281 3300006844 Ga0075428_100152509 Ga0075428_1001525092 230
282 3300006844 Ga0075428_100393302 Ga0075428_1003933022 230
283 3300006846 Ga0075430_100001211 Ga0075430_1000012112 230
284 3300006846 Ga0075430_100020849 Ga0075430_1000208493 230
285 3300006847 Ga0075431_100001495 Ga0075431_1000014955 230
286 3300006847 Ga0075431_100065085 Ga0075431_1000650855 230
287 3300006847 Ga0075431_100452409 Ga0075431_1004524092 230
288 3300006852 Ga0075433_10027057 Ga0075433_100270575 230
289 3300006852 Ga0075433_10078430 Ga0075433_100784303 230
290 3300006852 Ga0075433_10480241 Ga0075433_104802412 230
291 3300006871 Ga0075434_100099957 Ga0075434_1000999571 230
292 3300006871 Ga0075434_100173104 Ga0075434_1001731041 230
293 3300006871 Ga0075434_100251039 Ga0075434_1002510392 230
294 3300006880 Ga0075429_100004770 Ga0075429_1000047706 230
295 3300006880 Ga0075429_100115583 Ga0075429_1001155833 230
296 3300006914 Ga0075436_100015554 Ga0075436_1000155544 230
297 3300006914 Ga0075436_100279843 Ga0075436_1002798431 230
298 3300006931 Ga0097620_100124846 Ga0097620_1001248462 230
299 3300007076 Ga0075435_100140860 Ga0075435_1001408602 230
300 3300007076 Ga0075435_100408255 Ga0075435_1004082551 230
301 3300009093 Ga0105240_10010565 Ga0105240_1001056511 230
302 3300009094 Ga0111539_10001922 Ga0111539_1000192215 230
303 3300009094 Ga0111539_10058559 Ga0111539_100585593 230
304 3300009094 Ga0111539_10347643 Ga0111539_103476432 230
305 3300009094 Ga0111539_11126531 Ga0111539_111265311 230
306 3300009098 Ga0105245_10692637 Ga0105245_106926372 230
307 3300009101 Ga0105247_10077572 Ga0105247_100775722 230
308 3300009147 Ga0114129_10000170 Ga0114129_1000017038 230
309 3300009147 Ga0114129_10434751 Ga0114129_104347513 230
310 3300009147 Ga0114129_10490105 Ga0114129_104901052 230
311 3300009147 Ga0114129_10614156 Ga0114129_106141561 230
312 3300009176 Ga0105242_10311142 Ga0105242_103111422 230
313 3300009176 Ga0105242_10514350 Ga0105242_105143501 230
314 3300009177 Ga0105248_10059889 Ga0105248_100598891 230
315 3300009545 Ga0105237_10062535 Ga0105237_100625353 230
316 3300009545 Ga0105237_10314527 Ga0105237_103145272 230
317 3300009545 Ga0105237_10467588 Ga0105237_104675882 230
318 3300009551 Ga0105238_10213366 Ga0105238_102133662 230
319 3300009551 Ga0105238_10616479 Ga0105238_106164792 230
320 3300009551 Ga0105238_10751049 Ga0105238_107510492 230
321 3300009553 Ga0105249_10179723 Ga0105249_101797233 230
322 3300010375 Ga0105239_10122697 Ga0105239_101226974 230
323 3300010375 Ga0105239_10172832 Ga0105239_101728322 230
324 3300010375 Ga0105239_10293053 Ga0105239_102930532 230
325 3300010375 Ga0105239_10323382 Ga0105239_103233822 230
326 3300010375 Ga0105239_10359454 Ga0105239_103594542 230
327 3300011119 Ga0105246_10051839 Ga0105246_100518392 230
328 3300011119 Ga0105246_10091520 Ga0105246_100915202 230
329 3300011119 Ga0105246_10167963 Ga0105246_101679631 230
330 3300013104 Ga0157370_10178684 Ga0157370_101786842 230
331 3300013104 Ga0157370_10352481 Ga0157370_103524812 230
332 3300013105 Ga0157369_10021893 Ga0157369_100218939 230
333 3300013296 Ga0157374_10161013 Ga0157374_101610131 230
334 3300013296 Ga0157374_10755476 Ga0157374_107554762 230
335 3300013297 Ga0157378_10554981 Ga0157378_105549812 230
336 3300013306 Ga0163162_10152800 Ga0163162_101528002 230
337 3300013307 Ga0157372_10089010 Ga0157372_100890103 230
338 3300013307 Ga0157372_10783253 Ga0157372_107832532 230
339 3300013307 Ga0157372_11369876 Ga0157372_113698761 230
340 3300013308 Ga0157375_10801305 Ga0157375_108013052 230
341 3300014325 Ga0163163_10029708 Ga0163163_100297082 230
342 3300014325 Ga0163163_10147746 Ga0163163_101477463 230
343 3300014325 Ga0163163_10235335 Ga0163163_102353352 230
344 3300014326 Ga0157380_10064387 Ga0157380_100643873 230
345 3300014326 Ga0157380_10437610 Ga0157380_104376102 230
346 3300014968 Ga0157379_10206485 Ga0157379_102064851 230
347 3300014969 Ga0157376_10100881 Ga0157376_101008812 230
348 3300014969 Ga0157376_10140860 Ga0157376_101408603 230
349 3300014969 Ga0157376_10471469 Ga0157376_104714692 230
350 3300017792 Ga0163161_10326359 Ga0163161_103263591 230
351 3300021320 Ga0214544_1000001 Ga0214544_1000001268 230
352 3300021320 Ga0214544_1020777 Ga0214544_10207776 230
353 3300021321 Ga0214542_1000005 Ga0214542_1000005268 230
354 3300021324 Ga0214545_1000003 Ga0214545_1000003496 230
355 3300021324 Ga0214545_1013953 Ga0214545_10139534 230
356 3300021327 Ga0214543_1000002 Ga0214543_1000002269 230
357 3300024225 Ga0224572_1042443 Ga0224572_10424431 230
358 3300025254 Ga0209148_1000253 Ga0209148_100025332 230
359 3300025272 Ga0209455_1001670 Ga0209455_10016709 230
360 3300025901 Ga0207688_10078323 Ga0207688_100783231 230
361 3300025903 Ga0207680_10098431 Ga0207680_100984312 230
362 3300025905 Ga0207685_10066216 Ga0207685_100662162 230
363 3300025905 Ga0207685_10067789 Ga0207685_100677892 230
364 3300025906 Ga0207699_10003139 Ga0207699_100031391 230
365 3300025906 Ga0207699_10031686 Ga0207699_100316863 230
366 3300025910 Ga0207684_10030611 Ga0207684_100306117 230
367 3300025911 Ga0207654_10038930 Ga0207654_100389301 230
368 3300025912 Ga0207707_10001008 Ga0207707_1000100824 230
369 3300025912 Ga0207707_10028450 Ga0207707_100284502 230
370 3300025912 Ga0207707_10309467 Ga0207707_103094671 230
371 3300025914 Ga0207671_10100582 Ga0207671_101005822 230
372 3300025914 Ga0207671_10131838 Ga0207671_101318382 230
373 3300025915 Ga0207693_10016343 Ga0207693_100163432 230
374 3300025915 Ga0207693_10102352 Ga0207693_101023522 230
375 3300025915 Ga0207693_10107498 Ga0207693_101074982 230
376 3300025915 Ga0207693_10115637 Ga0207693_101156372 230
377 3300025915 Ga0207693_10159007 Ga0207693_101590072 230
378 3300025916 Ga0207663_10000176 Ga0207663_100001769 230
379 3300025916 Ga0207663_10005873 Ga0207663_100058733 230
380 3300025916 Ga0207663_10356415 Ga0207663_103564151 230
381 3300025916 Ga0207663_10371044 Ga0207663_103710442 230
382 3300025917 Ga0207660_10066272 Ga0207660_100662723 230
383 3300025917 Ga0207660_10244469 Ga0207660_102444692 230
384 3300025920 Ga0207649_10471870 Ga0207649_104718701 230
385 3300025921 Ga0207652_10003168 Ga0207652_1000316810 230
386 3300025921 Ga0207652_10102428 Ga0207652_101024281 230
387 3300025922 Ga0207646_10383587 Ga0207646_103835872 230
388 3300025924 Ga0207694_10171119 Ga0207694_101711193 230
389 3300025924 Ga0207694_10788624 Ga0207694_107886241 230
390 3300025925 Ga0207650_10005078 Ga0207650_100050789 230
391 3300025926 Ga0207659_10396611 Ga0207659_103966112 230
392 3300025927 Ga0207687_10121184 Ga0207687_101211842 230
393 3300025928 Ga0207700_10004711 Ga0207700_100047112 230
394 3300025928 Ga0207700_10071083 Ga0207700_100710831 230
395 3300025928 Ga0207700_10080128 Ga0207700_100801282 230
396 3300025928 Ga0207700_10111884 Ga0207700_101118842 230
397 3300025928 Ga0207700_10278264 Ga0207700_102782641 230
398 3300025929 Ga0207664_10432393 Ga0207664_104323932 230
399 3300025931 Ga0207644_10032854 Ga0207644_100328544 230
400 3300025934 Ga0207686_10636689 Ga0207686_106366891 230
401 3300025936 Ga0207670_10153331 Ga0207670_101533312 230
402 3300025937 Ga0207669_10372645 Ga0207669_103726452 230
403 3300025939 Ga0207665_10036681 Ga0207665_100366812 230
404 3300025939 Ga0207665_10177424 Ga0207665_101774243 230
405 3300025939 Ga0207665_10215327 Ga0207665_102153271 230
406 3300025940 Ga0207691_10372723 Ga0207691_103727231 230
407 3300025941 Ga0207711_10174233 Ga0207711_101742332 230
408 3300025941 Ga0207711_10797363 Ga0207711_107973631 230
409 3300025942 Ga0207689_10052872 Ga0207689_100528723 230
410 3300025942 Ga0207689_10466343 Ga0207689_104663432 230
411 3300025945 Ga0207679_10267936 Ga0207679_102679361 230
412 3300025945 Ga0207679_10547672 Ga0207679_105476722 230
413 3300025945 Ga0207679_10617170 Ga0207679_106171701 230
414 3300025949 Ga0207667_10022616 Ga0207667_100226164 230
415 3300025949 Ga0207667_10236509 Ga0207667_102365093 230
416 3300025960 Ga0207651_10187315 Ga0207651_101873152 230
417 3300025961 Ga0207712_10089281 Ga0207712_100892812 230
418 3300025972 Ga0207668_10052856 Ga0207668_100528561 230
419 3300025981 Ga0207640_10216643 Ga0207640_102166432 230
420 3300026023 Ga0207677_10103539 Ga0207677_101035393 230
421 3300026023 Ga0207677_10110142 Ga0207677_101101423 230
422 3300026035 Ga0207703_10030186 Ga0207703_100301865 230
423 3300026035 Ga0207703_10255840 Ga0207703_102558403 230
424 3300026041 Ga0207639_10131532 Ga0207639_101315322 230
425 3300026067 Ga0207678_10009140 Ga0207678_100091406 230
426 3300026067 Ga0207678_10020284 Ga0207678_100202845 230
427 3300026067 Ga0207678_10044698 Ga0207678_100446984 230
428 3300026067 Ga0207678_10060513 Ga0207678_100605134 230
429 3300026075 Ga0207708_10317722 Ga0207708_103177222 230
430 3300026078 Ga0207702_10206469 Ga0207702_102064691 230
431 3300026078 Ga0207702_10585384 Ga0207702_105853842 230
432 3300026089 Ga0207648_10086563 Ga0207648_100865633 230
433 3300026095 Ga0207676_10229815 Ga0207676_102298152 230
434 3300026095 Ga0207676_10770580 Ga0207676_107705802 230
435 3300026118 Ga0207675_100318339 Ga0207675_1003183392 230
436 3300026121 Ga0207683_10077845 Ga0207683_100778454 230
437 3300026142 Ga0207698_10105611 Ga0207698_101056113 230
438 3300027361 Ga0209489_100385 Ga0209489_10038558 230
439 3300027363 Ga0209700_100013 Ga0209700_10001331 230
440 3300027907 Ga0207428_10002205 Ga0207428_1000220514 230
441 3300028379 Ga0268266_10000670 Ga0268266_100006709 230
442 3300028379 Ga0268266_10026030 Ga0268266_100260303 230
443 3300028379 Ga0268266_10109961 Ga0268266_101099611 230
444 3300028381 Ga0268264_10118230 Ga0268264_101182302 230
445 3300028573 Ga0265334_10106273 Ga0265334_101062732 230
446 3300031235 Ga0265330_10004363 Ga0265330_100043633 230
447 3300031238 Ga0265332_10000106 Ga0265332_1000010641 230
448 3300031239 Ga0265328_10000333 Ga0265328_1000033316 230
449 3300031241 Ga0265325_10161933 Ga0265325_101619332 230
450 3300031242 Ga0265329_10004026 Ga0265329_100040264 230
451 3300031247 Ga0265340_10033578 Ga0265340_100335783 230
452 3300031247 Ga0265340_10042217 Ga0265340_100422172 230
453 3300031249 Ga0265339_10180646 Ga0265339_101806462 230
454 3300031250 Ga0265331_10000074 Ga0265331_1000007423 230
455 3300031250 Ga0265331_10011481 Ga0265331_100114815 230
456 3300031251 Ga0265327_10111438 Ga0265327_101114382 230
457 3300031344 Ga0265316_10000037 Ga0265316_1000003723 230
458 3300031595 Ga0265313_10002554 Ga0265313_100025549 230
459 3300031711 Ga0265314_10001545 Ga0265314_1000154519 230
460 3300031711 Ga0265314_10003230 Ga0265314_1000323016 230
461 3300031711 Ga0265314_10078333 Ga0265314_100783332 230
462 3300031712 Ga0265342_10000473 Ga0265342_1000047322 230
463 3300031731 Ga0307405_10093321 Ga0307405_100933213 230
464 3300031824 Ga0307413_10358918 Ga0307413_103589182 230
465 3300031903 Ga0307407_10536995 Ga0307407_105369951 230
466 3300031995 Ga0307409_100020254 Ga0307409_1000202545 230
467 3300032002 Ga0307416_100730541 Ga0307416_1007305412 230
468 3300032005 Ga0307411_10056323 Ga0307411_100563234 230
469 3300032126 Ga0307415_100016685 Ga0307415_1000166853 230
470 3300032126 Ga0307415_100136824 Ga0307415_1001368243 230
471 3300033180 Ga0307510_10037129 Ga0307510_100371295 230
472 3300033180 Ga0307510_10098175 Ga0307510_100981754 230
473 3300033442 Ga0315911_1000011 Ga0315911_1000011118 230
474 3300034820 Ga0373959_0028355 Ga0373959_0028355_281_979 230
475 3300035083 Ga0373926_0033752 Ga0373926_0033752_365_1063 230
476 3300035086 Ga0373934_0036665 Ga0373934_0036665_288_980 230
477 3300035090 Ga0373949_0004015 Ga0373949_0004015_653_1351 230
478 3300035091 Ga0373951_0003883 Ga0373951_0003883_468_1166 230
479 3300035092 Ga0373952_0009142 Ga0373952_0009142_684_1382 230
480 3300035112 Ga0373932_0004447 Ga0373932_0004447_2225_2923 230
481 3300035113 Ga0373936_0031239 Ga0373936_0031239_993_1685 230
482 3300035113 Ga0373936_0159721 Ga0373936_0159721_99_797 230
483 3300035114 Ga0373939_0001937 Ga0373939_0001937_2158_2856 230
484 3300035115 Ga0373941_0007347 Ga0373941_0007347_656_1354 230
485 3300035116 Ga0373945_0014672 Ga0373945_0014672_587_1279 230
486 3300035116 Ga0373945_0022918 Ga0373945_0022918_102_800 230
487 3300035118 Ga0373954_0041571 Ga0373954_0041571_598_1290 230
488 3300035118 Ga0373954_0062124 Ga0373954_0062124_76_834 230
489 3300035121 Ga0373960_0128651 Ga0373960_0128651_72_770 230
490 3300035170 Ga0373943_0021497 Ga0373943_0021497_61_759 230
491 3300035170 Ga0373943_0160679 Ga0373943_0160679_445_1146 230
492 3300035171 Ga0373946_0011011 Ga0373946_0011011_442_1140 230
493 3300035171 Ga0373946_0151310 Ga0373946_0151310_181_882 230
494 3300035172 Ga0373955_0017708 Ga0373955_0017708_313_1071 230
495 3300035172 Ga0373955_0063343 Ga0373955_0063343_1224_1916 230
496 3300035172 Ga0373955_0263014 Ga0373955_0263014_180_881 230
497 3300035242 Ga0373962_0005121 Ga0373962_0005121_538_1236 230
498 3300035691 Ga0373931_0017987 Ga0373931_0017987_1797_2495 230
499 3300035692 Ga0373935_0000359 Ga0373935_0000359_21763_22461 230
500 3300035692 Ga0373935_0015920 Ga0373935_0015920_2380_3072 230
501 3300035692 Ga0373935_0235732 Ga0373935_0235732_26_730 230
502 3300035692 Ga0373935_0539055 Ga0373935_0539055_132_833 230
503 3300035695 Ga0373927_0012622 Ga0373927_0012622_4442_5200 230
504 3300035695 Ga0373927_0042198 Ga0373927_0042198_1924_2622 230
505 3300035724 Ga0373933_0001892 Ga0373933_0001892_4401_5159 230
506 3300035724 Ga0373933_0568666 Ga0373933_0568666_10_702 230
507 3300035725 Ga0373947_0000490 Ga0373947_0000490_6095_6793 230
508 3300035725 Ga0373947_0014978 Ga0373947_0014978_398_1156 230
509 3300035725 Ga0373947_0063833 Ga0373947_0063833_1188_1880 230
510 3300035725 Ga0373947_0105860 Ga0373947_0105860_295_1086 230
511 3300036401 Ga0373937_0011820 Ga0373937_0011820_6777_7535 230
512 3300036401 Ga0373937_0113974 Ga0373937_0113974_72_764 230
513 3300036401 Ga0373937_0122815 Ga0373937_0122815_913_1611 230
514 3300036401 Ga0373937_0123962 Ga0373937_0123962_181_873 230
515 3300036459 Ga0372808_008576 Ga0372808_008576_307_999 230
516 3300037068 Ga0373925_0004226 Ga0373925_0004226_2630_3328 230
517 3300037068 Ga0373925_0064468 Ga0373925_0064468_1434_2192 230
518 3300037068 Ga0373925_0204720 Ga0373925_0204720_705_1406 230
519 3300037068 Ga0373925_0517504 Ga0373925_0517504_174_875 230
520 3300037418 Ga0395900_0006562 Ga0395900_0006562_7815_8507 230
521 3300037466 Ga0395898_0055110 Ga0395898_0055110_955_1647 230
522 3300037466 Ga0395898_0127296 Ga0395898_0127296_506_1255 230
523 3300038443 Ga0395901_0091033 Ga0395901_0091033_2314_3006 230
524 3300038443 Ga0395901_0226645 Ga0395901_0226645_1001_1750 230
525 3300039437 Ga0436365_1039646 Ga0436365_1039646_188_880 230
526 3300039437 Ga0436365_1540042 Ga0436365_1540042_4754_5491 230
527 3300039447 Ga0436361_0161816 Ga0436361_0161816_173_868 230
528 3300039447 Ga0436361_1082876 Ga0436361_1082876_1283_1978 230
529 3300039453 Ga0436362_0265151 Ga0436362_0265151_2085_2780 230
530 3300039453 Ga0436362_0443038 Ga0436362_0443038_38_730 230
531 3300041413 Ga0439465_0012372 Ga0439465_0012372_653_1345 230
532 3300041451 Ga0451791_1145985 Ga0451791_1145985_190_882 230
533 3300041507 Ga0451851_1218237 Ga0451851_1218237_26_721 230
534 3300044683 Ga0466965_0074731 Ga0466965_0074731_734_1429 230
535 3300044694 Ga0466963_0053342 Ga0466963_0053342_1660_2352 230
536 3300045976 Ga0466967_0018740 Ga0466967_0018740_2881_3573 230
537 3300045976 Ga0466967_0601992 Ga0466967_0601992_24_716 230
538 3300046454 Ga0495592_0165055 Ga0495592_0165055_202_894 230
539 3300046454 Ga0495592_0284011 Ga0495592_0284011_135_893 230
540 3300046455 Ga0495603_0010445 Ga0495603_0010445_1187_1885 230
541 3300046455 Ga0495603_0072989 Ga0495603_0072989_1176_1868 230
542 3300046455 Ga0495603_0078331 Ga0495603_0078331_146_847 230
543 3300046457 Ga0495590_0091811 Ga0495590_0091811_181_873 230
544 3300046459 Ga0495629_0000169 Ga0495629_0000169_13928_14626 230
545 3300046459 Ga0495629_0101680 Ga0495629_0101680_1096_1854 230
546 3300046459 Ga0495629_0382837 Ga0495629_0382837_138_839 230
547 3300046460 Ga0495638_0199033 Ga0495638_0199033_293_985 230
548 3300046461 Ga0495641_0028285 Ga0495641_0028285_1719_2417 230
549 3300046461 Ga0495641_0088227 Ga0495641_0088227_675_1376 230
550 3300046462 Ga0495651_0002891 Ga0495651_0002891_4140_4898 230
551 3300046462 Ga0495651_0056073 Ga0495651_0056073_181_873 230
552 3300046463 Ga0495653_0022577 Ga0495653_0022577_269_1027 230
553 3300046472 Ga0495580_0011387 Ga0495580_0011387_999_1691 230
554 3300046473 Ga0495582_0000501 Ga0495582_0000501_7578_8276 230
555 3300046473 Ga0495582_0089465 Ga0495582_0089465_341_1042 230
556 3300046473 Ga0495582_0417403 Ga0495582_0417403_32_730 230
557 3300046474 Ga0495605_0177650 Ga0495605_0177650_68_760 230
558 3300046475 Ga0495639_0027794 Ga0495639_0027794_1366_2058 230
559 3300046476 Ga0495662_0086996 Ga0495662_0086996_37_795 230
560 3300046477 Ga0495664_0015502 Ga0495664_0015502_1350_2108 230
561 3300046477 Ga0495664_0021658 Ga0495664_0021658_1891_2583 230
562 3300046477 Ga0495664_0228647 Ga0495664_0228647_216_908 230
563 3300046491 Ga0495584_0010790 Ga0495584_0010790_1747_2448 230
564 3300046492 Ga0495585_0027420 Ga0495585_0027420_1320_2021 230
565 3300046499 Ga0495594_0070183 Ga0495594_0070183_294_992 230
566 3300046511 Ga0495608_0223573 Ga0495608_0223573_201_893 230
567 3300046512 Ga0495610_0190666 Ga0495610_0190666_92_787 230
568 3300046513 Ga0495616_0202560 Ga0495616_0202560_35_727 230
569 3300046514 Ga0495618_0004599 Ga0495618_0004599_6745_7503 230
570 3300046514 Ga0495618_0009970 Ga0495618_0009970_1206_1898 230
571 3300046514 Ga0495618_0077440 Ga0495618_0077440_239_940 230
572 3300046516 Ga0495628_0128569 Ga0495628_0128569_327_1085 230
573 3300046516 Ga0495628_0135778 Ga0495628_0135778_517_1209 230
574 3300046517 Ga0495630_0255414 Ga0495630_0255414_337_1095 230
575 3300046517 Ga0495630_0259225 Ga0495630_0259225_419_1120 230
576 3300046529 Ga0495652_0066385 Ga0495652_0066385_1544_2302 230
577 3300046531 Ga0495665_0040425 Ga0495665_0040425_1306_1998 230
578 3300046531 Ga0495665_0068113 Ga0495665_0068113_120_878 230
579 3300046533 Ga0495640_0007530 Ga0495640_0007530_4479_5270 230
580 3300046533 Ga0495640_0022380 Ga0495640_0022380_990_1748 230
581 3300046533 Ga0495640_0024977 Ga0495640_0024977_1400_2092 230
582 3300046536 Ga0495587_0000396 Ga0495587_0000396_25065_25823 230
583 3300046543 Ga0495645_0106082 Ga0495645_0106082_246_1004 230
584 3300046557 Ga0495622_0020201 Ga0495622_0020201_1066_1758 230
585 3300046557 Ga0495622_0041478 Ga0495622_0041478_119_811 230
586 3300046557 Ga0495622_0091622 Ga0495622_0091622_361_1059 230
587 3300046557 Ga0495622_0168477 Ga0495622_0168477_186_878 230
588 3300046559 Ga0495667_0013334 Ga0495667_0013334_1183_1941 230
589 3300046559 Ga0495667_0027673 Ga0495667_0027673_1332_2024 230
590 3300046615 Ga0495656_0025225 Ga0495656_0025225_1279_1980 230
591 3300046616 Ga0495668_0241899 Ga0495668_0241899_115_807 230
592 3300046642 Ga0495634_0033866 Ga0495634_0033866_610_1368 230
593 3300046642 Ga0495634_0079328 Ga0495634_0079328_186_887 230
594 3300046663 Ga0495635_0012411 Ga0495635_0012411_2348_3040 230
595 3300046663 Ga0495635_0015552 Ga0495635_0015552_2135_2893 230
596 3300046663 Ga0495635_0108705 Ga0495635_0108705_118_810 230
597 3300046675 Ga0495657_0023962 Ga0495657_0023962_1276_2034 230
598 3300046675 Ga0495657_0130826 Ga0495657_0130826_734_1426 230
599 3300046678 Ga0495599_0037602 Ga0495599_0037602_28_786 230
600 3300046678 Ga0495599_0105775 Ga0495599_0105775_918_1610 230
601 3300046679 Ga0495623_0004013 Ga0495623_0004013_5177_5935 230
602 3300046679 Ga0495623_0054972 Ga0495623_0054972_1798_2493 230
603 3300046680 Ga0495646_0039725 Ga0495646_0039725_131_889 230
604 3300046683 Ga0495658_0001748 Ga0495658_0001748_5136_5834 230
605 3300046683 Ga0495658_0041125 Ga0495658_0041125_786_1487 230
606 3300046683 Ga0495658_0164366 Ga0495658_0164366_411_1103 230
607 3300046689 Ga0495613_0033167 Ga0495613_0033167_1753_2451 230
608 3300046689 Ga0495613_0136671 Ga0495613_0136671_270_971 230
609 3300046689 Ga0495613_0222069 Ga0495613_0222069_531_1223 230
610 3300046690 Ga0495624_0108776 Ga0495624_0108776_978_1670 230
611 3300046690 Ga0495624_0329531 Ga0495624_0329531_96_797 230
612 3300046809 Ga0495600_0004521 Ga0495600_0004521_1504_2262 230
613 3300047315 Ga0495581_0022126 Ga0495581_0022126_2287_2979 230
614 3300047315 Ga0495581_0070608 Ga0495581_0070608_509_1207 230
615 3300047315 Ga0495581_0075949 Ga0495581_0075949_203_961 230
616 3300047317 Ga0495604_0006104 Ga0495604_0006104_6380_7138 230
617 3300047317 Ga0495604_0115230 Ga0495604_0115230_933_1625 230
618 3300047319 Ga0495674_0000860 Ga0495674_0000860_22504_23262 230
619 3300047319 Ga0495674_0018990 Ga0495674_0018990_1967_2659 230
620 3300047319 Ga0495674_0062241 Ga0495674_0062241_1499_2290 230
621 3300047320 Ga0495672_0087168 Ga0495672_0087168_127_819 230
622 3300047320 Ga0495672_0173842 Ga0495672_0173842_316_1008 230
623 3300047320 Ga0495672_0194228 Ga0495672_0194228_154_846 230
624 3300047321 Ga0495676_0040825 Ga0495676_0040825_36_728 230
625 3300047321 Ga0495676_0289593 Ga0495676_0289593_303_1004 230
626 3300047321 Ga0495676_0301533 Ga0495676_0301533_198_956 230
627 3300047322 Ga0495680_0008674 Ga0495680_0008674_6409_7167 230
628 3300047322 Ga0495680_0057823 Ga0495680_0057823_607_1305 230
629 3300047444 Ga0495675_0035181 Ga0495675_0035181_1035_1793 230
630 3300047446 Ga0495679_077690 Ga0495679_077690_103_804 230
631 3300047471 Ga0495684_0011622 Ga0495684_0011622_4034_4792 230
632 3300047471 Ga0495684_0024897 Ga0495684_0024897_3743_4435 230
633 3300047472 Ga0495686_0110474 Ga0495686_0110474_246_938 230
634 3300047472 Ga0495686_0129427 Ga0495686_0129427_411_1130 230
635 3300047673 Ga0495593_0042881 Ga0495593_0042881_586_1278 230
636 3300047673 Ga0495593_0061530 Ga0495593_0061530_462_1160 230
637 3300048088 Ga0495602_0015443 Ga0495602_0015443_1160_1918 230
638 3300048903 Ga0496100_0056160 Ga0496100_0056160_423_1115 230
639 3300048903 Ga0496100_0203112 Ga0496100_0203112_150_848 230
640 3300048904 Ga0496101_0007208 Ga0496101_0007208_4749_5450 230
641 3300048904 Ga0496101_0162974 Ga0496101_0162974_324_1082 230
642 3300048905 Ga0496102_0152736 Ga0496102_0152736_921_1625 230
643 3300048905 Ga0496102_0409370 Ga0496102_0409370_483_1184 230
644 3300048906 Ga0496103_0089496 Ga0496103_0089496_836_1534 230
645 3300048907 Ga0496104_0000069 Ga0496104_0000069_11433_12149 230
646 3300048907 Ga0496104_0001421 Ga0496104_0001421_19726_20484 230
647 3300048907 Ga0496104_0005194 Ga0496104_0005194_9023_9715 230
648 3300048907 Ga0496104_0333963 Ga0496104_0333963_257_955 230
649 3300048907 Ga0496104_0352896 Ga0496104_0352896_37_738 230
650 3300048907 Ga0496104_0369104 Ga0496104_0369104_591_1283 230
651 3300048907 Ga0496104_0375570 Ga0496104_0375570_282_974 230
652 3300048908 Ga0496105_0000062 Ga0496105_0000062_1478_2194 230
653 3300048908 Ga0496105_0006775 Ga0496105_0006775_240_998 230
654 3300048908 Ga0496105_0060429 Ga0496105_0060429_2368_3060 230
655 3300048908 Ga0496105_0071969 Ga0496105_0071969_484_1185 230
656 3300048908 Ga0496105_0075153 Ga0496105_0075153_1672_2382 230
657 3300048908 Ga0496105_0316595 Ga0496105_0316595_260_976 230
658 3300048909 Ga0496106_0002088 Ga0496106_0002088_3183_3875 230
659 3300048909 Ga0496106_0025435 Ga0496106_0025435_1920_2621 230
660 3300048909 Ga0496106_0072788 Ga0496106_0072788_881_1579 230
661 3300048909 Ga0496106_0105469 Ga0496106_0105469_292_999 230
662 3300048909 Ga0496106_0114497 Ga0496106_0114497_1348_2055 230
663 3300048909 Ga0496106_0236097 Ga0496106_0236097_463_1173 230
664 3300048910 Ga0496107_0004186 Ga0496107_0004186_4209_4901 230
665 3300048910 Ga0496107_0004453 Ga0496107_0004453_403_1104 230
666 3300048911 Ga0496108_0001075 Ga0496108_0001075_16453_17145 230
667 3300048911 Ga0496108_0014318 Ga0496108_0014318_416_1174 230
668 3300048911 Ga0496108_0173761 Ga0496108_0173761_759_1457 230
669 3300048912 Ga0496109_0002544 Ga0496109_0002544_4431_5123 230
670 3300048912 Ga0496109_0196000 Ga0496109_0196000_366_1064 230
671 3300048912 Ga0496109_0310379 Ga0496109_0310379_137_829 230
672 3300048912 Ga0496109_0364960 Ga0496109_0364960_535_1227 230
673 3300048913 Ga0496110_0026785 Ga0496110_0026785_295_1053 230
674 3300048913 Ga0496110_0135186 Ga0496110_0135186_1476_2168 230
675 3300048913 Ga0496110_0355967 Ga0496110_0355967_407_1099 230
676 3300048913 Ga0496110_0623592 Ga0496110_0623592_115_855 230
677 3300048914 Ga0496111_0055575 Ga0496111_0055575_1194_1952 230
678 3300048914 Ga0496111_0282636 Ga0496111_0282636_419_1120 230
679 3300048915 Ga0496112_0003616 Ga0496112_0003616_5704_6396 230
680 3300048915 Ga0496112_0040721 Ga0496112_0040721_495_1196 230
681 3300048915 Ga0496112_0078923 Ga0496112_0078923_1458_2198 230
682 3300048915 Ga0496112_0168277 Ga0496112_0168277_1214_1912 230
683 3300048915 Ga0496112_0177789 Ga0496112_0177789_534_1292 230
684 3300048915 Ga0496112_0257938 Ga0496112_0257938_42_749 230
685 3300048915 Ga0496112_0788288 Ga0496112_0788288_36_737 230
686 3300048916 Ga0496113_0000949 Ga0496113_0000949_7952_8710 230
687 3300048916 Ga0496113_0020463 Ga0496113_0020463_2847_3539 230
688 3300048916 Ga0496113_0075829 Ga0496113_0075829_470_1171 230
689 3300048916 Ga0496113_0243344 Ga0496113_0243344_284_982 230
690 3300048917 Ga0496114_0026910 Ga0496114_0026910_422_1138 230
691 3300048917 Ga0496114_0111821 Ga0496114_0111821_1535_2236 230
692 3300048917 Ga0496114_0206816 Ga0496114_0206816_540_1232 230
693 3300048917 Ga0496114_0435070 Ga0496114_0435070_422_1114 230
694 3300048918 Ga0496115_0018802 Ga0496115_0018802_2318_3019 230
695 3300048918 Ga0496115_0043919 Ga0496115_0043919_2315_3031 230
696 3300048918 Ga0496115_0064899 Ga0496115_0064899_1889_2605 230
697 3300048918 Ga0496115_0111816 Ga0496115_0111816_1078_1770 230
698 3300048918 Ga0496115_0229266 Ga0496115_0229266_621_1313 230
699 3300048918 Ga0496115_0270767 Ga0496115_0270767_428_1144 230
700 3300048918 Ga0496115_0378098 Ga0496115_0378098_365_1057 230
701 3300048921 Ga0496118_0030366 Ga0496118_0030366_2026_2721 230
702 3300048922 Ga0496119_0012629 Ga0496119_0012629_6022_6714 230
703 3300048923 Ga0496120_0030873 Ga0496120_0030873_125_817 230
704 3300048924 Ga0496121_0039412 Ga0496121_0039412_2428_3123 230
705 3300048924 Ga0496121_0059965 Ga0496121_0059965_2076_2768 230
706 3300048927 Ga0496124_0057877 Ga0496124_0057877_1482_2174 230
707 3300048928 Ga0496125_0051128 Ga0496125_0051128_1838_2533 230
708 3300048929 Ga0496126_0007749 Ga0496126_0007749_1962_2660 230
709 3300048929 Ga0496126_0047853 Ga0496126_0047853_3083_3775 230
710 3300048929 Ga0496126_0065391 Ga0496126_0065391_2425_3117 230
711 3300048929 Ga0496126_0088727 Ga0496126_0088727_1854_2546 230
712 3300048929 Ga0496126_0089186 Ga0496126_0089186_976_1671 230
713 3300048929 Ga0496126_0218791 Ga0496126_0218791_52_744 230
714 3300049571 Ga0501034_0313442 Ga0501034_0313442_734_1432 230
715 3300049582 Ga0501048_0000115 Ga0501048_0000115_24020_24718 230
716 3300049585 Ga0501069_0135581 Ga0501069_0135581_137_829 230
717 3300050489 nmdc:mga03683_24331_c2 nmdc:mga03683_24331_c2_646_1350 230
718 3300050491 nmdc:mga00v17_133351_c1 nmdc:mga00v17_133351_c1_297_989 230
719 3300050491 nmdc:mga00v17_30266_c1 nmdc:mga00v17_30266_c1_846_1550 230
720 3300050491 nmdc:mga00v17_32317_c1 nmdc:mga00v17_32317_c1_1716_2411 230
721 3300050491 nmdc:mga00v17_325276_c1 nmdc:mga00v17_325276_c1_88_783 230
722 3300050492 nmdc:mga0yw44_11952_c1 nmdc:mga0yw44_11952_c1_850_1545 230
723 3300050492 nmdc:mga0yw44_126266_c1 nmdc:mga0yw44_126266_c1_783_1475 230
724 3300050492 nmdc:mga0yw44_34727_c1 nmdc:mga0yw44_34727_c1_1557_2261 230
725 3300050492 nmdc:mga0yw44_9567_c1 nmdc:mga0yw44_9567_c1_2805_3500 230
726 3300050493 nmdc:mga0k408_139207_c1 nmdc:mga0k408_139207_c1_384_1085 230
727 3300050494 nmdc:mga06z11_23452_c1 nmdc:mga06z11_23452_c1_1350_2042 230
728 3300050494 nmdc:mga06z11_59498_c1 nmdc:mga06z11_59498_c1_368_1060 230
729 3300050496 nmdc:mga07m45_5386_c1 nmdc:mga07m45_5386_c1_59_751 230
730 3300050507 nmdc:mga05p37_124_c1 nmdc:mga05p37_124_c1_31703_32395 230
731 3300050507 nmdc:mga05p37_333562_c1 nmdc:mga05p37_333562_c1_1041_1736 230
732 3300050508 nmdc:mga09592_547888_c1 nmdc:mga09592_547888_c1_222_935 230
733 3300050508 nmdc:mga09592_5518_c1 nmdc:mga09592_5518_c1_5410_6102 230
734 3300050509 nmdc:mga0qj67_16363_c1 nmdc:mga0qj67_16363_c1_4336_5028 230
735 3300050509 nmdc:mga0qj67_316236_c1 nmdc:mga0qj67_316236_c1_16_720 230
736 3300050509 nmdc:mga0qj67_3618_c1 nmdc:mga0qj67_3618_c1_430_1131 230
737 3300050510 nmdc:mga06r32_145140_c1 nmdc:mga06r32_145140_c1_552_1247 230
738 3300050510 nmdc:mga06r32_847_c1 nmdc:mga06r32_847_c1_7159_7851 230
739 3300050511 nmdc:mga08y16_2124_c1 nmdc:mga08y16_2124_c1_13330_14022 230
740 3300050511 nmdc:mga08y16_233220_c1 nmdc:mga08y16_233220_c1_1050_1751 230
741 3300050511 nmdc:mga08y16_238003_c1 nmdc:mga08y16_238003_c1_821_1513 230
742 3300050512 nmdc:mga0n895_18346_c1 nmdc:mga0n895_18346_c1_5384_6085 230
743 3300050512 nmdc:mga0n895_426935_c1 nmdc:mga0n895_426935_c1_131_838 230
744 3300050512 nmdc:mga0n895_45308_c1 nmdc:mga0n895_45308_c1_437_1132 230
745 3300050512 nmdc:mga0n895_56526_c1 nmdc:mga0n895_56526_c1_1810_2508 230
746 3300050512 nmdc:mga0n895_790415_c1 nmdc:mga0n895_790415_c1_202_912 230
747 3300050513 nmdc:mga0rr50_353686_c1 nmdc:mga0rr50_353686_c1_441_1136 230
748 3300050513 nmdc:mga0rr50_678961_c1 nmdc:mga0rr50_678961_c1_10_711 230
749 3300050513 nmdc:mga0rr50_73213_c1 nmdc:mga0rr50_73213_c1_1567_2265 230
750 3300050514 nmdc:mga08x19_206289_c1 nmdc:mga08x19_206289_c1_487_1182 230
751 3300050514 nmdc:mga08x19_23380_c1 nmdc:mga08x19_23380_c1_415_1128 230
752 3300050515 nmdc:mga0a205_154174_c1 nmdc:mga0a205_154174_c1_374_1075 230
753 3300050515 nmdc:mga0a205_469041_c1 nmdc:mga0a205_469041_c1_275_985 230
754 3300050515 nmdc:mga0a205_543441_c1 nmdc:mga0a205_543441_c1_39_737 230
755 3300050515 nmdc:mga0a205_97632_c1 nmdc:mga0a205_97632_c1_833_1528 230
756 3300050516 nmdc:mga0sz30_98102_c1 nmdc:mga0sz30_98102_c1_497_1198 230
757 3300053077 Ga0495601_0010338 Ga0495601_0010338_2797_3555 230
758 3300053077 Ga0495601_0060130 Ga0495601_0060130_715_1506 230
759 3300053077 Ga0495601_0195387 Ga0495601_0195387_327_1019 230
760 3300053078 Ga0495612_0021763 Ga0495612_0021763_1014_1772 230
761 3300053085 Ga0495619_0001572 Ga0495619_0001572_5942_6640 230
762 3300053085 Ga0495619_0006981 Ga0495619_0006981_5526_6284 230
763 3300053085 Ga0495619_0027144 Ga0495619_0027144_1831_2532 230
764 3300053085 Ga0495619_0200622 Ga0495619_0200622_392_1084 230
765 3300053096 Ga0500641_0001698 Ga0500641_0001698_6897_7589 230
766 3300053119 Ga0500595_000941 Ga0500595_000941_9467_10165 230
767 3300053119 Ga0500595_006818 Ga0500595_006818_40_768 230
768 3300053119 Ga0500595_019376 Ga0500595_019376_454_1149 230
769 3300053119 Ga0500595_052847 Ga0500595_052847_389_1081 230
770 3300053121 Ga0500607_050885 Ga0500607_050885_201_911 230
771 3300053122 Ga0500608_197859 Ga0500608_197859_42_740 230
772 3300053136 Ga0500559_0002260 Ga0500559_0002260_5682_6392 230
773 3300053145 Ga0500586_016591 Ga0500586_016591_875_1585 230
774 3300053150 Ga0500603_001309 Ga0500603_001309_3530_4222 230
775 3300053150 Ga0500603_026355 Ga0500603_026355_74_766 230
776 3300053153 Ga0500616_0027152 Ga0500616_0027152_2085_2786 230
777 3300053153 Ga0500616_0034208 Ga0500616_0034208_1459_2157 230
778 3300053155 Ga0500620_063141 Ga0500620_063141_82_777 230
779 3300053162 Ga0500638_000054 Ga0500638_000054_16937_17635 230
780 3300053178 Ga0500637_0000775 Ga0500637_0000775_128_826 230
781 3300053178 Ga0500637_0013609 Ga0500637_0013609_1218_1910 230
782 3300055283 Ga0500661_000301 Ga0500661_000301_7019_7717 230
783 3300061734 Ga0530510_0292637 Ga0530510_0292637_225_917 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17171

GST_C_6

Glutathione S-transferase, C-terminal domain

162

224

0.96

PF17172

GST_N_4

Glutathione S-transferase N-terminal domain

19

114

0.96

PF10568

Tom37

Outer mitochondrial membrane transport complex protein

20

127

0.88

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

18

77

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w66-assembly1.cif.gz_B crystal structure of glutathione s-transferase domain protein from haliangium ochraceum dsm 14365 0.7678 2 224
4iel-assembly1.cif.gz_A-2 crystal structure of a glutathione s-transferase family protein from burkholderia ambifaria, target efi-507141, with bound glutathione 0.7565 1 227
5djm-assembly1.cif.gz_B structure of wt human glutathione transferase in complex with cisplatin in the absence of glutathione. 0.7544 1 227
3zmk-assembly1.cif.gz_C anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa 0.7543 1 223
4jed-assembly1.cif.gz_A-2 crystal structure of glutathione s-transferase mrad2831_1084 (target efi-507060) from methylobacterium radiotolerans jcm 2831, complex with glutathione sulfonate 0.7533 2 229
ID Description Score Start End Superfamily
af_Q4D4W9_85_180_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.964 22 98 3.40.30.10
af_Q95RI5_238_344_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9266 135 225 1.20.1050.10
af_G5EDZ7_45_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9229 1 98 3.40.30.10
af_E9QGX6_115_210_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8952 19 111 3.40.30.10
af_Q9NA74_166_268_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.8882 148 226 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A6P1R2W7-F1-model_v4 Glutathione S-transferase family protein 0.9991 1 229 GO:0016740
AF-A0A850IMW0-F1-model_v4 Glutathione S-transferase family protein 0.9976 1 230
AF-A0A841A5U8-F1-model_v4 deleted 0.9948 1 228
AF-A0A562L9H8-F1-model_v4 Glutathione S-transferase-like protein 0.9917 1 198 GO:0016740
AF-A0A6P1R2W7-F1-model_v4 Glutathione S-transferase family protein 0.9904 1 229 GO:0016740

Feature Viewer

pLDDT pTM Quality
96.74 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map