F480652
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 783 | 447 | 680 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10032257|Ga0081538_100322573 |
| Length | 268 |
| Sequence | MLTLYSYPELFGVADNNGYGLKVFAFLRLAGVAFRHEHIFDAASAPRGQLPYIVDDGETIGDSDTIIAHLIAKYRLTIDAKLTGAERDTDHLITRMLDDLYWVMSYSRWKDERFWPLFRDALMRTHPSLTPEGLDKAREYNAQRYYFQGIGRYAPDAAYRRGVKDLQVLADLVPASDYLHGETPTSIDAGIYGFIANIHFYDIDTPLKQFVSSHANLVRHCNAIHAAVTAPPQFLDRGYPRGVFLYIAACALVAIATVAFGMSGRRTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 10 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 11 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 12 | 2791355199 | |||
| 13 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 14 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 15 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 16 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 17 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 18 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 19 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 20 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 21 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 22 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 23 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 24 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 25 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 26 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 27 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 28 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 29 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 30 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 31 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 32 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 33 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 34 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 35 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 36 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 37 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 38 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 39 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 40 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 41 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 42 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 43 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 44 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 45 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 46 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 47 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 48 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 49 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 50 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 51 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 52 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 53 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 54 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 55 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 56 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 57 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 58 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 59 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 60 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 61 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 62 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 63 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 64 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 65 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 66 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 67 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 68 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 69 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 70 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 71 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 72 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 73 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 74 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 75 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 76 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 77 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 78 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 79 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 80 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 81 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 82 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 83 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 84 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 90 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 93 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 116 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 118 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 120 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 123 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 125 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 126 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 127 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 128 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 129 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 130 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 131 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 132 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 133 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 134 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 135 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 136 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 137 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 138 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 139 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 140 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 142 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 143 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 144 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 145 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 146 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 149 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 150 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 151 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 152 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 154 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 155 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 156 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 157 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 158 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 159 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 160 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 161 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 162 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 164 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 189 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 190 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 191 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 192 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 193 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 194 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 195 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 245 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 247 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 251 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 253 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 254 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 256 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 257 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 258 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 259 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 260 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 261 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 262 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 263 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 265 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 266 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 269 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 270 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 271 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 274 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 275 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 276 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 278 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 281 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 289 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 290 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 292 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 293 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 294 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 296 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 297 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 298 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 299 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 300 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 301 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 302 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 303 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 304 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 305 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 307 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 308 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 309 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 310 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 385 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 386 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 387 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 388 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 389 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 390 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 391 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 416 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 417 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 418 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 419 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 420 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 421 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 422 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 423 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 425 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 426 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 427 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 428 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 429 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 430 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 431 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 432 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 433 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 434 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 435 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 436 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 437 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 438 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 439 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 440 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 441 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 442 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 443 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 444 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 445 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 446 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 447 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.83 |
| Metatranscriptomes | 0.13 |
| Isolates | 13.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.9 |
| Nodule | 11.37 |
| Rhizoplane | 8.3 |
| Rhizosphere | 67.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10028247 | 3300003320 | Bacteria | 1450 |
| 2 | JGI25404J52841_10027507 | 3300003659 | Bacteria | 1223 |
| 3 | Ga0065707_10305448 | 3300005295 | Bacteria | 995 |
| 4 | Ga0070658_10200690 | 3300005327 | Bacteria | 1683 |
| 5 | Ga0070683_100146343 | 3300005329 | Bacteria | 2239 |
| 6 | Ga0070683_100656872 | 3300005329 | Bacteria | 1004 |
| 7 | Ga0070670_100002724 | 3300005331 | Bacteria | 14600 |
| 8 | Ga0070670_100275170 | 3300005331 | Bacteria | 1469 |
| 9 | Ga0068869_100040507 | 3300005334 | Bacteria | 3331 |
| 10 | Ga0070680_100451117 | 3300005336 | Bacteria | 1098 |
| 11 | Ga0070682_100012744 | 3300005337 | Bacteria | 4826 |
| 12 | Ga0070682_100266355 | 3300005337 | Bacteria | 1243 |
| 13 | Ga0070682_100408638 | 3300005337 | Bacteria | 1029 |
| 14 | Ga0068868_100143996 | 3300005338 | Bacteria | 1959 |
| 15 | Ga0070660_100130480 | 3300005339 | Bacteria | 2011 |
| 16 | Ga0070689_100058900 | 3300005340 | Bacteria | 2984 |
| 17 | Ga0070691_10080048 | 3300005341 | Bacteria | 1598 |
| 18 | Ga0070691_10091580 | 3300005341 | Bacteria | 1500 |
| 19 | Ga0070668_100045408 | 3300005347 | Bacteria | 3370 |
| 20 | Ga0070668_100102316 | 3300005347 | Bacteria | 2271 |
| 21 | Ga0070668_100115575 | 3300005347 | Bacteria | 2139 |
| 22 | Ga0070671_100001622 | 3300005355 | Bacteria | 16950 |
| 23 | Ga0070671_100264152 | 3300005355 | Bacteria | 1463 |
| 24 | Ga0070673_100044017 | 3300005364 | Bacteria | 3454 |
| 25 | Ga0070667_100392065 | 3300005367 | Bacteria | 1263 |
| 26 | Ga0070667_100645944 | 3300005367 | Bacteria | 977 |
| 27 | Ga0070709_10073029 | 3300005434 | Bacteria | 2220 |
| 28 | Ga0070709_10164477 | 3300005434 | Bacteria | 1545 |
| 29 | Ga0070714_100063519 | 3300005435 | Bacteria | 3176 |
| 30 | Ga0070713_100039420 | 3300005436 | Bacteria | 3834 |
| 31 | Ga0070713_100064482 | 3300005436 | Bacteria | 3075 |
| 32 | Ga0070713_100093832 | 3300005436 | Bacteria | 2586 |
| 33 | Ga0070713_100934834 | 3300005436 | Bacteria | 835 |
| 34 | Ga0070710_10017367 | 3300005437 | Bacteria | 3680 |
| 35 | Ga0070710_10035714 | 3300005437 | Bacteria | 2712 |
| 36 | Ga0070710_10039921 | 3300005437 | Bacteria | 2584 |
| 37 | Ga0070710_10380793 | 3300005437 | Bacteria | 941 |
| 38 | Ga0070701_10239926 | 3300005438 | Bacteria | 1090 |
| 39 | Ga0070711_100010047 | 3300005439 | Bacteria | 5844 |
| 40 | Ga0070711_100029291 | 3300005439 | Bacteria | 3632 |
| 41 | Ga0070711_100404802 | 3300005439 | Bacteria | 1108 |
| 42 | Ga0070708_100335683 | 3300005445 | Bacteria | 1424 |
| 43 | Ga0070663_100017934 | 3300005455 | Bacteria | 4629 |
| 44 | Ga0070663_100063699 | 3300005455 | Bacteria | 2663 |
| 45 | Ga0070663_100087030 | 3300005455 | Bacteria | 2308 |
| 46 | Ga0070678_100056739 | 3300005456 | Bacteria | 2866 |
| 47 | Ga0070678_100237225 | 3300005456 | Bacteria | 1523 |
| 48 | Ga0070662_100195506 | 3300005457 | Bacteria | 1602 |
| 49 | Ga0070681_10008226 | 3300005458 | Bacteria | 10206 |
| 50 | Ga0070681_10056108 | 3300005458 | Bacteria | 3921 |
| 51 | Ga0070681_10157638 | 3300005458 | Bacteria | 2194 |
| 52 | Ga0070681_10162326 | 3300005458 | Bacteria | 2159 |
| 53 | Ga0070706_100035478 | 3300005467 | Bacteria | 4606 |
| 54 | Ga0070698_100105128 | 3300005471 | Bacteria | 2793 |
| 55 | Ga0070699_100004291 | 3300005518 | Bacteria | 12600 |
| 56 | Ga0070679_100023223 | 3300005530 | Bacteria | 6069 |
| 57 | Ga0070679_100039928 | 3300005530 | Bacteria | 4666 |
| 58 | Ga0070679_100213053 | 3300005530 | Bacteria | 1895 |
| 59 | Ga0070684_100758929 | 3300005535 | Bacteria | 906 |
| 60 | Ga0070697_100040568 | 3300005536 | Bacteria | 3767 |
| 61 | Ga0068853_100179252 | 3300005539 | Bacteria | 1921 |
| 62 | Ga0070672_100306571 | 3300005543 | Bacteria | 1347 |
| 63 | Ga0070686_100099082 | 3300005544 | Bacteria | 1966 |
| 64 | Ga0070693_100130027 | 3300005547 | Bacteria | 1573 |
| 65 | Ga0070693_100170425 | 3300005547 | Bacteria | 1394 |
| 66 | Ga0070693_100178127 | 3300005547 | Bacteria | 1367 |
| 67 | Ga0070665_100005813 | 3300005548 | Bacteria | 12652 |
| 68 | Ga0070665_100152404 | 3300005548 | Bacteria | 2314 |
| 69 | Ga0068855_100132560 | 3300005563 | Bacteria | 2845 |
| 70 | Ga0068855_101256767 | 3300005563 | Bacteria | 768 |
| 71 | Ga0070664_100743647 | 3300005564 | Bacteria | 915 |
| 72 | Ga0068857_100031867 | 3300005577 | Bacteria | 4658 |
| 73 | Ga0068854_100185586 | 3300005578 | Bacteria | 1627 |
| 74 | Ga0068856_100607371 | 3300005614 | Bacteria | 1115 |
| 75 | Ga0068856_100848407 | 3300005614 | Bacteria | 933 |
| 76 | Ga0068852_100180838 | 3300005616 | Bacteria | 1983 |
| 77 | Ga0068852_100621572 | 3300005616 | Bacteria | 1086 |
| 78 | Ga0068859_100124845 | 3300005617 | Bacteria | 2642 |
| 79 | Ga0068864_100526009 | 3300005618 | Bacteria | 1141 |
| 80 | Ga0068866_10066524 | 3300005718 | Bacteria | 1889 |
| 81 | Ga0068861_100223271 | 3300005719 | Bacteria | 1593 |
| 82 | Ga0068863_100321751 | 3300005841 | Bacteria | 1502 |
| 83 | Ga0068858_100224480 | 3300005842 | Bacteria | 1780 |
| 84 | Ga0068860_100193494 | 3300005843 | Bacteria | 1969 |
| 85 | Ga0068862_100131061 | 3300005844 | Bacteria | 2217 |
| 86 | Ga0081455_10000227 | 3300005937 | Bacteria | 72665 |
| 87 | Ga0081455_10002386 | 3300005937 | Bacteria | 22424 |
| 88 | Ga0081455_10007051 | 3300005937 | Bacteria | 11930 |
| 89 | Ga0081455_10014446 | 3300005937 | Bacteria | 7737 |
| 90 | Ga0081455_10019827 | 3300005937 | Bacteria | 6351 |
| 91 | Ga0081455_10043015 | 3300005937 | Bacteria | 3957 |
| 92 | Ga0081538_10032257 | 3300005981 | Bacteria | 3514 |
| 93 | Ga0081540_1000099 | 3300005983 | Bacteria | 91686 |
| 94 | Ga0081540_1002490 | 3300005983 | Bacteria | 14987 |
| 95 | Ga0081540_1042412 | 3300005983 | Bacteria | 2347 |
| 96 | Ga0081540_1044297 | 3300005983 | Bacteria | 2273 |
| 97 | Ga0081540_1059942 | 3300005983 | Bacteria | 1824 |
| 98 | Ga0081540_1080010 | 3300005983 | Bacteria | 1475 |
| 99 | Ga0081540_1138740 | 3300005983 | Bacteria | 980 |
| 100 | Ga0081539_10025006 | 3300005985 | Bacteria | 3858 |
| 101 | Ga0070717_10000895 | 3300006028 | Bacteria | 19768 |
| 102 | Ga0070717_10008142 | 3300006028 | Bacteria | 7824 |
| 103 | Ga0070717_10042605 | 3300006028 | Bacteria | 3703 |
| 104 | Ga0070717_10058356 | 3300006028 | Bacteria | 3191 |
| 105 | Ga0070717_10063182 | 3300006028 | Bacteria | 3072 |
| 106 | Ga0070717_10069176 | 3300006028 | Bacteria | 2939 |
| 107 | Ga0070717_10114897 | 3300006028 | Bacteria | 2300 |
| 108 | Ga0070717_10147787 | 3300006028 | Bacteria | 2031 |
| 109 | Ga0070717_10163763 | 3300006028 | Bacteria | 1931 |
| 110 | Ga0075365_10026360 | 3300006038 | Bacteria | 3689 |
| 111 | Ga0075365_10028679 | 3300006038 | Bacteria | 3551 |
| 112 | Ga0075365_10099836 | 3300006038 | Bacteria | 1987 |
| 113 | Ga0075365_10278175 | 3300006038 | Bacteria | 1177 |
| 114 | Ga0075368_10042960 | 3300006042 | Bacteria | 1780 |
| 115 | Ga0075363_100126406 | 3300006048 | Bacteria | 1432 |
| 116 | Ga0075363_100309072 | 3300006048 | Bacteria | 918 |
| 117 | Ga0075364_10040862 | 3300006051 | Bacteria | 3009 |
| 118 | Ga0075364_10087071 | 3300006051 | Bacteria | 2070 |
| 119 | Ga0070715_10130893 | 3300006163 | Bacteria | 1207 |
| 120 | Ga0070715_10163309 | 3300006163 | Bacteria | 1102 |
| 121 | Ga0070715_10273906 | 3300006163 | Bacteria | 892 |
| 122 | Ga0070716_100184947 | 3300006173 | Bacteria | 1371 |
| 123 | Ga0070716_100432576 | 3300006173 | Bacteria | 955 |
| 124 | Ga0070712_100147218 | 3300006175 | Bacteria | 1804 |
| 125 | Ga0070712_100164924 | 3300006175 | Bacteria | 1714 |
| 126 | Ga0070712_100326682 | 3300006175 | Bacteria | 1249 |
| 127 | Ga0075362_10191814 | 3300006177 | Bacteria | 993 |
| 128 | Ga0075367_10010099 | 3300006178 | Bacteria | 4950 |
| 129 | Ga0075367_10013716 | 3300006178 | Bacteria | 4367 |
| 130 | Ga0075367_10451172 | 3300006178 | Bacteria | 815 |
| 131 | Ga0075369_10151354 | 3300006186 | Bacteria | 1061 |
| 132 | Ga0075366_10125556 | 3300006195 | Bacteria | 1547 |
| 133 | Ga0097621_100458819 | 3300006237 | Bacteria | 1149 |
| 134 | Ga0097621_100747993 | 3300006237 | Bacteria | 903 |
| 135 | Ga0075370_10005125 | 3300006353 | Bacteria | 6462 |
| 136 | Ga0075370_10010731 | 3300006353 | Bacteria | 4802 |
| 137 | Ga0075370_10325207 | 3300006353 | Bacteria | 916 |
| 138 | Ga0068871_100022452 | 3300006358 | Bacteria | 4864 |
| 139 | Ga0075428_100003372 | 3300006844 | Bacteria | 17480 |
| 140 | Ga0075428_100152509 | 3300006844 | Bacteria | 2510 |
| 141 | Ga0075428_100393302 | 3300006844 | Bacteria | 1486 |
| 142 | Ga0075430_100001211 | 3300006846 | Bacteria | 20749 |
| 143 | Ga0075430_100020849 | 3300006846 | Bacteria | 5572 |
| 144 | Ga0075431_100001495 | 3300006847 | Bacteria | 21638 |
| 145 | Ga0075431_100065085 | 3300006847 | Bacteria | 3764 |
| 146 | Ga0075431_100452409 | 3300006847 | Bacteria | 1279 |
| 147 | Ga0075433_10027057 | 3300006852 | Bacteria | 4862 |
| 148 | Ga0075433_10078430 | 3300006852 | Bacteria | 2910 |
| 149 | Ga0075433_10480241 | 3300006852 | Bacteria | 1095 |
| 150 | Ga0075434_100099957 | 3300006871 | Bacteria | 2906 |
| 151 | Ga0075434_100173104 | 3300006871 | Bacteria | 2179 |
| 152 | Ga0075434_100251039 | 3300006871 | Bacteria | 1788 |
| 153 | Ga0075429_100004770 | 3300006880 | Bacteria | 11675 |
| 154 | Ga0075429_100115583 | 3300006880 | Bacteria | 2345 |
| 155 | Ga0075436_100015554 | 3300006914 | Bacteria | 5208 |
| 156 | Ga0075436_100254605 | 3300006914 | Bacteria | 1251 |
| 157 | Ga0075436_100279843 | 3300006914 | Bacteria | 1193 |
| 158 | Ga0097620_100124846 | 3300006931 | Bacteria | 2642 |
| 159 | Ga0075435_100140860 | 3300007076 | Bacteria | 2023 |
| 160 | Ga0075435_100408255 | 3300007076 | Bacteria | 1169 |
| 161 | Ga0105240_10010565 | 3300009093 | Bacteria | 12967 |
| 162 | Ga0111539_10001922 | 3300009094 | Bacteria | 27676 |
| 163 | Ga0111539_10058559 | 3300009094 | Bacteria | 4570 |
| 164 | Ga0111539_10347643 | 3300009094 | Bacteria | 1726 |
| 165 | Ga0111539_11126531 | 3300009094 | Bacteria | 912 |
| 166 | Ga0105245_10692637 | 3300009098 | Bacteria | 1052 |
| 167 | Ga0105247_10077572 | 3300009101 | Bacteria | 2088 |
| 168 | Ga0114129_10000170 | 3300009147 | Bacteria | 70817 |
| 169 | Ga0114129_10434751 | 3300009147 | Bacteria | 1724 |
| 170 | Ga0114129_10490105 | 3300009147 | Bacteria | 1607 |
| 171 | Ga0114129_10614156 | 3300009147 | Bacteria | 1407 |
| 172 | Ga0105242_10311142 | 3300009176 | Bacteria | 1441 |
| 173 | Ga0105242_10514350 | 3300009176 | Bacteria | 1141 |
| 174 | Ga0105248_10059889 | 3300009177 | Bacteria | 4276 |
| 175 | Ga0105237_10062535 | 3300009545 | Bacteria | 3722 |
| 176 | Ga0105237_10314527 | 3300009545 | Bacteria | 1569 |
| 177 | Ga0105237_10467588 | 3300009545 | Bacteria | 1267 |
| 178 | Ga0105237_10487599 | 3300009545 | Bacteria | 1239 |
| 179 | Ga0105238_10213366 | 3300009551 | Bacteria | 1907 |
| 180 | Ga0105238_10616479 | 3300009551 | Bacteria | 1094 |
| 181 | Ga0105238_10751049 | 3300009551 | Bacteria | 989 |
| 182 | Ga0105238_10933843 | 3300009551 | Bacteria | 887 |
| 183 | Ga0105249_10179723 | 3300009553 | Bacteria | 2057 |
| 184 | Ga0105239_10122697 | 3300010375 | Bacteria | 2887 |
| 185 | Ga0105239_10172832 | 3300010375 | Bacteria | 2416 |
| 186 | Ga0105239_10293053 | 3300010375 | Bacteria | 1832 |
| 187 | Ga0105239_10323382 | 3300010375 | Bacteria | 1739 |
| 188 | Ga0105239_10359454 | 3300010375 | Bacteria | 1644 |
| 189 | Ga0105246_10051839 | 3300011119 | Bacteria | 2819 |
| 190 | Ga0105246_10091520 | 3300011119 | Bacteria | 2193 |
| 191 | Ga0105246_10167963 | 3300011119 | Bacteria | 1677 |
| 192 | Ga0157370_10178684 | 3300013104 | Bacteria | 1972 |
| 193 | Ga0157370_10352481 | 3300013104 | Bacteria | 1356 |
| 194 | Ga0157369_10021893 | 3300013105 | Bacteria | 7145 |
| 195 | Ga0157374_10161013 | 3300013296 | Bacteria | 2186 |
| 196 | Ga0157374_10755476 | 3300013296 | Bacteria | 987 |
| 197 | Ga0157378_10554981 | 3300013297 | Bacteria | 1154 |
| 198 | Ga0163162_10152800 | 3300013306 | Bacteria | 2427 |
| 199 | Ga0157372_10089010 | 3300013307 | Bacteria | 3507 |
| 200 | Ga0157372_10783253 | 3300013307 | Bacteria | 1108 |
| 201 | Ga0157372_11369876 | 3300013307 | Bacteria | 816 |
| 202 | Ga0157375_10801305 | 3300013308 | Bacteria | 1091 |
| 203 | Ga0163163_10029708 | 3300014325 | Bacteria | 5260 |
| 204 | Ga0163163_10147746 | 3300014325 | Bacteria | 2395 |
| 205 | Ga0163163_10235335 | 3300014325 | Bacteria | 1881 |
| 206 | Ga0157380_10064387 | 3300014326 | Bacteria | 2943 |
| 207 | Ga0157380_10437610 | 3300014326 | Bacteria | 1252 |
| 208 | Ga0157379_10206485 | 3300014968 | Bacteria | 1777 |
| 209 | Ga0157376_10100881 | 3300014969 | Bacteria | 2521 |
| 210 | Ga0157376_10140860 | 3300014969 | Bacteria | 2163 |
| 211 | Ga0157376_10471469 | 3300014969 | Bacteria | 1228 |
| 212 | Ga0163161_10326359 | 3300017792 | Bacteria | 1214 |
| 213 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 214 | Ga0214544_1020777 | 3300021320 | Bacteria | 4531 |
| 215 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 216 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 217 | Ga0214545_1013953 | 3300021324 | Bacteria | 9654 |
| 218 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 219 | Ga0213876_10040880 | 3300021384 | Bacteria | 2450 |
| 220 | Ga0213871_10001289 | 3300021441 | Bacteria | 4116 |
| 221 | Ga0224572_1042443 | 3300024225 | Bacteria | 855 |
| 222 | Ga0209148_1000253 | 3300025254 | Bacteria | 84643 |
| 223 | Ga0209455_1001670 | 3300025272 | Bacteria | 9565 |
| 224 | Ga0207426_1059801 | 3300025302 | Bacteria | 1100 |
| 225 | Ga0207688_10078323 | 3300025901 | Bacteria | 1884 |
| 226 | Ga0207680_10098431 | 3300025903 | Bacteria | 1875 |
| 227 | Ga0207685_10066216 | 3300025905 | Bacteria | 1449 |
| 228 | Ga0207685_10067789 | 3300025905 | Bacteria | 1436 |
| 229 | Ga0207699_10003139 | 3300025906 | Bacteria | 7855 |
| 230 | Ga0207699_10031686 | 3300025906 | Bacteria | 2971 |
| 231 | Ga0207684_10030611 | 3300025910 | Bacteria | 4581 |
| 232 | Ga0207654_10038930 | 3300025911 | Bacteria | 2671 |
| 233 | Ga0207707_10001008 | 3300025912 | Bacteria | 27003 |
| 234 | Ga0207707_10028450 | 3300025912 | Bacteria | 4885 |
| 235 | Ga0207707_10309467 | 3300025912 | Bacteria | 1365 |
| 236 | Ga0207671_10100582 | 3300025914 | Bacteria | 2189 |
| 237 | Ga0207671_10131838 | 3300025914 | Bacteria | 1919 |
| 238 | Ga0207693_10016343 | 3300025915 | Bacteria | 5932 |
| 239 | Ga0207693_10102352 | 3300025915 | Bacteria | 2246 |
| 240 | Ga0207693_10107498 | 3300025915 | Bacteria | 2188 |
| 241 | Ga0207693_10115637 | 3300025915 | Bacteria | 2106 |
| 242 | Ga0207693_10159007 | 3300025915 | Bacteria | 1777 |
| 243 | Ga0207693_10159174 | 3300025915 | Bacteria | 1776 |
| 244 | Ga0207663_10000176 | 3300025916 | Bacteria | 28557 |
| 245 | Ga0207663_10005873 | 3300025916 | Bacteria | 6225 |
| 246 | Ga0207663_10356415 | 3300025916 | Bacteria | 1109 |
| 247 | Ga0207663_10371044 | 3300025916 | Bacteria | 1088 |
| 248 | Ga0207660_10066272 | 3300025917 | Bacteria | 2612 |
| 249 | Ga0207660_10244469 | 3300025917 | Bacteria | 1415 |
| 250 | Ga0207649_10471870 | 3300025920 | Bacteria | 950 |
| 251 | Ga0207652_10003168 | 3300025921 | Bacteria | 13699 |
| 252 | Ga0207652_10102428 | 3300025921 | Bacteria | 2530 |
| 253 | Ga0207646_10383587 | 3300025922 | Bacteria | 1269 |
| 254 | Ga0207694_10171119 | 3300025924 | Bacteria | 1759 |
| 255 | Ga0207694_10788624 | 3300025924 | Bacteria | 802 |
| 256 | Ga0207650_10005078 | 3300025925 | Bacteria | 8983 |
| 257 | Ga0207659_10396611 | 3300025926 | Bacteria | 1153 |
| 258 | Ga0207687_10121184 | 3300025927 | Bacteria | 1956 |
| 259 | Ga0207700_10004711 | 3300025928 | Bacteria | 8085 |
| 260 | Ga0207700_10010008 | 3300025928 | Bacteria | 5958 |
| 261 | Ga0207700_10071083 | 3300025928 | Bacteria | 2678 |
| 262 | Ga0207700_10080128 | 3300025928 | Bacteria | 2545 |
| 263 | Ga0207700_10111884 | 3300025928 | Bacteria | 2199 |
| 264 | Ga0207700_10278264 | 3300025928 | Bacteria | 1439 |
| 265 | Ga0207664_10432393 | 3300025929 | Bacteria | 1173 |
| 266 | Ga0207644_10032854 | 3300025931 | Bacteria | 3623 |
| 267 | Ga0207686_10636689 | 3300025934 | Bacteria | 842 |
| 268 | Ga0207670_10153331 | 3300025936 | Bacteria | 1712 |
| 269 | Ga0207669_10372645 | 3300025937 | Bacteria | 1110 |
| 270 | Ga0207665_10036681 | 3300025939 | Bacteria | 3261 |
| 271 | Ga0207665_10177424 | 3300025939 | Bacteria | 1541 |
| 272 | Ga0207665_10215327 | 3300025939 | Bacteria | 1405 |
| 273 | Ga0207665_10341117 | 3300025939 | Bacteria | 1129 |
| 274 | Ga0207691_10372723 | 3300025940 | Bacteria | 1219 |
| 275 | Ga0207711_10174233 | 3300025941 | Bacteria | 1953 |
| 276 | Ga0207711_10797363 | 3300025941 | Bacteria | 880 |
| 277 | Ga0207689_10052872 | 3300025942 | Bacteria | 3346 |
| 278 | Ga0207689_10466343 | 3300025942 | Bacteria | 1056 |
| 279 | Ga0207679_10267936 | 3300025945 | Bacteria | 1459 |
| 280 | Ga0207679_10547672 | 3300025945 | Bacteria | 1038 |
| 281 | Ga0207679_10617170 | 3300025945 | Bacteria | 978 |
| 282 | Ga0207667_10022616 | 3300025949 | Bacteria | 6939 |
| 283 | Ga0207667_10236509 | 3300025949 | Bacteria | 1870 |
| 284 | Ga0207651_10187315 | 3300025960 | Bacteria | 1648 |
| 285 | Ga0207712_10089281 | 3300025961 | Bacteria | 2265 |
| 286 | Ga0207668_10052856 | 3300025972 | Bacteria | 2812 |
| 287 | Ga0207640_10216643 | 3300025981 | Bacteria | 1463 |
| 288 | Ga0207677_10103539 | 3300026023 | Bacteria | 2101 |
| 289 | Ga0207677_10110142 | 3300026023 | Bacteria | 2049 |
| 290 | Ga0207703_10030186 | 3300026035 | Bacteria | 4282 |
| 291 | Ga0207703_10255840 | 3300026035 | Bacteria | 1581 |
| 292 | Ga0207639_10131532 | 3300026041 | Bacteria | 2072 |
| 293 | Ga0207678_10009140 | 3300026067 | Bacteria | 8728 |
| 294 | Ga0207678_10020284 | 3300026067 | Bacteria | 5833 |
| 295 | Ga0207678_10044698 | 3300026067 | Bacteria | 3831 |
| 296 | Ga0207678_10060513 | 3300026067 | Bacteria | 3257 |
| 297 | Ga0207708_10317722 | 3300026075 | Bacteria | 1270 |
| 298 | Ga0207702_10206469 | 3300026078 | Bacteria | 1824 |
| 299 | Ga0207702_10585384 | 3300026078 | Bacteria | 1094 |
| 300 | Ga0207648_10086563 | 3300026089 | Bacteria | 2734 |
| 301 | Ga0207676_10229815 | 3300026095 | Bacteria | 1657 |
| 302 | Ga0207676_10770580 | 3300026095 | Bacteria | 937 |
| 303 | Ga0207674_10027595 | 3300026116 | Bacteria | 6003 |
| 304 | Ga0207675_100318339 | 3300026118 | Bacteria | 1518 |
| 305 | Ga0207683_10077845 | 3300026121 | Bacteria | 2937 |
| 306 | Ga0207698_10105611 | 3300026142 | Bacteria | 2347 |
| 307 | Ga0209489_100385 | 3300027361 | Bacteria | 79532 |
| 308 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 309 | Ga0207428_10002205 | 3300027907 | Bacteria | 19581 |
| 310 | Ga0268266_10000670 | 3300028379 | Bacteria | 46181 |
| 311 | Ga0268266_10026030 | 3300028379 | Bacteria | 4976 |
| 312 | Ga0268266_10109961 | 3300028379 | Bacteria | 2441 |
| 313 | Ga0268264_10118230 | 3300028381 | Bacteria | 2332 |
| 314 | Ga0265334_10106273 | 3300028573 | Bacteria | 1012 |
| 315 | Ga0265330_10004363 | 3300031235 | Bacteria | 7190 |
| 316 | Ga0265332_10000106 | 3300031238 | Bacteria | 71076 |
| 317 | Ga0265328_10000333 | 3300031239 | Bacteria | 22080 |
| 318 | Ga0265325_10161933 | 3300031241 | Bacteria | 1052 |
| 319 | Ga0265329_10004026 | 3300031242 | Bacteria | 6253 |
| 320 | Ga0265340_10033578 | 3300031247 | Bacteria | 2554 |
| 321 | Ga0265340_10042217 | 3300031247 | Bacteria | 2240 |
| 322 | Ga0265340_10058756 | 3300031247 | Bacteria | 1846 |
| 323 | Ga0265339_10000906 | 3300031249 | Bacteria | 22779 |
| 324 | Ga0265339_10180646 | 3300031249 | Bacteria | 1051 |
| 325 | Ga0265331_10000074 | 3300031250 | Bacteria | 149282 |
| 326 | Ga0265331_10011481 | 3300031250 | Bacteria | 4847 |
| 327 | Ga0265327_10111438 | 3300031251 | Bacteria | 1307 |
| 328 | Ga0265316_10000037 | 3300031344 | Bacteria | 149295 |
| 329 | Ga0265313_10002554 | 3300031595 | Bacteria | 15551 |
| 330 | Ga0265314_10001545 | 3300031711 | Bacteria | 25384 |
| 331 | Ga0265314_10003230 | 3300031711 | Bacteria | 15933 |
| 332 | Ga0265314_10078333 | 3300031711 | Bacteria | 2189 |
| 333 | Ga0265342_10000473 | 3300031712 | Bacteria | 43592 |
| 334 | Ga0307405_10093321 | 3300031731 | Bacteria | 1999 |
| 335 | Ga0307413_10358918 | 3300031824 | Bacteria | 1127 |
| 336 | Ga0307407_10536995 | 3300031903 | Bacteria | 862 |
| 337 | Ga0307409_100020254 | 3300031995 | Bacteria | 4529 |
| 338 | Ga0307416_100730541 | 3300032002 | Bacteria | 1081 |
| 339 | Ga0307411_10056323 | 3300032005 | Bacteria | 2591 |
| 340 | Ga0307415_100016685 | 3300032126 | Bacteria | 4384 |
| 341 | Ga0307415_100136824 | 3300032126 | Bacteria | 1864 |
| 342 | Ga0307510_10037129 | 3300033180 | Bacteria | 5411 |
| 343 | Ga0307510_10098175 | 3300033180 | Bacteria | 2734 |
| 344 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 345 | Ga0373959_0028355 | 3300034820 | Bacteria | 1117 |
| 346 | Ga0373926_0033752 | 3300035083 | Bacteria | 1810 |
| 347 | Ga0373934_0036665 | 3300035086 | Bacteria | 1932 |
| 348 | Ga0373949_0004015 | 3300035090 | Bacteria | 3411 |
| 349 | Ga0373951_0003883 | 3300035091 | Bacteria | 3593 |
| 350 | Ga0373952_0009142 | 3300035092 | Bacteria | 1890 |
| 351 | Ga0373932_0004447 | 3300035112 | Bacteria | 3313 |
| 352 | Ga0373936_0031239 | 3300035113 | Bacteria | 2103 |
| 353 | Ga0373936_0159721 | 3300035113 | Bacteria | 981 |
| 354 | Ga0373939_0001937 | 3300035114 | Bacteria | 4951 |
| 355 | Ga0373941_0007347 | 3300035115 | Bacteria | 2693 |
| 356 | Ga0373945_0014672 | 3300035116 | Bacteria | 2629 |
| 357 | Ga0373945_0022918 | 3300035116 | Bacteria | 2155 |
| 358 | Ga0373954_0041571 | 3300035118 | Bacteria | 2144 |
| 359 | Ga0373954_0062124 | 3300035118 | Bacteria | 1764 |
| 360 | Ga0373960_0128651 | 3300035121 | Bacteria | 847 |
| 361 | Ga0373943_0021497 | 3300035170 | Bacteria | 2981 |
| 362 | Ga0373943_0160679 | 3300035170 | Bacteria | 1223 |
| 363 | Ga0373946_0011011 | 3300035171 | Bacteria | 3363 |
| 364 | Ga0373946_0050353 | 3300035171 | Bacteria | 1740 |
| 365 | Ga0373946_0151310 | 3300035171 | Bacteria | 1083 |
| 366 | Ga0373955_0017708 | 3300035172 | Bacteria | 3530 |
| 367 | Ga0373955_0063343 | 3300035172 | Bacteria | 2047 |
| 368 | Ga0373955_0263014 | 3300035172 | Bacteria | 1036 |
| 369 | Ga0373955_0482825 | 3300035172 | Bacteria | 756 |
| 370 | Ga0373962_0005121 | 3300035242 | Bacteria | 3167 |
| 371 | Ga0373931_0017987 | 3300035691 | Bacteria | 3506 |
| 372 | Ga0373935_0000359 | 3300035692 | Bacteria | 23236 |
| 373 | Ga0373935_0015920 | 3300035692 | Bacteria | 4550 |
| 374 | Ga0373935_0235732 | 3300035692 | Bacteria | 1276 |
| 375 | Ga0373935_0539055 | 3300035692 | Bacteria | 850 |
| 376 | Ga0373927_0012622 | 3300035695 | Bacteria | 5620 |
| 377 | Ga0373927_0042198 | 3300035695 | Bacteria | 2956 |
| 378 | Ga0373927_0060943 | 3300035695 | Bacteria | 2441 |
| 379 | Ga0373933_0001892 | 3300035724 | Bacteria | 12075 |
| 380 | Ga0373933_0568666 | 3300035724 | Bacteria | 744 |
| 381 | Ga0373947_0000490 | 3300035725 | Bacteria | 22794 |
| 382 | Ga0373947_0014978 | 3300035725 | Bacteria | 4451 |
| 383 | Ga0373947_0063833 | 3300035725 | Bacteria | 2244 |
| 384 | Ga0373947_0105860 | 3300035725 | Bacteria | 1772 |
| 385 | Ga0373937_0011820 | 3300036401 | Bacteria | 7665 |
| 386 | Ga0373937_0113974 | 3300036401 | Bacteria | 2516 |
| 387 | Ga0373937_0122815 | 3300036401 | Bacteria | 2421 |
| 388 | Ga0373937_0123962 | 3300036401 | Bacteria | 2409 |
| 389 | Ga0372808_008576 | 3300036459 | Bacteria | 1419 |
| 390 | Ga0373925_0004226 | 3300037068 | Bacteria | 10894 |
| 391 | Ga0373925_0064468 | 3300037068 | Bacteria | 2758 |
| 392 | Ga0373925_0204720 | 3300037068 | Bacteria | 1570 |
| 393 | Ga0373925_0427076 | 3300037068 | Bacteria | 1083 |
| 394 | Ga0373925_0517504 | 3300037068 | Bacteria | 980 |
| 395 | Ga0395900_0006562 | 3300037418 | Bacteria | 12123 |
| 396 | Ga0395898_0055110 | 3300037466 | Bacteria | 3878 |
| 397 | Ga0395898_0127296 | 3300037466 | Bacteria | 2440 |
| 398 | Ga0395898_0276925 | 3300037466 | Bacteria | 1600 |
| 399 | Ga0395901_0091033 | 3300038443 | Bacteria | 3193 |
| 400 | Ga0395901_0226645 | 3300038443 | Bacteria | 1952 |
| 401 | Ga0436365_0968052 | 3300039437 | Bacteria | 2798 |
| 402 | Ga0436365_1039646 | 3300039437 | Bacteria | 1232 |
| 403 | Ga0436365_1540042 | 3300039437 | Bacteria | 70665 |
| 404 | Ga0436360_1067866 | 3300039438 | Bacteria | 3628 |
| 405 | Ga0436361_0161816 | 3300039447 | Bacteria | 1291 |
| 406 | Ga0436361_0894340 | 3300039447 | Bacteria | 3899 |
| 407 | Ga0436361_1082876 | 3300039447 | Bacteria | 6083 |
| 408 | Ga0436362_0265151 | 3300039453 | Bacteria | 2896 |
| 409 | Ga0436362_0443038 | 3300039453 | Bacteria | 903 |
| 410 | Ga0439465_0012372 | 3300041413 | Bacteria | 2669 |
| 411 | Ga0451791_1145985 | 3300041451 | Bacteria | 1092 |
| 412 | Ga0451851_1218237 | 3300041507 | Bacteria | 837 |
| 413 | Ga0439456_049285 | 3300042013 | Bacteria | 919 |
| 414 | Ga0439460_0097950 | 3300042461 | Bacteria | 939 |
| 415 | Ga0466965_0074731 | 3300044683 | Bacteria | 1708 |
| 416 | Ga0466963_0053342 | 3300044694 | Bacteria | 2685 |
| 417 | Ga0466967_0018740 | 3300045976 | Bacteria | 5543 |
| 418 | Ga0466967_0115901 | 3300045976 | Bacteria | 2468 |
| 419 | Ga0466967_0601992 | 3300045976 | Bacteria | 1085 |
| 420 | Ga0466967_0977870 | 3300045976 | Bacteria | 842 |
| 421 | Ga0495592_0165055 | 3300046454 | Bacteria | 1520 |
| 422 | Ga0495592_0284011 | 3300046454 | Bacteria | 1081 |
| 423 | Ga0495603_0010445 | 3300046455 | Bacteria | 5623 |
| 424 | Ga0495603_0072989 | 3300046455 | Bacteria | 2016 |
| 425 | Ga0495603_0078331 | 3300046455 | Bacteria | 1938 |
| 426 | Ga0495590_0091811 | 3300046457 | Bacteria | 1075 |
| 427 | Ga0495629_0000169 | 3300046459 | Bacteria | 57783 |
| 428 | Ga0495629_0101680 | 3300046459 | Bacteria | 2005 |
| 429 | Ga0495629_0382837 | 3300046459 | Bacteria | 957 |
| 430 | Ga0495638_0199033 | 3300046460 | Bacteria | 1132 |
| 431 | Ga0495641_0028285 | 3300046461 | Bacteria | 2715 |
| 432 | Ga0495641_0088227 | 3300046461 | Bacteria | 1387 |
| 433 | Ga0495651_0002891 | 3300046462 | Bacteria | 13294 |
| 434 | Ga0495651_0056073 | 3300046462 | Bacteria | 3027 |
| 435 | Ga0495653_0022577 | 3300046463 | Bacteria | 5089 |
| 436 | Ga0495580_0011387 | 3300046472 | Bacteria | 6883 |
| 437 | Ga0495582_0000501 | 3300046473 | Bacteria | 21420 |
| 438 | Ga0495582_0089465 | 3300046473 | Bacteria | 1716 |
| 439 | Ga0495582_0417403 | 3300046473 | Bacteria | 774 |
| 440 | Ga0495605_0177650 | 3300046474 | Bacteria | 938 |
| 441 | Ga0495639_0027794 | 3300046475 | Bacteria | 2504 |
| 442 | Ga0495639_0188273 | 3300046475 | Bacteria | 1007 |
| 443 | Ga0495662_0086996 | 3300046476 | Bacteria | 1522 |
| 444 | Ga0495662_0090129 | 3300046476 | Bacteria | 1495 |
| 445 | Ga0495664_0015502 | 3300046477 | Bacteria | 4333 |
| 446 | Ga0495664_0021658 | 3300046477 | Bacteria | 3713 |
| 447 | Ga0495664_0228647 | 3300046477 | Bacteria | 1126 |
| 448 | Ga0495584_0010790 | 3300046491 | Bacteria | 4690 |
| 449 | Ga0495585_0027420 | 3300046492 | Bacteria | 3251 |
| 450 | Ga0495594_0070183 | 3300046499 | Bacteria | 1947 |
| 451 | Ga0495608_0223573 | 3300046511 | Bacteria | 1180 |
| 452 | Ga0495610_0190666 | 3300046512 | Bacteria | 846 |
| 453 | Ga0495616_0202560 | 3300046513 | Bacteria | 872 |
| 454 | Ga0495618_0004599 | 3300046514 | Bacteria | 8450 |
| 455 | Ga0495618_0009970 | 3300046514 | Bacteria | 5748 |
| 456 | Ga0495618_0077440 | 3300046514 | Bacteria | 2119 |
| 457 | Ga0495628_0128569 | 3300046516 | Bacteria | 1939 |
| 458 | Ga0495628_0135778 | 3300046516 | Bacteria | 1880 |
| 459 | Ga0495630_0255414 | 3300046517 | Bacteria | 1339 |
| 460 | Ga0495630_0259225 | 3300046517 | Bacteria | 1328 |
| 461 | Ga0495648_0005936 | 3300046524 | Bacteria | 10049 |
| 462 | Ga0495652_0066385 | 3300046529 | Bacteria | 3028 |
| 463 | Ga0495665_0040425 | 3300046531 | Bacteria | 2483 |
| 464 | Ga0495665_0068113 | 3300046531 | Bacteria | 1877 |
| 465 | Ga0495640_0007530 | 3300046533 | Bacteria | 8555 |
| 466 | Ga0495640_0022380 | 3300046533 | Bacteria | 4620 |
| 467 | Ga0495640_0024977 | 3300046533 | Bacteria | 4341 |
| 468 | Ga0495587_0000396 | 3300046536 | Bacteria | 30853 |
| 469 | Ga0495645_0106082 | 3300046543 | Bacteria | 1993 |
| 470 | Ga0495622_0020201 | 3300046557 | Bacteria | 3102 |
| 471 | Ga0495622_0041478 | 3300046557 | Bacteria | 2140 |
| 472 | Ga0495622_0091622 | 3300046557 | Bacteria | 1396 |
| 473 | Ga0495622_0168477 | 3300046557 | Bacteria | 986 |
| 474 | Ga0495667_0013334 | 3300046559 | Bacteria | 5563 |
| 475 | Ga0495667_0027673 | 3300046559 | Bacteria | 3818 |
| 476 | Ga0495656_0025225 | 3300046615 | Bacteria | 2355 |
| 477 | Ga0495668_0241899 | 3300046616 | Bacteria | 988 |
| 478 | Ga0495634_0033866 | 3300046642 | Bacteria | 3508 |
| 479 | Ga0495634_0079328 | 3300046642 | Bacteria | 2150 |
| 480 | Ga0495635_0012411 | 3300046663 | Bacteria | 5970 |
| 481 | Ga0495635_0015552 | 3300046663 | Bacteria | 5318 |
| 482 | Ga0495635_0108705 | 3300046663 | Bacteria | 1894 |
| 483 | Ga0495657_0023962 | 3300046675 | Bacteria | 4354 |
| 484 | Ga0495657_0130826 | 3300046675 | Bacteria | 1572 |
| 485 | Ga0495599_0037602 | 3300046678 | Bacteria | 3040 |
| 486 | Ga0495599_0105775 | 3300046678 | Bacteria | 1753 |
| 487 | Ga0495623_0004013 | 3300046679 | Bacteria | 9685 |
| 488 | Ga0495623_0054972 | 3300046679 | Bacteria | 2511 |
| 489 | Ga0495646_0039725 | 3300046680 | Bacteria | 2900 |
| 490 | Ga0495647_0016441 | 3300046681 | Bacteria | 2605 |
| 491 | Ga0495658_0001748 | 3300046683 | Bacteria | 11230 |
| 492 | Ga0495658_0041125 | 3300046683 | Bacteria | 2573 |
| 493 | Ga0495658_0077268 | 3300046683 | Bacteria | 1947 |
| 494 | Ga0495658_0164366 | 3300046683 | Bacteria | 1370 |
| 495 | Ga0495613_0033167 | 3300046689 | Bacteria | 3837 |
| 496 | Ga0495613_0136671 | 3300046689 | Bacteria | 1753 |
| 497 | Ga0495613_0222069 | 3300046689 | Bacteria | 1326 |
| 498 | Ga0495624_0108776 | 3300046690 | Bacteria | 1705 |
| 499 | Ga0495624_0329531 | 3300046690 | Bacteria | 919 |
| 500 | Ga0495600_0004521 | 3300046809 | Bacteria | 8333 |
| 501 | Ga0495581_0022126 | 3300047315 | Bacteria | 3684 |
| 502 | Ga0495581_0070608 | 3300047315 | Bacteria | 2020 |
| 503 | Ga0495581_0075949 | 3300047315 | Bacteria | 1944 |
| 504 | Ga0495581_0175731 | 3300047315 | Bacteria | 1252 |
| 505 | Ga0495604_0006104 | 3300047317 | Bacteria | 9561 |
| 506 | Ga0495604_0115230 | 3300047317 | Bacteria | 1953 |
| 507 | Ga0495604_0167937 | 3300047317 | Bacteria | 1546 |
| 508 | Ga0495674_0000860 | 3300047319 | Bacteria | 29012 |
| 509 | Ga0495674_0018990 | 3300047319 | Bacteria | 6391 |
| 510 | Ga0495674_0062241 | 3300047319 | Bacteria | 3250 |
| 511 | Ga0495672_0087168 | 3300047320 | Bacteria | 1724 |
| 512 | Ga0495672_0173842 | 3300047320 | Bacteria | 1096 |
| 513 | Ga0495672_0194228 | 3300047320 | Bacteria | 1019 |
| 514 | Ga0495676_0040825 | 3300047321 | Bacteria | 3826 |
| 515 | Ga0495676_0289593 | 3300047321 | Bacteria | 1107 |
| 516 | Ga0495676_0301533 | 3300047321 | Bacteria | 1080 |
| 517 | Ga0495680_0008674 | 3300047322 | Bacteria | 9225 |
| 518 | Ga0495680_0057823 | 3300047322 | Bacteria | 2998 |
| 519 | Ga0495675_0035181 | 3300047444 | Bacteria | 3199 |
| 520 | Ga0495679_077690 | 3300047446 | Bacteria | 947 |
| 521 | Ga0495684_0011622 | 3300047471 | Bacteria | 6797 |
| 522 | Ga0495684_0024897 | 3300047471 | Bacteria | 4603 |
| 523 | Ga0495686_0110474 | 3300047472 | Bacteria | 1649 |
| 524 | Ga0495686_0129427 | 3300047472 | Bacteria | 1498 |
| 525 | Ga0495593_0042881 | 3300047673 | Bacteria | 2427 |
| 526 | Ga0495593_0061530 | 3300047673 | Bacteria | 1963 |
| 527 | Ga0495593_0105535 | 3300047673 | Bacteria | 1442 |
| 528 | Ga0495602_0015443 | 3300048088 | Bacteria | 7705 |
| 529 | Ga0496100_0056160 | 3300048903 | Bacteria | 2575 |
| 530 | Ga0496100_0203112 | 3300048903 | Bacteria | 1445 |
| 531 | Ga0496101_0007208 | 3300048904 | Bacteria | 7198 |
| 532 | Ga0496101_0162974 | 3300048904 | Bacteria | 1711 |
| 533 | Ga0496102_0152736 | 3300048905 | Bacteria | 2170 |
| 534 | Ga0496102_0409370 | 3300048905 | Bacteria | 1274 |
| 535 | Ga0496103_0089496 | 3300048906 | Bacteria | 1941 |
| 536 | Ga0496104_0000069 | 3300048907 | Bacteria | 107511 |
| 537 | Ga0496104_0001421 | 3300048907 | Bacteria | 20741 |
| 538 | Ga0496104_0005194 | 3300048907 | Bacteria | 11383 |
| 539 | Ga0496104_0333963 | 3300048907 | Bacteria | 1428 |
| 540 | Ga0496104_0352896 | 3300048907 | Bacteria | 1383 |
| 541 | Ga0496104_0369104 | 3300048907 | Bacteria | 1348 |
| 542 | Ga0496104_0375570 | 3300048907 | Bacteria | 1334 |
| 543 | Ga0496105_0000062 | 3300048908 | Bacteria | 85187 |
| 544 | Ga0496105_0006775 | 3300048908 | Bacteria | 8808 |
| 545 | Ga0496105_0060429 | 3300048908 | Bacteria | 3127 |
| 546 | Ga0496105_0071969 | 3300048908 | Bacteria | 2858 |
| 547 | Ga0496105_0075153 | 3300048908 | Bacteria | 2790 |
| 548 | Ga0496105_0316595 | 3300048908 | Bacteria | 1251 |
| 549 | Ga0496106_0002088 | 3300048909 | Bacteria | 14981 |
| 550 | Ga0496106_0025435 | 3300048909 | Bacteria | 4406 |
| 551 | Ga0496106_0072788 | 3300048909 | Bacteria | 2628 |
| 552 | Ga0496106_0105469 | 3300048909 | Bacteria | 2190 |
| 553 | Ga0496106_0114497 | 3300048909 | Bacteria | 2103 |
| 554 | Ga0496106_0236097 | 3300048909 | Bacteria | 1461 |
| 555 | Ga0496107_0004186 | 3300048910 | Bacteria | 9746 |
| 556 | Ga0496107_0004453 | 3300048910 | Bacteria | 9497 |
| 557 | Ga0496108_0001075 | 3300048911 | Bacteria | 21328 |
| 558 | Ga0496108_0014318 | 3300048911 | Bacteria | 6474 |
| 559 | Ga0496108_0173761 | 3300048911 | Bacteria | 1864 |
| 560 | Ga0496109_0002544 | 3300048912 | Bacteria | 15291 |
| 561 | Ga0496109_0196000 | 3300048912 | Bacteria | 1898 |
| 562 | Ga0496109_0310379 | 3300048912 | Bacteria | 1488 |
| 563 | Ga0496109_0364960 | 3300048912 | Bacteria | 1364 |
| 564 | Ga0496110_0026785 | 3300048913 | Bacteria | 4937 |
| 565 | Ga0496110_0135186 | 3300048913 | Bacteria | 2227 |
| 566 | Ga0496110_0355967 | 3300048913 | Bacteria | 1334 |
| 567 | Ga0496110_0623592 | 3300048913 | Bacteria | 977 |
| 568 | Ga0496111_0055575 | 3300048914 | Bacteria | 2863 |
| 569 | Ga0496111_0282636 | 3300048914 | Bacteria | 1231 |
| 570 | Ga0496112_0003616 | 3300048915 | Bacteria | 12875 |
| 571 | Ga0496112_0040721 | 3300048915 | Bacteria | 4543 |
| 572 | Ga0496112_0078923 | 3300048915 | Bacteria | 3255 |
| 573 | Ga0496112_0168277 | 3300048915 | Bacteria | 2157 |
| 574 | Ga0496112_0177789 | 3300048915 | Bacteria | 2092 |
| 575 | Ga0496112_0257938 | 3300048915 | Bacteria | 1693 |
| 576 | Ga0496112_0788288 | 3300048915 | Bacteria | 875 |
| 577 | Ga0496113_0000949 | 3300048916 | Bacteria | 15428 |
| 578 | Ga0496113_0020463 | 3300048916 | Bacteria | 4652 |
| 579 | Ga0496113_0075829 | 3300048916 | Bacteria | 2567 |
| 580 | Ga0496113_0243344 | 3300048916 | Bacteria | 1436 |
| 581 | Ga0496114_0026910 | 3300048917 | Bacteria | 4711 |
| 582 | Ga0496114_0111821 | 3300048917 | Bacteria | 2341 |
| 583 | Ga0496114_0206816 | 3300048917 | Bacteria | 1721 |
| 584 | Ga0496114_0435070 | 3300048917 | Bacteria | 1162 |
| 585 | Ga0496115_0018802 | 3300048918 | Bacteria | 5311 |
| 586 | Ga0496115_0043919 | 3300048918 | Bacteria | 3564 |
| 587 | Ga0496115_0064899 | 3300048918 | Bacteria | 2948 |
| 588 | Ga0496115_0111816 | 3300048918 | Bacteria | 2244 |
| 589 | Ga0496115_0167639 | 3300048918 | Bacteria | 1816 |
| 590 | Ga0496115_0229266 | 3300048918 | Bacteria | 1532 |
| 591 | Ga0496115_0270767 | 3300048918 | Bacteria | 1395 |
| 592 | Ga0496115_0378098 | 3300048918 | Bacteria | 1152 |
| 593 | Ga0496118_0030366 | 3300048921 | Bacteria | 4512 |
| 594 | Ga0496119_0012629 | 3300048922 | Bacteria | 6837 |
| 595 | Ga0496120_0030873 | 3300048923 | Bacteria | 3252 |
| 596 | Ga0496121_0039412 | 3300048924 | Bacteria | 4164 |
| 597 | Ga0496121_0059965 | 3300048924 | Bacteria | 3134 |
| 598 | Ga0496124_0057877 | 3300048927 | Bacteria | 3263 |
| 599 | Ga0496125_0051128 | 3300048928 | Bacteria | 3412 |
| 600 | Ga0496126_0007749 | 3300048929 | Bacteria | 11708 |
| 601 | Ga0496126_0047853 | 3300048929 | Bacteria | 3913 |
| 602 | Ga0496126_0065391 | 3300048929 | Bacteria | 3255 |
| 603 | Ga0496126_0088727 | 3300048929 | Bacteria | 2723 |
| 604 | Ga0496126_0089186 | 3300048929 | Bacteria | 2715 |
| 605 | Ga0496126_0218791 | 3300048929 | Bacteria | 1601 |
| 606 | Ga0501034_0313442 | 3300049571 | Bacteria | 1503 |
| 607 | Ga0501036_0593806 | 3300049572 | Bacteria | 919 |
| 608 | Ga0501048_0000115 | 3300049582 | Bacteria | 45729 |
| 609 | Ga0501069_0135581 | 3300049585 | Bacteria | 1411 |
| 610 | nmdc:mga03683_24331_c2 | 3300050489 | Bacteria | 1672 |
| 611 | nmdc:mga00v17_133351_c1 | 3300050491 | Bacteria | 1589 |
| 612 | nmdc:mga00v17_30266_c1 | 3300050491 | Bacteria | 3184 |
| 613 | nmdc:mga00v17_32317_c1 | 3300050491 | Bacteria | 3092 |
| 614 | nmdc:mga00v17_325276_c1 | 3300050491 | Bacteria | 999 |
| 615 | nmdc:mga0yw44_11952_c1 | 3300050492 | Bacteria | 4506 |
| 616 | nmdc:mga0yw44_126266_c1 | 3300050492 | Bacteria | 1652 |
| 617 | nmdc:mga0yw44_34727_c1 | 3300050492 | Bacteria | 2957 |
| 618 | nmdc:mga0yw44_9567_c1 | 3300050492 | Bacteria | 4911 |
| 619 | nmdc:mga0k408_139207_c1 | 3300050493 | Bacteria | 1443 |
| 620 | nmdc:mga06z11_13060_c1 | 3300050494 | Bacteria | 3633 |
| 621 | nmdc:mga06z11_23452_c1 | 3300050494 | Bacteria | 2899 |
| 622 | nmdc:mga06z11_59498_c1 | 3300050494 | Bacteria | 1986 |
| 623 | nmdc:mga07m45_5386_c1 | 3300050496 | Bacteria | 6367 |
| 624 | nmdc:mga05p37_124_c1 | 3300050507 | Bacteria | 69907 |
| 625 | nmdc:mga05p37_333562_c1 | 3300050507 | Bacteria | 1791 |
| 626 | nmdc:mga09592_547888_c1 | 3300050508 | Bacteria | 993 |
| 627 | nmdc:mga09592_5518_c1 | 3300050508 | Bacteria | 10293 |
| 628 | nmdc:mga0qj67_16363_c1 | 3300050509 | Bacteria | 5623 |
| 629 | nmdc:mga0qj67_316236_c1 | 3300050509 | Bacteria | 1264 |
| 630 | nmdc:mga0qj67_3618_c1 | 3300050509 | Bacteria | 11152 |
| 631 | nmdc:mga06r32_145140_c1 | 3300050510 | Bacteria | 2351 |
| 632 | nmdc:mga06r32_847_c1 | 3300050510 | Bacteria | 27075 |
| 633 | nmdc:mga08y16_2124_c1 | 3300050511 | Bacteria | 20307 |
| 634 | nmdc:mga08y16_233220_c1 | 3300050511 | Bacteria | 1903 |
| 635 | nmdc:mga08y16_238003_c1 | 3300050511 | Bacteria | 1882 |
| 636 | nmdc:mga0n895_18346_c1 | 3300050512 | Bacteria | 6471 |
| 637 | nmdc:mga0n895_426935_c1 | 3300050512 | Bacteria | 1339 |
| 638 | nmdc:mga0n895_45308_c1 | 3300050512 | Bacteria | 4292 |
| 639 | nmdc:mga0n895_56526_c1 | 3300050512 | Bacteria | 3866 |
| 640 | nmdc:mga0n895_790415_c1 | 3300050512 | Bacteria | 940 |
| 641 | nmdc:mga0rr50_353686_c1 | 3300050513 | Bacteria | 1236 |
| 642 | nmdc:mga0rr50_678961_c1 | 3300050513 | Bacteria | 879 |
| 643 | nmdc:mga0rr50_73213_c1 | 3300050513 | Bacteria | 2619 |
| 644 | nmdc:mga08x19_206289_c1 | 3300050514 | Bacteria | 1348 |
| 645 | nmdc:mga08x19_209816_c1 | 3300050514 | Bacteria | 1337 |
| 646 | nmdc:mga08x19_23380_c1 | 3300050514 | Bacteria | 3834 |
| 647 | nmdc:mga0a205_154174_c1 | 3300050515 | Bacteria | 2196 |
| 648 | nmdc:mga0a205_469041_c1 | 3300050515 | Bacteria | 1118 |
| 649 | nmdc:mga0a205_543441_c1 | 3300050515 | Bacteria | 1017 |
| 650 | nmdc:mga0a205_97632_c1 | 3300050515 | Bacteria | 2837 |
| 651 | nmdc:mga0sz30_98102_c1 | 3300050516 | Bacteria | 1278 |
| 652 | Ga0495601_0010338 | 3300053077 | Bacteria | 5551 |
| 653 | Ga0495601_0060130 | 3300053077 | Bacteria | 2411 |
| 654 | Ga0495601_0195387 | 3300053077 | Bacteria | 1322 |
| 655 | Ga0495612_0021763 | 3300053078 | Bacteria | 2571 |
| 656 | Ga0495619_0001572 | 3300053085 | Bacteria | 15017 |
| 657 | Ga0495619_0003276 | 3300053085 | Bacteria | 10468 |
| 658 | Ga0495619_0006981 | 3300053085 | Bacteria | 7146 |
| 659 | Ga0495619_0027144 | 3300053085 | Bacteria | 3688 |
| 660 | Ga0495619_0200622 | 3300053085 | Bacteria | 1381 |
| 661 | Ga0500641_0001698 | 3300053096 | Bacteria | 7831 |
| 662 | Ga0500595_000941 | 3300053119 | Bacteria | 16447 |
| 663 | Ga0500595_006818 | 3300053119 | Bacteria | 4807 |
| 664 | Ga0500595_019376 | 3300053119 | Bacteria | 2470 |
| 665 | Ga0500595_052847 | 3300053119 | Bacteria | 1253 |
| 666 | Ga0500607_050885 | 3300053121 | Bacteria | 2205 |
| 667 | Ga0500608_197859 | 3300053122 | Bacteria | 834 |
| 668 | Ga0500559_0002260 | 3300053136 | Bacteria | 10172 |
| 669 | Ga0500586_016591 | 3300053145 | Bacteria | 2238 |
| 670 | Ga0500603_001309 | 3300053150 | Bacteria | 5711 |
| 671 | Ga0500603_026355 | 3300053150 | Bacteria | 1469 |
| 672 | Ga0500616_0027152 | 3300053153 | Bacteria | 3163 |
| 673 | Ga0500616_0034208 | 3300053153 | Bacteria | 2769 |
| 674 | Ga0500620_063141 | 3300053155 | Bacteria | 1264 |
| 675 | Ga0500638_000054 | 3300053162 | Bacteria | 23606 |
| 676 | Ga0500637_0000775 | 3300053178 | Bacteria | 12832 |
| 677 | Ga0500637_0013609 | 3300053178 | Bacteria | 4271 |
| 678 | Ga0500661_000301 | 3300055283 | Bacteria | 8965 |
| 679 | Ga0530510_0094293 | 3300061734 | Bacteria | 2186 |
| 680 | Ga0530510_0292637 | 3300061734 | Bacteria | 1218 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037068 | Ga0373925_0427076 | Ga0373925_0427076_211_933 | 209 |
| 2 | 3300005434 | Ga0070709_10073029 | Ga0070709_100730293 | 214 |
| 3 | 3300005437 | Ga0070710_10039921 | Ga0070710_100399212 | 214 |
| 4 | 3300005439 | Ga0070711_100029291 | Ga0070711_1000292912 | 214 |
| 5 | 3300006028 | Ga0070717_10114897 | Ga0070717_101148973 | 214 |
| 6 | 3300025915 | Ga0207693_10159174 | Ga0207693_101591742 | 214 |
| 7 | 3300025928 | Ga0207700_10010008 | Ga0207700_100100082 | 214 |
| 8 | 3300045976 | Ga0466967_0977870 | Ga0466967_0977870_33_725 | 214 |
| 9 | 3300046524 | Ga0495648_0005936 | Ga0495648_0005936_1037_1705 | 218 |
| 10 | 3300005563 | Ga0068855_101256767 | Ga0068855_1012567671 | 219 |
| 11 | 3300021441 | Ga0213871_10001289 | Ga0213871_100012896 | 219 |
| 12 | 3300039438 | Ga0436360_1067866 | Ga0436360_1067866_2754_3443 | 219 |
| 13 | 3300039447 | Ga0436361_0894340 | Ga0436361_0894340_1998_2687 | 219 |
| 14 | 3300025939 | Ga0207665_10341117 | Ga0207665_103411171 | 220 |
| 15 | 3300021384 | Ga0213876_10040880 | Ga0213876_100408803 | 221 |
| 16 | 3300039437 | Ga0436365_0968052 | Ga0436365_0968052_1105_1797 | 221 |
| 17 | 3300049572 | Ga0501036_0593806 | Ga0501036_0593806_11_685 | 221 |
| 18 | 3300006914 | Ga0075436_100254605 | Ga0075436_1002546051 | 223 |
| 19 | 3300037466 | Ga0395898_0276925 | Ga0395898_0276925_778_1470 | 223 |
| 20 | 3300050514 | nmdc:mga08x19_209816_c1 | nmdc:mga08x19_209816_c1_496_1188 | 223 |
| 21 | 3300006175 | Ga0070712_100326682 | Ga0070712_1003266822 | 225 |
| 22 | 3300031247 | Ga0265340_10058756 | Ga0265340_100587562 | 225 |
| 23 | 3300031249 | Ga0265339_10000906 | Ga0265339_1000090611 | 225 |
| 24 | 3300035171 | Ga0373946_0050353 | Ga0373946_0050353_443_1141 | 225 |
| 25 | 3300035172 | Ga0373955_0482825 | Ga0373955_0482825_37_735 | 225 |
| 26 | 3300035695 | Ga0373927_0060943 | Ga0373927_0060943_434_1132 | 225 |
| 27 | 3300046475 | Ga0495639_0188273 | Ga0495639_0188273_234_932 | 225 |
| 28 | 3300046476 | Ga0495662_0090129 | Ga0495662_0090129_341_1039 | 225 |
| 29 | 3300046681 | Ga0495647_0016441 | Ga0495647_0016441_1865_2563 | 225 |
| 30 | 3300046683 | Ga0495658_0077268 | Ga0495658_0077268_1153_1851 | 225 |
| 31 | 3300047315 | Ga0495581_0175731 | Ga0495581_0175731_506_1204 | 225 |
| 32 | 3300047673 | Ga0495593_0105535 | Ga0495593_0105535_433_1131 | 225 |
| 33 | 3300048918 | Ga0496115_0167639 | Ga0496115_0167639_755_1453 | 225 |
| 34 | 3300053085 | Ga0495619_0003276 | Ga0495619_0003276_3341_4039 | 225 |
| 35 | iso_pu_bacteria | 2508501042 | 2508696872 | 225 |
| 36 | iso_pu_bacteria | 8006926726 | 8006929832 | 225 |
| 37 | iso_pu_bacteria | 2507262055 | 2507511086 | 226 |
| 38 | iso_pu_bacteria | 2508501009 | 2508544900 | 226 |
| 39 | iso_pu_bacteria | 2513237092 | 2513623545 | 226 |
| 40 | iso_pu_bacteria | 2513237096 | 2513661269 | 226 |
| 41 | iso_pu_bacteria | 2513237137 | 2513858182 | 226 |
| 42 | iso_pu_bacteria | 2513237141 | 2513892151 | 226 |
| 43 | iso_pu_bacteria | 2513237145 | 2513922990 | 226 |
| 44 | iso_pu_bacteria | 2517572143 | 2517893926 | 226 |
| 45 | iso_pu_bacteria | 2524023205 | 2524438126 | 226 |
| 46 | iso_pu_bacteria | 2617270741 | 2617373209 | 226 |
| 47 | iso_pu_bacteria | 2791355199 | 2793081987 | 226 |
| 48 | iso_pu_bacteria | 2821443989 | 2821446318 | 226 |
| 49 | iso_pu_bacteria | 2824661429 | 2824667975 | 226 |
| 50 | iso_pu_bacteria | 2824704595 | 2824712081 | 226 |
| 51 | iso_pu_bacteria | 2824732956 | 2824738728 | 226 |
| 52 | iso_pu_bacteria | 2824746037 | 2824752407 | 226 |
| 53 | iso_pu_bacteria | 2824753945 | 2824761481 | 226 |
| 54 | iso_pu_bacteria | 2824763712 | 2824771356 | 226 |
| 55 | iso_pu_bacteria | 2824773399 | 2824780506 | 226 |
| 56 | iso_pu_bacteria | 2841957949 | 2841961942 | 226 |
| 57 | iso_pu_bacteria | 2847930680 | 2847938627 | 226 |
| 58 | iso_pu_bacteria | 2849076700 | 2849081600 | 226 |
| 59 | iso_pu_bacteria | 2879083081 | 2879088399 | 226 |
| 60 | iso_pu_bacteria | 2881364244 | 2881370745 | 226 |
| 61 | iso_pu_bacteria | 2881665667 | 2881671273 | 226 |
| 62 | iso_pu_bacteria | 2885374607 | 2885382427 | 226 |
| 63 | iso_pu_bacteria | 2885409591 | 2885411872 | 226 |
| 64 | iso_pu_bacteria | 2889033259 | 2889037265 | 226 |
| 65 | iso_pu_bacteria | 2903768456 | 2903777904 | 226 |
| 66 | iso_pu_bacteria | 2904711408 | 2904719302 | 226 |
| 67 | iso_pu_bacteria | 2906635258 | 2906635976 | 226 |
| 68 | iso_pu_bacteria | 2906643746 | 2906649146 | 226 |
| 69 | iso_pu_bacteria | 2906660503 | 2906663925 | 226 |
| 70 | iso_pu_bacteria | 2908739725 | 2908744330 | 226 |
| 71 | iso_pu_bacteria | 2908775508 | 2908781666 | 226 |
| 72 | iso_pu_bacteria | 2922393267 | 2922401026 | 226 |
| 73 | iso_pu_bacteria | 2932784394 | 2932785832 | 226 |
| 74 | iso_pu_bacteria | 2932828146 | 2932830877 | 226 |
| 75 | iso_pu_bacteria | 2935608549 | 2935612685 | 226 |
| 76 | iso_pu_bacteria | 2935616580 | 2935620920 | 226 |
| 77 | iso_pu_bacteria | 2935638405 | 2935640003 | 226 |
| 78 | iso_pu_bacteria | 2935648319 | 2935655199 | 226 |
| 79 | iso_pu_bacteria | 2935656913 | 2935664080 | 226 |
| 80 | iso_pu_bacteria | 2935665750 | 2935667143 | 226 |
| 81 | iso_pu_bacteria | 2935684952 | 2935690273 | 226 |
| 82 | iso_pu_bacteria | 2935703347 | 2935704899 | 226 |
| 83 | iso_pu_bacteria | 2935713505 | 2935718031 | 226 |
| 84 | iso_pu_bacteria | 2935722832 | 2935726819 | 226 |
| 85 | iso_pu_bacteria | 2935732158 | 2935735589 | 226 |
| 86 | iso_pu_bacteria | 2935741537 | 2935745140 | 226 |
| 87 | iso_pu_bacteria | 2935750917 | 2935755283 | 226 |
| 88 | iso_pu_bacteria | 2935769743 | 2935773577 | 226 |
| 89 | iso_pu_bacteria | 2935777560 | 2935784519 | 226 |
| 90 | iso_pu_bacteria | 2935785616 | 2935788518 | 226 |
| 91 | iso_pu_bacteria | 2935793552 | 2935796674 | 226 |
| 92 | iso_pu_bacteria | 2935801545 | 2935803699 | 226 |
| 93 | iso_pu_bacteria | 2935819856 | 2935824174 | 226 |
| 94 | iso_pu_bacteria | 2935827899 | 2935829486 | 226 |
| 95 | iso_pu_bacteria | 2935837841 | 2935842537 | 226 |
| 96 | iso_pu_bacteria | 2935847175 | 2935852679 | 226 |
| 97 | iso_pu_bacteria | 2935855204 | 2935858728 | 226 |
| 98 | iso_pu_bacteria | 2935864058 | 2935866850 | 226 |
| 99 | iso_pu_bacteria | 2935873716 | 2935876981 | 226 |
| 100 | iso_pu_bacteria | 2935908558 | 2935912167 | 226 |
| 101 | iso_pu_bacteria | 2935916978 | 2935922380 | 226 |
| 102 | iso_pu_bacteria | 2935926038 | 2935929196 | 226 |
| 103 | iso_pu_bacteria | 2935934488 | 2935935827 | 226 |
| 104 | iso_pu_bacteria | 2935942939 | 2935947393 | 226 |
| 105 | iso_pu_bacteria | 2935951376 | 2935953513 | 226 |
| 106 | iso_pu_bacteria | 2935959822 | 2935961977 | 226 |
| 107 | iso_pu_bacteria | 2935967501 | 2935968539 | 226 |
| 108 | iso_pu_bacteria | 2935984226 | 2935990656 | 226 |
| 109 | iso_pu_bacteria | 2936002035 | 2936004274 | 226 |
| 110 | iso_pu_bacteria | 2936011229 | 2936015422 | 226 |
| 111 | iso_pu_bacteria | 2936019824 | 2936024056 | 226 |
| 112 | iso_pu_bacteria | 2936028420 | 2936033071 | 226 |
| 113 | iso_pu_bacteria | 2936046547 | 2936051164 | 226 |
| 114 | iso_pu_bacteria | 2936055302 | 2936058541 | 226 |
| 115 | iso_pu_bacteria | 2940556831 | 2940561436 | 226 |
| 116 | iso_pu_bacteria | 2941538514 | 2941544616 | 226 |
| 117 | iso_pu_bacteria | 3005718088 | 3005719605 | 226 |
| 118 | iso_pu_bacteria | 8016511872 | 8016516512 | 226 |
| 119 | iso_pu_bacteria | 8016530956 | 8016537451 | 226 |
| 120 | iso_pu_bacteria | 8016539877 | 8016541722 | 226 |
| 121 | iso_pu_bacteria | 8016566248 | 8016567108 | 226 |
| 122 | iso_pu_bacteria | 8016575299 | 8016579827 | 226 |
| 123 | iso_pu_bacteria | 8016595262 | 8016597864 | 226 |
| 124 | iso_pu_bacteria | 8016603502 | 8016604002 | 226 |
| 125 | iso_pu_bacteria | 8016613128 | 8016620583 | 226 |
| 126 | iso_pu_bacteria | 8016622563 | 8016629408 | 226 |
| 127 | iso_pu_bacteria | 8016630954 | 8016633921 | 226 |
| 128 | iso_pu_bacteria | 8017057580 | 8017060028 | 226 |
| 129 | iso_pu_bacteria | 8019530166 | 8019537135 | 226 |
| 130 | iso_pu_bacteria | 8019538911 | 8019542412 | 226 |
| 131 | iso_pu_bacteria | 8019547302 | 8019548346 | 226 |
| 132 | iso_pu_bacteria | 8019576017 | 8019579532 | 226 |
| 133 | iso_pu_bacteria | 8019586578 | 8019587242 | 226 |
| 134 | iso_pu_bacteria | 8019597564 | 8019604096 | 226 |
| 135 | iso_pu_bacteria | 8019608314 | 8019614433 | 226 |
| 136 | iso_pu_bacteria | 8019687851 | 8019694192 | 226 |
| 137 | iso_pu_bacteria | 8056967851 | 8056969645 | 226 |
| 138 | 3300050494 | nmdc:mga06z11_13060_c1 | nmdc:mga06z11_13060_c1_139_825 | 227 |
| 139 | 3300005577 | Ga0068857_100031867 | Ga0068857_1000318674 | 229 |
| 140 | 3300009545 | Ga0105237_10487599 | Ga0105237_104875992 | 229 |
| 141 | 3300009551 | Ga0105238_10933843 | Ga0105238_109338431 | 229 |
| 142 | 3300025302 | Ga0207426_1059801 | Ga0207426_10598012 | 229 |
| 143 | 3300026116 | Ga0207674_10027595 | Ga0207674_100275955 | 229 |
| 144 | 3300042013 | Ga0439456_049285 | Ga0439456_049285_168_857 | 229 |
| 145 | 3300042461 | Ga0439460_0097950 | Ga0439460_0097950_189_878 | 229 |
| 146 | 3300045976 | Ga0466967_0115901 | Ga0466967_0115901_1683_2378 | 229 |
| 147 | 3300047317 | Ga0495604_0167937 | Ga0495604_0167937_22_741 | 229 |
| 148 | 3300061734 | Ga0530510_0094293 | Ga0530510_0094293_257_946 | 229 |
| 149 | 3300003320 | rootH2_10028247 | rootH2_100282472 | 230 |
| 150 | 3300003659 | JGI25404J52841_10027507 | JGI25404J52841_100275071 | 230 |
| 151 | 3300005295 | Ga0065707_10305448 | Ga0065707_103054481 | 230 |
| 152 | 3300005327 | Ga0070658_10200690 | Ga0070658_102006902 | 230 |
| 153 | 3300005329 | Ga0070683_100146343 | Ga0070683_1001463432 | 230 |
| 154 | 3300005329 | Ga0070683_100656872 | Ga0070683_1006568722 | 230 |
| 155 | 3300005331 | Ga0070670_100002724 | Ga0070670_1000027247 | 230 |
| 156 | 3300005331 | Ga0070670_100275170 | Ga0070670_1002751702 | 230 |
| 157 | 3300005334 | Ga0068869_100040507 | Ga0068869_1000405073 | 230 |
| 158 | 3300005336 | Ga0070680_100451117 | Ga0070680_1004511171 | 230 |
| 159 | 3300005337 | Ga0070682_100012744 | Ga0070682_1000127442 | 230 |
| 160 | 3300005337 | Ga0070682_100266355 | Ga0070682_1002663551 | 230 |
| 161 | 3300005337 | Ga0070682_100408638 | Ga0070682_1004086381 | 230 |
| 162 | 3300005338 | Ga0068868_100143996 | Ga0068868_1001439963 | 230 |
| 163 | 3300005339 | Ga0070660_100130480 | Ga0070660_1001304802 | 230 |
| 164 | 3300005340 | Ga0070689_100058900 | Ga0070689_1000589002 | 230 |
| 165 | 3300005341 | Ga0070691_10080048 | Ga0070691_100800482 | 230 |
| 166 | 3300005341 | Ga0070691_10091580 | Ga0070691_100915802 | 230 |
| 167 | 3300005347 | Ga0070668_100045408 | Ga0070668_1000454085 | 230 |
| 168 | 3300005347 | Ga0070668_100102316 | Ga0070668_1001023162 | 230 |
| 169 | 3300005347 | Ga0070668_100115575 | Ga0070668_1001155752 | 230 |
| 170 | 3300005355 | Ga0070671_100001622 | Ga0070671_1000016228 | 230 |
| 171 | 3300005355 | Ga0070671_100264152 | Ga0070671_1002641521 | 230 |
| 172 | 3300005364 | Ga0070673_100044017 | Ga0070673_1000440173 | 230 |
| 173 | 3300005367 | Ga0070667_100392065 | Ga0070667_1003920651 | 230 |
| 174 | 3300005367 | Ga0070667_100645944 | Ga0070667_1006459441 | 230 |
| 175 | 3300005434 | Ga0070709_10164477 | Ga0070709_101644772 | 230 |
| 176 | 3300005435 | Ga0070714_100063519 | Ga0070714_1000635192 | 230 |
| 177 | 3300005436 | Ga0070713_100039420 | Ga0070713_1000394205 | 230 |
| 178 | 3300005436 | Ga0070713_100064482 | Ga0070713_1000644823 | 230 |
| 179 | 3300005436 | Ga0070713_100093832 | Ga0070713_1000938322 | 230 |
| 180 | 3300005436 | Ga0070713_100934834 | Ga0070713_1009348341 | 230 |
| 181 | 3300005437 | Ga0070710_10017367 | Ga0070710_100173672 | 230 |
| 182 | 3300005437 | Ga0070710_10035714 | Ga0070710_100357142 | 230 |
| 183 | 3300005437 | Ga0070710_10380793 | Ga0070710_103807931 | 230 |
| 184 | 3300005438 | Ga0070701_10239926 | Ga0070701_102399261 | 230 |
| 185 | 3300005439 | Ga0070711_100010047 | Ga0070711_1000100478 | 230 |
| 186 | 3300005439 | Ga0070711_100404802 | Ga0070711_1004048022 | 230 |
| 187 | 3300005445 | Ga0070708_100335683 | Ga0070708_1003356831 | 230 |
| 188 | 3300005455 | Ga0070663_100017934 | Ga0070663_1000179345 | 230 |
| 189 | 3300005455 | Ga0070663_100063699 | Ga0070663_1000636991 | 230 |
| 190 | 3300005455 | Ga0070663_100087030 | Ga0070663_1000870302 | 230 |
| 191 | 3300005456 | Ga0070678_100056739 | Ga0070678_1000567392 | 230 |
| 192 | 3300005456 | Ga0070678_100237225 | Ga0070678_1002372251 | 230 |
| 193 | 3300005457 | Ga0070662_100195506 | Ga0070662_1001955061 | 230 |
| 194 | 3300005458 | Ga0070681_10008226 | Ga0070681_1000822615 | 230 |
| 195 | 3300005458 | Ga0070681_10056108 | Ga0070681_100561083 | 230 |
| 196 | 3300005458 | Ga0070681_10157638 | Ga0070681_101576383 | 230 |
| 197 | 3300005458 | Ga0070681_10162326 | Ga0070681_101623262 | 230 |
| 198 | 3300005467 | Ga0070706_100035478 | Ga0070706_1000354782 | 230 |
| 199 | 3300005471 | Ga0070698_100105128 | Ga0070698_1001051282 | 230 |
| 200 | 3300005518 | Ga0070699_100004291 | Ga0070699_10000429113 | 230 |
| 201 | 3300005530 | Ga0070679_100023223 | Ga0070679_10002322311 | 230 |
| 202 | 3300005530 | Ga0070679_100039928 | Ga0070679_1000399284 | 230 |
| 203 | 3300005530 | Ga0070679_100213053 | Ga0070679_1002130531 | 230 |
| 204 | 3300005535 | Ga0070684_100758929 | Ga0070684_1007589291 | 230 |
| 205 | 3300005536 | Ga0070697_100040568 | Ga0070697_1000405684 | 230 |
| 206 | 3300005539 | Ga0068853_100179252 | Ga0068853_1001792523 | 230 |
| 207 | 3300005543 | Ga0070672_100306571 | Ga0070672_1003065712 | 230 |
| 208 | 3300005544 | Ga0070686_100099082 | Ga0070686_1000990821 | 230 |
| 209 | 3300005547 | Ga0070693_100130027 | Ga0070693_1001300272 | 230 |
| 210 | 3300005547 | Ga0070693_100170425 | Ga0070693_1001704252 | 230 |
| 211 | 3300005547 | Ga0070693_100178127 | Ga0070693_1001781271 | 230 |
| 212 | 3300005548 | Ga0070665_100005813 | Ga0070665_1000058135 | 230 |
| 213 | 3300005548 | Ga0070665_100152404 | Ga0070665_1001524043 | 230 |
| 214 | 3300005563 | Ga0068855_100132560 | Ga0068855_1001325602 | 230 |
| 215 | 3300005564 | Ga0070664_100743647 | Ga0070664_1007436471 | 230 |
| 216 | 3300005578 | Ga0068854_100185586 | Ga0068854_1001855862 | 230 |
| 217 | 3300005614 | Ga0068856_100607371 | Ga0068856_1006073711 | 230 |
| 218 | 3300005614 | Ga0068856_100848407 | Ga0068856_1008484071 | 230 |
| 219 | 3300005616 | Ga0068852_100180838 | Ga0068852_1001808382 | 230 |
| 220 | 3300005616 | Ga0068852_100621572 | Ga0068852_1006215722 | 230 |
| 221 | 3300005617 | Ga0068859_100124845 | Ga0068859_1001248453 | 230 |
| 222 | 3300005618 | Ga0068864_100526009 | Ga0068864_1005260092 | 230 |
| 223 | 3300005718 | Ga0068866_10066524 | Ga0068866_100665243 | 230 |
| 224 | 3300005719 | Ga0068861_100223271 | Ga0068861_1002232712 | 230 |
| 225 | 3300005841 | Ga0068863_100321751 | Ga0068863_1003217512 | 230 |
| 226 | 3300005842 | Ga0068858_100224480 | Ga0068858_1002244802 | 230 |
| 227 | 3300005843 | Ga0068860_100193494 | Ga0068860_1001934942 | 230 |
| 228 | 3300005844 | Ga0068862_100131061 | Ga0068862_1001310612 | 230 |
| 229 | 3300005937 | Ga0081455_10000227 | Ga0081455_1000022728 | 230 |
| 230 | 3300005937 | Ga0081455_10002386 | Ga0081455_1000238623 | 230 |
| 231 | 3300005937 | Ga0081455_10007051 | Ga0081455_100070516 | 230 |
| 232 | 3300005937 | Ga0081455_10014446 | Ga0081455_100144461 | 230 |
| 233 | 3300005937 | Ga0081455_10019827 | Ga0081455_100198273 | 230 |
| 234 | 3300005937 | Ga0081455_10043015 | Ga0081455_100430156 | 230 |
| 235 | 3300005981 | Ga0081538_10032257 | Ga0081538_100322573 | 230 |
| 236 | 3300005983 | Ga0081540_1000099 | Ga0081540_100009938 | 230 |
| 237 | 3300005983 | Ga0081540_1002490 | Ga0081540_10024902 | 230 |
| 238 | 3300005983 | Ga0081540_1042412 | Ga0081540_10424124 | 230 |
| 239 | 3300005983 | Ga0081540_1044297 | Ga0081540_10442971 | 230 |
| 240 | 3300005983 | Ga0081540_1059942 | Ga0081540_10599422 | 230 |
| 241 | 3300005983 | Ga0081540_1080010 | Ga0081540_10800102 | 230 |
| 242 | 3300005983 | Ga0081540_1138740 | Ga0081540_11387401 | 230 |
| 243 | 3300005985 | Ga0081539_10025006 | Ga0081539_100250067 | 230 |
| 244 | 3300006028 | Ga0070717_10000895 | Ga0070717_100008952 | 230 |
| 245 | 3300006028 | Ga0070717_10008142 | Ga0070717_100081423 | 230 |
| 246 | 3300006028 | Ga0070717_10042605 | Ga0070717_100426051 | 230 |
| 247 | 3300006028 | Ga0070717_10058356 | Ga0070717_100583563 | 230 |
| 248 | 3300006028 | Ga0070717_10063182 | Ga0070717_100631824 | 230 |
| 249 | 3300006028 | Ga0070717_10069176 | Ga0070717_100691762 | 230 |
| 250 | 3300006028 | Ga0070717_10147787 | Ga0070717_101477872 | 230 |
| 251 | 3300006028 | Ga0070717_10163763 | Ga0070717_101637633 | 230 |
| 252 | 3300006038 | Ga0075365_10026360 | Ga0075365_100263602 | 230 |
| 253 | 3300006038 | Ga0075365_10028679 | Ga0075365_100286795 | 230 |
| 254 | 3300006038 | Ga0075365_10099836 | Ga0075365_100998362 | 230 |
| 255 | 3300006038 | Ga0075365_10278175 | Ga0075365_102781752 | 230 |
| 256 | 3300006042 | Ga0075368_10042960 | Ga0075368_100429602 | 230 |
| 257 | 3300006048 | Ga0075363_100126406 | Ga0075363_1001264062 | 230 |
| 258 | 3300006048 | Ga0075363_100309072 | Ga0075363_1003090721 | 230 |
| 259 | 3300006051 | Ga0075364_10040862 | Ga0075364_100408623 | 230 |
| 260 | 3300006051 | Ga0075364_10087071 | Ga0075364_100870712 | 230 |
| 261 | 3300006163 | Ga0070715_10130893 | Ga0070715_101308931 | 230 |
| 262 | 3300006163 | Ga0070715_10163309 | Ga0070715_101633091 | 230 |
| 263 | 3300006163 | Ga0070715_10273906 | Ga0070715_102739061 | 230 |
| 264 | 3300006173 | Ga0070716_100184947 | Ga0070716_1001849471 | 230 |
| 265 | 3300006173 | Ga0070716_100432576 | Ga0070716_1004325761 | 230 |
| 266 | 3300006175 | Ga0070712_100147218 | Ga0070712_1001472182 | 230 |
| 267 | 3300006175 | Ga0070712_100164924 | Ga0070712_1001649242 | 230 |
| 268 | 3300006177 | Ga0075362_10191814 | Ga0075362_101918141 | 230 |
| 269 | 3300006178 | Ga0075367_10010099 | Ga0075367_100100995 | 230 |
| 270 | 3300006178 | Ga0075367_10013716 | Ga0075367_100137164 | 230 |
| 271 | 3300006178 | Ga0075367_10451172 | Ga0075367_104511721 | 230 |
| 272 | 3300006186 | Ga0075369_10151354 | Ga0075369_101513542 | 230 |
| 273 | 3300006195 | Ga0075366_10125556 | Ga0075366_101255563 | 230 |
| 274 | 3300006237 | Ga0097621_100458819 | Ga0097621_1004588192 | 230 |
| 275 | 3300006237 | Ga0097621_100747993 | Ga0097621_1007479931 | 230 |
| 276 | 3300006353 | Ga0075370_10005125 | Ga0075370_100051252 | 230 |
| 277 | 3300006353 | Ga0075370_10010731 | Ga0075370_100107313 | 230 |
| 278 | 3300006353 | Ga0075370_10325207 | Ga0075370_103252072 | 230 |
| 279 | 3300006358 | Ga0068871_100022452 | Ga0068871_1000224523 | 230 |
| 280 | 3300006844 | Ga0075428_100003372 | Ga0075428_10000337216 | 230 |
| 281 | 3300006844 | Ga0075428_100152509 | Ga0075428_1001525092 | 230 |
| 282 | 3300006844 | Ga0075428_100393302 | Ga0075428_1003933022 | 230 |
| 283 | 3300006846 | Ga0075430_100001211 | Ga0075430_1000012112 | 230 |
| 284 | 3300006846 | Ga0075430_100020849 | Ga0075430_1000208493 | 230 |
| 285 | 3300006847 | Ga0075431_100001495 | Ga0075431_1000014955 | 230 |
| 286 | 3300006847 | Ga0075431_100065085 | Ga0075431_1000650855 | 230 |
| 287 | 3300006847 | Ga0075431_100452409 | Ga0075431_1004524092 | 230 |
| 288 | 3300006852 | Ga0075433_10027057 | Ga0075433_100270575 | 230 |
| 289 | 3300006852 | Ga0075433_10078430 | Ga0075433_100784303 | 230 |
| 290 | 3300006852 | Ga0075433_10480241 | Ga0075433_104802412 | 230 |
| 291 | 3300006871 | Ga0075434_100099957 | Ga0075434_1000999571 | 230 |
| 292 | 3300006871 | Ga0075434_100173104 | Ga0075434_1001731041 | 230 |
| 293 | 3300006871 | Ga0075434_100251039 | Ga0075434_1002510392 | 230 |
| 294 | 3300006880 | Ga0075429_100004770 | Ga0075429_1000047706 | 230 |
| 295 | 3300006880 | Ga0075429_100115583 | Ga0075429_1001155833 | 230 |
| 296 | 3300006914 | Ga0075436_100015554 | Ga0075436_1000155544 | 230 |
| 297 | 3300006914 | Ga0075436_100279843 | Ga0075436_1002798431 | 230 |
| 298 | 3300006931 | Ga0097620_100124846 | Ga0097620_1001248462 | 230 |
| 299 | 3300007076 | Ga0075435_100140860 | Ga0075435_1001408602 | 230 |
| 300 | 3300007076 | Ga0075435_100408255 | Ga0075435_1004082551 | 230 |
| 301 | 3300009093 | Ga0105240_10010565 | Ga0105240_1001056511 | 230 |
| 302 | 3300009094 | Ga0111539_10001922 | Ga0111539_1000192215 | 230 |
| 303 | 3300009094 | Ga0111539_10058559 | Ga0111539_100585593 | 230 |
| 304 | 3300009094 | Ga0111539_10347643 | Ga0111539_103476432 | 230 |
| 305 | 3300009094 | Ga0111539_11126531 | Ga0111539_111265311 | 230 |
| 306 | 3300009098 | Ga0105245_10692637 | Ga0105245_106926372 | 230 |
| 307 | 3300009101 | Ga0105247_10077572 | Ga0105247_100775722 | 230 |
| 308 | 3300009147 | Ga0114129_10000170 | Ga0114129_1000017038 | 230 |
| 309 | 3300009147 | Ga0114129_10434751 | Ga0114129_104347513 | 230 |
| 310 | 3300009147 | Ga0114129_10490105 | Ga0114129_104901052 | 230 |
| 311 | 3300009147 | Ga0114129_10614156 | Ga0114129_106141561 | 230 |
| 312 | 3300009176 | Ga0105242_10311142 | Ga0105242_103111422 | 230 |
| 313 | 3300009176 | Ga0105242_10514350 | Ga0105242_105143501 | 230 |
| 314 | 3300009177 | Ga0105248_10059889 | Ga0105248_100598891 | 230 |
| 315 | 3300009545 | Ga0105237_10062535 | Ga0105237_100625353 | 230 |
| 316 | 3300009545 | Ga0105237_10314527 | Ga0105237_103145272 | 230 |
| 317 | 3300009545 | Ga0105237_10467588 | Ga0105237_104675882 | 230 |
| 318 | 3300009551 | Ga0105238_10213366 | Ga0105238_102133662 | 230 |
| 319 | 3300009551 | Ga0105238_10616479 | Ga0105238_106164792 | 230 |
| 320 | 3300009551 | Ga0105238_10751049 | Ga0105238_107510492 | 230 |
| 321 | 3300009553 | Ga0105249_10179723 | Ga0105249_101797233 | 230 |
| 322 | 3300010375 | Ga0105239_10122697 | Ga0105239_101226974 | 230 |
| 323 | 3300010375 | Ga0105239_10172832 | Ga0105239_101728322 | 230 |
| 324 | 3300010375 | Ga0105239_10293053 | Ga0105239_102930532 | 230 |
| 325 | 3300010375 | Ga0105239_10323382 | Ga0105239_103233822 | 230 |
| 326 | 3300010375 | Ga0105239_10359454 | Ga0105239_103594542 | 230 |
| 327 | 3300011119 | Ga0105246_10051839 | Ga0105246_100518392 | 230 |
| 328 | 3300011119 | Ga0105246_10091520 | Ga0105246_100915202 | 230 |
| 329 | 3300011119 | Ga0105246_10167963 | Ga0105246_101679631 | 230 |
| 330 | 3300013104 | Ga0157370_10178684 | Ga0157370_101786842 | 230 |
| 331 | 3300013104 | Ga0157370_10352481 | Ga0157370_103524812 | 230 |
| 332 | 3300013105 | Ga0157369_10021893 | Ga0157369_100218939 | 230 |
| 333 | 3300013296 | Ga0157374_10161013 | Ga0157374_101610131 | 230 |
| 334 | 3300013296 | Ga0157374_10755476 | Ga0157374_107554762 | 230 |
| 335 | 3300013297 | Ga0157378_10554981 | Ga0157378_105549812 | 230 |
| 336 | 3300013306 | Ga0163162_10152800 | Ga0163162_101528002 | 230 |
| 337 | 3300013307 | Ga0157372_10089010 | Ga0157372_100890103 | 230 |
| 338 | 3300013307 | Ga0157372_10783253 | Ga0157372_107832532 | 230 |
| 339 | 3300013307 | Ga0157372_11369876 | Ga0157372_113698761 | 230 |
| 340 | 3300013308 | Ga0157375_10801305 | Ga0157375_108013052 | 230 |
| 341 | 3300014325 | Ga0163163_10029708 | Ga0163163_100297082 | 230 |
| 342 | 3300014325 | Ga0163163_10147746 | Ga0163163_101477463 | 230 |
| 343 | 3300014325 | Ga0163163_10235335 | Ga0163163_102353352 | 230 |
| 344 | 3300014326 | Ga0157380_10064387 | Ga0157380_100643873 | 230 |
| 345 | 3300014326 | Ga0157380_10437610 | Ga0157380_104376102 | 230 |
| 346 | 3300014968 | Ga0157379_10206485 | Ga0157379_102064851 | 230 |
| 347 | 3300014969 | Ga0157376_10100881 | Ga0157376_101008812 | 230 |
| 348 | 3300014969 | Ga0157376_10140860 | Ga0157376_101408603 | 230 |
| 349 | 3300014969 | Ga0157376_10471469 | Ga0157376_104714692 | 230 |
| 350 | 3300017792 | Ga0163161_10326359 | Ga0163161_103263591 | 230 |
| 351 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001268 | 230 |
| 352 | 3300021320 | Ga0214544_1020777 | Ga0214544_10207776 | 230 |
| 353 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005268 | 230 |
| 354 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003496 | 230 |
| 355 | 3300021324 | Ga0214545_1013953 | Ga0214545_10139534 | 230 |
| 356 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002269 | 230 |
| 357 | 3300024225 | Ga0224572_1042443 | Ga0224572_10424431 | 230 |
| 358 | 3300025254 | Ga0209148_1000253 | Ga0209148_100025332 | 230 |
| 359 | 3300025272 | Ga0209455_1001670 | Ga0209455_10016709 | 230 |
| 360 | 3300025901 | Ga0207688_10078323 | Ga0207688_100783231 | 230 |
| 361 | 3300025903 | Ga0207680_10098431 | Ga0207680_100984312 | 230 |
| 362 | 3300025905 | Ga0207685_10066216 | Ga0207685_100662162 | 230 |
| 363 | 3300025905 | Ga0207685_10067789 | Ga0207685_100677892 | 230 |
| 364 | 3300025906 | Ga0207699_10003139 | Ga0207699_100031391 | 230 |
| 365 | 3300025906 | Ga0207699_10031686 | Ga0207699_100316863 | 230 |
| 366 | 3300025910 | Ga0207684_10030611 | Ga0207684_100306117 | 230 |
| 367 | 3300025911 | Ga0207654_10038930 | Ga0207654_100389301 | 230 |
| 368 | 3300025912 | Ga0207707_10001008 | Ga0207707_1000100824 | 230 |
| 369 | 3300025912 | Ga0207707_10028450 | Ga0207707_100284502 | 230 |
| 370 | 3300025912 | Ga0207707_10309467 | Ga0207707_103094671 | 230 |
| 371 | 3300025914 | Ga0207671_10100582 | Ga0207671_101005822 | 230 |
| 372 | 3300025914 | Ga0207671_10131838 | Ga0207671_101318382 | 230 |
| 373 | 3300025915 | Ga0207693_10016343 | Ga0207693_100163432 | 230 |
| 374 | 3300025915 | Ga0207693_10102352 | Ga0207693_101023522 | 230 |
| 375 | 3300025915 | Ga0207693_10107498 | Ga0207693_101074982 | 230 |
| 376 | 3300025915 | Ga0207693_10115637 | Ga0207693_101156372 | 230 |
| 377 | 3300025915 | Ga0207693_10159007 | Ga0207693_101590072 | 230 |
| 378 | 3300025916 | Ga0207663_10000176 | Ga0207663_100001769 | 230 |
| 379 | 3300025916 | Ga0207663_10005873 | Ga0207663_100058733 | 230 |
| 380 | 3300025916 | Ga0207663_10356415 | Ga0207663_103564151 | 230 |
| 381 | 3300025916 | Ga0207663_10371044 | Ga0207663_103710442 | 230 |
| 382 | 3300025917 | Ga0207660_10066272 | Ga0207660_100662723 | 230 |
| 383 | 3300025917 | Ga0207660_10244469 | Ga0207660_102444692 | 230 |
| 384 | 3300025920 | Ga0207649_10471870 | Ga0207649_104718701 | 230 |
| 385 | 3300025921 | Ga0207652_10003168 | Ga0207652_1000316810 | 230 |
| 386 | 3300025921 | Ga0207652_10102428 | Ga0207652_101024281 | 230 |
| 387 | 3300025922 | Ga0207646_10383587 | Ga0207646_103835872 | 230 |
| 388 | 3300025924 | Ga0207694_10171119 | Ga0207694_101711193 | 230 |
| 389 | 3300025924 | Ga0207694_10788624 | Ga0207694_107886241 | 230 |
| 390 | 3300025925 | Ga0207650_10005078 | Ga0207650_100050789 | 230 |
| 391 | 3300025926 | Ga0207659_10396611 | Ga0207659_103966112 | 230 |
| 392 | 3300025927 | Ga0207687_10121184 | Ga0207687_101211842 | 230 |
| 393 | 3300025928 | Ga0207700_10004711 | Ga0207700_100047112 | 230 |
| 394 | 3300025928 | Ga0207700_10071083 | Ga0207700_100710831 | 230 |
| 395 | 3300025928 | Ga0207700_10080128 | Ga0207700_100801282 | 230 |
| 396 | 3300025928 | Ga0207700_10111884 | Ga0207700_101118842 | 230 |
| 397 | 3300025928 | Ga0207700_10278264 | Ga0207700_102782641 | 230 |
| 398 | 3300025929 | Ga0207664_10432393 | Ga0207664_104323932 | 230 |
| 399 | 3300025931 | Ga0207644_10032854 | Ga0207644_100328544 | 230 |
| 400 | 3300025934 | Ga0207686_10636689 | Ga0207686_106366891 | 230 |
| 401 | 3300025936 | Ga0207670_10153331 | Ga0207670_101533312 | 230 |
| 402 | 3300025937 | Ga0207669_10372645 | Ga0207669_103726452 | 230 |
| 403 | 3300025939 | Ga0207665_10036681 | Ga0207665_100366812 | 230 |
| 404 | 3300025939 | Ga0207665_10177424 | Ga0207665_101774243 | 230 |
| 405 | 3300025939 | Ga0207665_10215327 | Ga0207665_102153271 | 230 |
| 406 | 3300025940 | Ga0207691_10372723 | Ga0207691_103727231 | 230 |
| 407 | 3300025941 | Ga0207711_10174233 | Ga0207711_101742332 | 230 |
| 408 | 3300025941 | Ga0207711_10797363 | Ga0207711_107973631 | 230 |
| 409 | 3300025942 | Ga0207689_10052872 | Ga0207689_100528723 | 230 |
| 410 | 3300025942 | Ga0207689_10466343 | Ga0207689_104663432 | 230 |
| 411 | 3300025945 | Ga0207679_10267936 | Ga0207679_102679361 | 230 |
| 412 | 3300025945 | Ga0207679_10547672 | Ga0207679_105476722 | 230 |
| 413 | 3300025945 | Ga0207679_10617170 | Ga0207679_106171701 | 230 |
| 414 | 3300025949 | Ga0207667_10022616 | Ga0207667_100226164 | 230 |
| 415 | 3300025949 | Ga0207667_10236509 | Ga0207667_102365093 | 230 |
| 416 | 3300025960 | Ga0207651_10187315 | Ga0207651_101873152 | 230 |
| 417 | 3300025961 | Ga0207712_10089281 | Ga0207712_100892812 | 230 |
| 418 | 3300025972 | Ga0207668_10052856 | Ga0207668_100528561 | 230 |
| 419 | 3300025981 | Ga0207640_10216643 | Ga0207640_102166432 | 230 |
| 420 | 3300026023 | Ga0207677_10103539 | Ga0207677_101035393 | 230 |
| 421 | 3300026023 | Ga0207677_10110142 | Ga0207677_101101423 | 230 |
| 422 | 3300026035 | Ga0207703_10030186 | Ga0207703_100301865 | 230 |
| 423 | 3300026035 | Ga0207703_10255840 | Ga0207703_102558403 | 230 |
| 424 | 3300026041 | Ga0207639_10131532 | Ga0207639_101315322 | 230 |
| 425 | 3300026067 | Ga0207678_10009140 | Ga0207678_100091406 | 230 |
| 426 | 3300026067 | Ga0207678_10020284 | Ga0207678_100202845 | 230 |
| 427 | 3300026067 | Ga0207678_10044698 | Ga0207678_100446984 | 230 |
| 428 | 3300026067 | Ga0207678_10060513 | Ga0207678_100605134 | 230 |
| 429 | 3300026075 | Ga0207708_10317722 | Ga0207708_103177222 | 230 |
| 430 | 3300026078 | Ga0207702_10206469 | Ga0207702_102064691 | 230 |
| 431 | 3300026078 | Ga0207702_10585384 | Ga0207702_105853842 | 230 |
| 432 | 3300026089 | Ga0207648_10086563 | Ga0207648_100865633 | 230 |
| 433 | 3300026095 | Ga0207676_10229815 | Ga0207676_102298152 | 230 |
| 434 | 3300026095 | Ga0207676_10770580 | Ga0207676_107705802 | 230 |
| 435 | 3300026118 | Ga0207675_100318339 | Ga0207675_1003183392 | 230 |
| 436 | 3300026121 | Ga0207683_10077845 | Ga0207683_100778454 | 230 |
| 437 | 3300026142 | Ga0207698_10105611 | Ga0207698_101056113 | 230 |
| 438 | 3300027361 | Ga0209489_100385 | Ga0209489_10038558 | 230 |
| 439 | 3300027363 | Ga0209700_100013 | Ga0209700_10001331 | 230 |
| 440 | 3300027907 | Ga0207428_10002205 | Ga0207428_1000220514 | 230 |
| 441 | 3300028379 | Ga0268266_10000670 | Ga0268266_100006709 | 230 |
| 442 | 3300028379 | Ga0268266_10026030 | Ga0268266_100260303 | 230 |
| 443 | 3300028379 | Ga0268266_10109961 | Ga0268266_101099611 | 230 |
| 444 | 3300028381 | Ga0268264_10118230 | Ga0268264_101182302 | 230 |
| 445 | 3300028573 | Ga0265334_10106273 | Ga0265334_101062732 | 230 |
| 446 | 3300031235 | Ga0265330_10004363 | Ga0265330_100043633 | 230 |
| 447 | 3300031238 | Ga0265332_10000106 | Ga0265332_1000010641 | 230 |
| 448 | 3300031239 | Ga0265328_10000333 | Ga0265328_1000033316 | 230 |
| 449 | 3300031241 | Ga0265325_10161933 | Ga0265325_101619332 | 230 |
| 450 | 3300031242 | Ga0265329_10004026 | Ga0265329_100040264 | 230 |
| 451 | 3300031247 | Ga0265340_10033578 | Ga0265340_100335783 | 230 |
| 452 | 3300031247 | Ga0265340_10042217 | Ga0265340_100422172 | 230 |
| 453 | 3300031249 | Ga0265339_10180646 | Ga0265339_101806462 | 230 |
| 454 | 3300031250 | Ga0265331_10000074 | Ga0265331_1000007423 | 230 |
| 455 | 3300031250 | Ga0265331_10011481 | Ga0265331_100114815 | 230 |
| 456 | 3300031251 | Ga0265327_10111438 | Ga0265327_101114382 | 230 |
| 457 | 3300031344 | Ga0265316_10000037 | Ga0265316_1000003723 | 230 |
| 458 | 3300031595 | Ga0265313_10002554 | Ga0265313_100025549 | 230 |
| 459 | 3300031711 | Ga0265314_10001545 | Ga0265314_1000154519 | 230 |
| 460 | 3300031711 | Ga0265314_10003230 | Ga0265314_1000323016 | 230 |
| 461 | 3300031711 | Ga0265314_10078333 | Ga0265314_100783332 | 230 |
| 462 | 3300031712 | Ga0265342_10000473 | Ga0265342_1000047322 | 230 |
| 463 | 3300031731 | Ga0307405_10093321 | Ga0307405_100933213 | 230 |
| 464 | 3300031824 | Ga0307413_10358918 | Ga0307413_103589182 | 230 |
| 465 | 3300031903 | Ga0307407_10536995 | Ga0307407_105369951 | 230 |
| 466 | 3300031995 | Ga0307409_100020254 | Ga0307409_1000202545 | 230 |
| 467 | 3300032002 | Ga0307416_100730541 | Ga0307416_1007305412 | 230 |
| 468 | 3300032005 | Ga0307411_10056323 | Ga0307411_100563234 | 230 |
| 469 | 3300032126 | Ga0307415_100016685 | Ga0307415_1000166853 | 230 |
| 470 | 3300032126 | Ga0307415_100136824 | Ga0307415_1001368243 | 230 |
| 471 | 3300033180 | Ga0307510_10037129 | Ga0307510_100371295 | 230 |
| 472 | 3300033180 | Ga0307510_10098175 | Ga0307510_100981754 | 230 |
| 473 | 3300033442 | Ga0315911_1000011 | Ga0315911_1000011118 | 230 |
| 474 | 3300034820 | Ga0373959_0028355 | Ga0373959_0028355_281_979 | 230 |
| 475 | 3300035083 | Ga0373926_0033752 | Ga0373926_0033752_365_1063 | 230 |
| 476 | 3300035086 | Ga0373934_0036665 | Ga0373934_0036665_288_980 | 230 |
| 477 | 3300035090 | Ga0373949_0004015 | Ga0373949_0004015_653_1351 | 230 |
| 478 | 3300035091 | Ga0373951_0003883 | Ga0373951_0003883_468_1166 | 230 |
| 479 | 3300035092 | Ga0373952_0009142 | Ga0373952_0009142_684_1382 | 230 |
| 480 | 3300035112 | Ga0373932_0004447 | Ga0373932_0004447_2225_2923 | 230 |
| 481 | 3300035113 | Ga0373936_0031239 | Ga0373936_0031239_993_1685 | 230 |
| 482 | 3300035113 | Ga0373936_0159721 | Ga0373936_0159721_99_797 | 230 |
| 483 | 3300035114 | Ga0373939_0001937 | Ga0373939_0001937_2158_2856 | 230 |
| 484 | 3300035115 | Ga0373941_0007347 | Ga0373941_0007347_656_1354 | 230 |
| 485 | 3300035116 | Ga0373945_0014672 | Ga0373945_0014672_587_1279 | 230 |
| 486 | 3300035116 | Ga0373945_0022918 | Ga0373945_0022918_102_800 | 230 |
| 487 | 3300035118 | Ga0373954_0041571 | Ga0373954_0041571_598_1290 | 230 |
| 488 | 3300035118 | Ga0373954_0062124 | Ga0373954_0062124_76_834 | 230 |
| 489 | 3300035121 | Ga0373960_0128651 | Ga0373960_0128651_72_770 | 230 |
| 490 | 3300035170 | Ga0373943_0021497 | Ga0373943_0021497_61_759 | 230 |
| 491 | 3300035170 | Ga0373943_0160679 | Ga0373943_0160679_445_1146 | 230 |
| 492 | 3300035171 | Ga0373946_0011011 | Ga0373946_0011011_442_1140 | 230 |
| 493 | 3300035171 | Ga0373946_0151310 | Ga0373946_0151310_181_882 | 230 |
| 494 | 3300035172 | Ga0373955_0017708 | Ga0373955_0017708_313_1071 | 230 |
| 495 | 3300035172 | Ga0373955_0063343 | Ga0373955_0063343_1224_1916 | 230 |
| 496 | 3300035172 | Ga0373955_0263014 | Ga0373955_0263014_180_881 | 230 |
| 497 | 3300035242 | Ga0373962_0005121 | Ga0373962_0005121_538_1236 | 230 |
| 498 | 3300035691 | Ga0373931_0017987 | Ga0373931_0017987_1797_2495 | 230 |
| 499 | 3300035692 | Ga0373935_0000359 | Ga0373935_0000359_21763_22461 | 230 |
| 500 | 3300035692 | Ga0373935_0015920 | Ga0373935_0015920_2380_3072 | 230 |
| 501 | 3300035692 | Ga0373935_0235732 | Ga0373935_0235732_26_730 | 230 |
| 502 | 3300035692 | Ga0373935_0539055 | Ga0373935_0539055_132_833 | 230 |
| 503 | 3300035695 | Ga0373927_0012622 | Ga0373927_0012622_4442_5200 | 230 |
| 504 | 3300035695 | Ga0373927_0042198 | Ga0373927_0042198_1924_2622 | 230 |
| 505 | 3300035724 | Ga0373933_0001892 | Ga0373933_0001892_4401_5159 | 230 |
| 506 | 3300035724 | Ga0373933_0568666 | Ga0373933_0568666_10_702 | 230 |
| 507 | 3300035725 | Ga0373947_0000490 | Ga0373947_0000490_6095_6793 | 230 |
| 508 | 3300035725 | Ga0373947_0014978 | Ga0373947_0014978_398_1156 | 230 |
| 509 | 3300035725 | Ga0373947_0063833 | Ga0373947_0063833_1188_1880 | 230 |
| 510 | 3300035725 | Ga0373947_0105860 | Ga0373947_0105860_295_1086 | 230 |
| 511 | 3300036401 | Ga0373937_0011820 | Ga0373937_0011820_6777_7535 | 230 |
| 512 | 3300036401 | Ga0373937_0113974 | Ga0373937_0113974_72_764 | 230 |
| 513 | 3300036401 | Ga0373937_0122815 | Ga0373937_0122815_913_1611 | 230 |
| 514 | 3300036401 | Ga0373937_0123962 | Ga0373937_0123962_181_873 | 230 |
| 515 | 3300036459 | Ga0372808_008576 | Ga0372808_008576_307_999 | 230 |
| 516 | 3300037068 | Ga0373925_0004226 | Ga0373925_0004226_2630_3328 | 230 |
| 517 | 3300037068 | Ga0373925_0064468 | Ga0373925_0064468_1434_2192 | 230 |
| 518 | 3300037068 | Ga0373925_0204720 | Ga0373925_0204720_705_1406 | 230 |
| 519 | 3300037068 | Ga0373925_0517504 | Ga0373925_0517504_174_875 | 230 |
| 520 | 3300037418 | Ga0395900_0006562 | Ga0395900_0006562_7815_8507 | 230 |
| 521 | 3300037466 | Ga0395898_0055110 | Ga0395898_0055110_955_1647 | 230 |
| 522 | 3300037466 | Ga0395898_0127296 | Ga0395898_0127296_506_1255 | 230 |
| 523 | 3300038443 | Ga0395901_0091033 | Ga0395901_0091033_2314_3006 | 230 |
| 524 | 3300038443 | Ga0395901_0226645 | Ga0395901_0226645_1001_1750 | 230 |
| 525 | 3300039437 | Ga0436365_1039646 | Ga0436365_1039646_188_880 | 230 |
| 526 | 3300039437 | Ga0436365_1540042 | Ga0436365_1540042_4754_5491 | 230 |
| 527 | 3300039447 | Ga0436361_0161816 | Ga0436361_0161816_173_868 | 230 |
| 528 | 3300039447 | Ga0436361_1082876 | Ga0436361_1082876_1283_1978 | 230 |
| 529 | 3300039453 | Ga0436362_0265151 | Ga0436362_0265151_2085_2780 | 230 |
| 530 | 3300039453 | Ga0436362_0443038 | Ga0436362_0443038_38_730 | 230 |
| 531 | 3300041413 | Ga0439465_0012372 | Ga0439465_0012372_653_1345 | 230 |
| 532 | 3300041451 | Ga0451791_1145985 | Ga0451791_1145985_190_882 | 230 |
| 533 | 3300041507 | Ga0451851_1218237 | Ga0451851_1218237_26_721 | 230 |
| 534 | 3300044683 | Ga0466965_0074731 | Ga0466965_0074731_734_1429 | 230 |
| 535 | 3300044694 | Ga0466963_0053342 | Ga0466963_0053342_1660_2352 | 230 |
| 536 | 3300045976 | Ga0466967_0018740 | Ga0466967_0018740_2881_3573 | 230 |
| 537 | 3300045976 | Ga0466967_0601992 | Ga0466967_0601992_24_716 | 230 |
| 538 | 3300046454 | Ga0495592_0165055 | Ga0495592_0165055_202_894 | 230 |
| 539 | 3300046454 | Ga0495592_0284011 | Ga0495592_0284011_135_893 | 230 |
| 540 | 3300046455 | Ga0495603_0010445 | Ga0495603_0010445_1187_1885 | 230 |
| 541 | 3300046455 | Ga0495603_0072989 | Ga0495603_0072989_1176_1868 | 230 |
| 542 | 3300046455 | Ga0495603_0078331 | Ga0495603_0078331_146_847 | 230 |
| 543 | 3300046457 | Ga0495590_0091811 | Ga0495590_0091811_181_873 | 230 |
| 544 | 3300046459 | Ga0495629_0000169 | Ga0495629_0000169_13928_14626 | 230 |
| 545 | 3300046459 | Ga0495629_0101680 | Ga0495629_0101680_1096_1854 | 230 |
| 546 | 3300046459 | Ga0495629_0382837 | Ga0495629_0382837_138_839 | 230 |
| 547 | 3300046460 | Ga0495638_0199033 | Ga0495638_0199033_293_985 | 230 |
| 548 | 3300046461 | Ga0495641_0028285 | Ga0495641_0028285_1719_2417 | 230 |
| 549 | 3300046461 | Ga0495641_0088227 | Ga0495641_0088227_675_1376 | 230 |
| 550 | 3300046462 | Ga0495651_0002891 | Ga0495651_0002891_4140_4898 | 230 |
| 551 | 3300046462 | Ga0495651_0056073 | Ga0495651_0056073_181_873 | 230 |
| 552 | 3300046463 | Ga0495653_0022577 | Ga0495653_0022577_269_1027 | 230 |
| 553 | 3300046472 | Ga0495580_0011387 | Ga0495580_0011387_999_1691 | 230 |
| 554 | 3300046473 | Ga0495582_0000501 | Ga0495582_0000501_7578_8276 | 230 |
| 555 | 3300046473 | Ga0495582_0089465 | Ga0495582_0089465_341_1042 | 230 |
| 556 | 3300046473 | Ga0495582_0417403 | Ga0495582_0417403_32_730 | 230 |
| 557 | 3300046474 | Ga0495605_0177650 | Ga0495605_0177650_68_760 | 230 |
| 558 | 3300046475 | Ga0495639_0027794 | Ga0495639_0027794_1366_2058 | 230 |
| 559 | 3300046476 | Ga0495662_0086996 | Ga0495662_0086996_37_795 | 230 |
| 560 | 3300046477 | Ga0495664_0015502 | Ga0495664_0015502_1350_2108 | 230 |
| 561 | 3300046477 | Ga0495664_0021658 | Ga0495664_0021658_1891_2583 | 230 |
| 562 | 3300046477 | Ga0495664_0228647 | Ga0495664_0228647_216_908 | 230 |
| 563 | 3300046491 | Ga0495584_0010790 | Ga0495584_0010790_1747_2448 | 230 |
| 564 | 3300046492 | Ga0495585_0027420 | Ga0495585_0027420_1320_2021 | 230 |
| 565 | 3300046499 | Ga0495594_0070183 | Ga0495594_0070183_294_992 | 230 |
| 566 | 3300046511 | Ga0495608_0223573 | Ga0495608_0223573_201_893 | 230 |
| 567 | 3300046512 | Ga0495610_0190666 | Ga0495610_0190666_92_787 | 230 |
| 568 | 3300046513 | Ga0495616_0202560 | Ga0495616_0202560_35_727 | 230 |
| 569 | 3300046514 | Ga0495618_0004599 | Ga0495618_0004599_6745_7503 | 230 |
| 570 | 3300046514 | Ga0495618_0009970 | Ga0495618_0009970_1206_1898 | 230 |
| 571 | 3300046514 | Ga0495618_0077440 | Ga0495618_0077440_239_940 | 230 |
| 572 | 3300046516 | Ga0495628_0128569 | Ga0495628_0128569_327_1085 | 230 |
| 573 | 3300046516 | Ga0495628_0135778 | Ga0495628_0135778_517_1209 | 230 |
| 574 | 3300046517 | Ga0495630_0255414 | Ga0495630_0255414_337_1095 | 230 |
| 575 | 3300046517 | Ga0495630_0259225 | Ga0495630_0259225_419_1120 | 230 |
| 576 | 3300046529 | Ga0495652_0066385 | Ga0495652_0066385_1544_2302 | 230 |
| 577 | 3300046531 | Ga0495665_0040425 | Ga0495665_0040425_1306_1998 | 230 |
| 578 | 3300046531 | Ga0495665_0068113 | Ga0495665_0068113_120_878 | 230 |
| 579 | 3300046533 | Ga0495640_0007530 | Ga0495640_0007530_4479_5270 | 230 |
| 580 | 3300046533 | Ga0495640_0022380 | Ga0495640_0022380_990_1748 | 230 |
| 581 | 3300046533 | Ga0495640_0024977 | Ga0495640_0024977_1400_2092 | 230 |
| 582 | 3300046536 | Ga0495587_0000396 | Ga0495587_0000396_25065_25823 | 230 |
| 583 | 3300046543 | Ga0495645_0106082 | Ga0495645_0106082_246_1004 | 230 |
| 584 | 3300046557 | Ga0495622_0020201 | Ga0495622_0020201_1066_1758 | 230 |
| 585 | 3300046557 | Ga0495622_0041478 | Ga0495622_0041478_119_811 | 230 |
| 586 | 3300046557 | Ga0495622_0091622 | Ga0495622_0091622_361_1059 | 230 |
| 587 | 3300046557 | Ga0495622_0168477 | Ga0495622_0168477_186_878 | 230 |
| 588 | 3300046559 | Ga0495667_0013334 | Ga0495667_0013334_1183_1941 | 230 |
| 589 | 3300046559 | Ga0495667_0027673 | Ga0495667_0027673_1332_2024 | 230 |
| 590 | 3300046615 | Ga0495656_0025225 | Ga0495656_0025225_1279_1980 | 230 |
| 591 | 3300046616 | Ga0495668_0241899 | Ga0495668_0241899_115_807 | 230 |
| 592 | 3300046642 | Ga0495634_0033866 | Ga0495634_0033866_610_1368 | 230 |
| 593 | 3300046642 | Ga0495634_0079328 | Ga0495634_0079328_186_887 | 230 |
| 594 | 3300046663 | Ga0495635_0012411 | Ga0495635_0012411_2348_3040 | 230 |
| 595 | 3300046663 | Ga0495635_0015552 | Ga0495635_0015552_2135_2893 | 230 |
| 596 | 3300046663 | Ga0495635_0108705 | Ga0495635_0108705_118_810 | 230 |
| 597 | 3300046675 | Ga0495657_0023962 | Ga0495657_0023962_1276_2034 | 230 |
| 598 | 3300046675 | Ga0495657_0130826 | Ga0495657_0130826_734_1426 | 230 |
| 599 | 3300046678 | Ga0495599_0037602 | Ga0495599_0037602_28_786 | 230 |
| 600 | 3300046678 | Ga0495599_0105775 | Ga0495599_0105775_918_1610 | 230 |
| 601 | 3300046679 | Ga0495623_0004013 | Ga0495623_0004013_5177_5935 | 230 |
| 602 | 3300046679 | Ga0495623_0054972 | Ga0495623_0054972_1798_2493 | 230 |
| 603 | 3300046680 | Ga0495646_0039725 | Ga0495646_0039725_131_889 | 230 |
| 604 | 3300046683 | Ga0495658_0001748 | Ga0495658_0001748_5136_5834 | 230 |
| 605 | 3300046683 | Ga0495658_0041125 | Ga0495658_0041125_786_1487 | 230 |
| 606 | 3300046683 | Ga0495658_0164366 | Ga0495658_0164366_411_1103 | 230 |
| 607 | 3300046689 | Ga0495613_0033167 | Ga0495613_0033167_1753_2451 | 230 |
| 608 | 3300046689 | Ga0495613_0136671 | Ga0495613_0136671_270_971 | 230 |
| 609 | 3300046689 | Ga0495613_0222069 | Ga0495613_0222069_531_1223 | 230 |
| 610 | 3300046690 | Ga0495624_0108776 | Ga0495624_0108776_978_1670 | 230 |
| 611 | 3300046690 | Ga0495624_0329531 | Ga0495624_0329531_96_797 | 230 |
| 612 | 3300046809 | Ga0495600_0004521 | Ga0495600_0004521_1504_2262 | 230 |
| 613 | 3300047315 | Ga0495581_0022126 | Ga0495581_0022126_2287_2979 | 230 |
| 614 | 3300047315 | Ga0495581_0070608 | Ga0495581_0070608_509_1207 | 230 |
| 615 | 3300047315 | Ga0495581_0075949 | Ga0495581_0075949_203_961 | 230 |
| 616 | 3300047317 | Ga0495604_0006104 | Ga0495604_0006104_6380_7138 | 230 |
| 617 | 3300047317 | Ga0495604_0115230 | Ga0495604_0115230_933_1625 | 230 |
| 618 | 3300047319 | Ga0495674_0000860 | Ga0495674_0000860_22504_23262 | 230 |
| 619 | 3300047319 | Ga0495674_0018990 | Ga0495674_0018990_1967_2659 | 230 |
| 620 | 3300047319 | Ga0495674_0062241 | Ga0495674_0062241_1499_2290 | 230 |
| 621 | 3300047320 | Ga0495672_0087168 | Ga0495672_0087168_127_819 | 230 |
| 622 | 3300047320 | Ga0495672_0173842 | Ga0495672_0173842_316_1008 | 230 |
| 623 | 3300047320 | Ga0495672_0194228 | Ga0495672_0194228_154_846 | 230 |
| 624 | 3300047321 | Ga0495676_0040825 | Ga0495676_0040825_36_728 | 230 |
| 625 | 3300047321 | Ga0495676_0289593 | Ga0495676_0289593_303_1004 | 230 |
| 626 | 3300047321 | Ga0495676_0301533 | Ga0495676_0301533_198_956 | 230 |
| 627 | 3300047322 | Ga0495680_0008674 | Ga0495680_0008674_6409_7167 | 230 |
| 628 | 3300047322 | Ga0495680_0057823 | Ga0495680_0057823_607_1305 | 230 |
| 629 | 3300047444 | Ga0495675_0035181 | Ga0495675_0035181_1035_1793 | 230 |
| 630 | 3300047446 | Ga0495679_077690 | Ga0495679_077690_103_804 | 230 |
| 631 | 3300047471 | Ga0495684_0011622 | Ga0495684_0011622_4034_4792 | 230 |
| 632 | 3300047471 | Ga0495684_0024897 | Ga0495684_0024897_3743_4435 | 230 |
| 633 | 3300047472 | Ga0495686_0110474 | Ga0495686_0110474_246_938 | 230 |
| 634 | 3300047472 | Ga0495686_0129427 | Ga0495686_0129427_411_1130 | 230 |
| 635 | 3300047673 | Ga0495593_0042881 | Ga0495593_0042881_586_1278 | 230 |
| 636 | 3300047673 | Ga0495593_0061530 | Ga0495593_0061530_462_1160 | 230 |
| 637 | 3300048088 | Ga0495602_0015443 | Ga0495602_0015443_1160_1918 | 230 |
| 638 | 3300048903 | Ga0496100_0056160 | Ga0496100_0056160_423_1115 | 230 |
| 639 | 3300048903 | Ga0496100_0203112 | Ga0496100_0203112_150_848 | 230 |
| 640 | 3300048904 | Ga0496101_0007208 | Ga0496101_0007208_4749_5450 | 230 |
| 641 | 3300048904 | Ga0496101_0162974 | Ga0496101_0162974_324_1082 | 230 |
| 642 | 3300048905 | Ga0496102_0152736 | Ga0496102_0152736_921_1625 | 230 |
| 643 | 3300048905 | Ga0496102_0409370 | Ga0496102_0409370_483_1184 | 230 |
| 644 | 3300048906 | Ga0496103_0089496 | Ga0496103_0089496_836_1534 | 230 |
| 645 | 3300048907 | Ga0496104_0000069 | Ga0496104_0000069_11433_12149 | 230 |
| 646 | 3300048907 | Ga0496104_0001421 | Ga0496104_0001421_19726_20484 | 230 |
| 647 | 3300048907 | Ga0496104_0005194 | Ga0496104_0005194_9023_9715 | 230 |
| 648 | 3300048907 | Ga0496104_0333963 | Ga0496104_0333963_257_955 | 230 |
| 649 | 3300048907 | Ga0496104_0352896 | Ga0496104_0352896_37_738 | 230 |
| 650 | 3300048907 | Ga0496104_0369104 | Ga0496104_0369104_591_1283 | 230 |
| 651 | 3300048907 | Ga0496104_0375570 | Ga0496104_0375570_282_974 | 230 |
| 652 | 3300048908 | Ga0496105_0000062 | Ga0496105_0000062_1478_2194 | 230 |
| 653 | 3300048908 | Ga0496105_0006775 | Ga0496105_0006775_240_998 | 230 |
| 654 | 3300048908 | Ga0496105_0060429 | Ga0496105_0060429_2368_3060 | 230 |
| 655 | 3300048908 | Ga0496105_0071969 | Ga0496105_0071969_484_1185 | 230 |
| 656 | 3300048908 | Ga0496105_0075153 | Ga0496105_0075153_1672_2382 | 230 |
| 657 | 3300048908 | Ga0496105_0316595 | Ga0496105_0316595_260_976 | 230 |
| 658 | 3300048909 | Ga0496106_0002088 | Ga0496106_0002088_3183_3875 | 230 |
| 659 | 3300048909 | Ga0496106_0025435 | Ga0496106_0025435_1920_2621 | 230 |
| 660 | 3300048909 | Ga0496106_0072788 | Ga0496106_0072788_881_1579 | 230 |
| 661 | 3300048909 | Ga0496106_0105469 | Ga0496106_0105469_292_999 | 230 |
| 662 | 3300048909 | Ga0496106_0114497 | Ga0496106_0114497_1348_2055 | 230 |
| 663 | 3300048909 | Ga0496106_0236097 | Ga0496106_0236097_463_1173 | 230 |
| 664 | 3300048910 | Ga0496107_0004186 | Ga0496107_0004186_4209_4901 | 230 |
| 665 | 3300048910 | Ga0496107_0004453 | Ga0496107_0004453_403_1104 | 230 |
| 666 | 3300048911 | Ga0496108_0001075 | Ga0496108_0001075_16453_17145 | 230 |
| 667 | 3300048911 | Ga0496108_0014318 | Ga0496108_0014318_416_1174 | 230 |
| 668 | 3300048911 | Ga0496108_0173761 | Ga0496108_0173761_759_1457 | 230 |
| 669 | 3300048912 | Ga0496109_0002544 | Ga0496109_0002544_4431_5123 | 230 |
| 670 | 3300048912 | Ga0496109_0196000 | Ga0496109_0196000_366_1064 | 230 |
| 671 | 3300048912 | Ga0496109_0310379 | Ga0496109_0310379_137_829 | 230 |
| 672 | 3300048912 | Ga0496109_0364960 | Ga0496109_0364960_535_1227 | 230 |
| 673 | 3300048913 | Ga0496110_0026785 | Ga0496110_0026785_295_1053 | 230 |
| 674 | 3300048913 | Ga0496110_0135186 | Ga0496110_0135186_1476_2168 | 230 |
| 675 | 3300048913 | Ga0496110_0355967 | Ga0496110_0355967_407_1099 | 230 |
| 676 | 3300048913 | Ga0496110_0623592 | Ga0496110_0623592_115_855 | 230 |
| 677 | 3300048914 | Ga0496111_0055575 | Ga0496111_0055575_1194_1952 | 230 |
| 678 | 3300048914 | Ga0496111_0282636 | Ga0496111_0282636_419_1120 | 230 |
| 679 | 3300048915 | Ga0496112_0003616 | Ga0496112_0003616_5704_6396 | 230 |
| 680 | 3300048915 | Ga0496112_0040721 | Ga0496112_0040721_495_1196 | 230 |
| 681 | 3300048915 | Ga0496112_0078923 | Ga0496112_0078923_1458_2198 | 230 |
| 682 | 3300048915 | Ga0496112_0168277 | Ga0496112_0168277_1214_1912 | 230 |
| 683 | 3300048915 | Ga0496112_0177789 | Ga0496112_0177789_534_1292 | 230 |
| 684 | 3300048915 | Ga0496112_0257938 | Ga0496112_0257938_42_749 | 230 |
| 685 | 3300048915 | Ga0496112_0788288 | Ga0496112_0788288_36_737 | 230 |
| 686 | 3300048916 | Ga0496113_0000949 | Ga0496113_0000949_7952_8710 | 230 |
| 687 | 3300048916 | Ga0496113_0020463 | Ga0496113_0020463_2847_3539 | 230 |
| 688 | 3300048916 | Ga0496113_0075829 | Ga0496113_0075829_470_1171 | 230 |
| 689 | 3300048916 | Ga0496113_0243344 | Ga0496113_0243344_284_982 | 230 |
| 690 | 3300048917 | Ga0496114_0026910 | Ga0496114_0026910_422_1138 | 230 |
| 691 | 3300048917 | Ga0496114_0111821 | Ga0496114_0111821_1535_2236 | 230 |
| 692 | 3300048917 | Ga0496114_0206816 | Ga0496114_0206816_540_1232 | 230 |
| 693 | 3300048917 | Ga0496114_0435070 | Ga0496114_0435070_422_1114 | 230 |
| 694 | 3300048918 | Ga0496115_0018802 | Ga0496115_0018802_2318_3019 | 230 |
| 695 | 3300048918 | Ga0496115_0043919 | Ga0496115_0043919_2315_3031 | 230 |
| 696 | 3300048918 | Ga0496115_0064899 | Ga0496115_0064899_1889_2605 | 230 |
| 697 | 3300048918 | Ga0496115_0111816 | Ga0496115_0111816_1078_1770 | 230 |
| 698 | 3300048918 | Ga0496115_0229266 | Ga0496115_0229266_621_1313 | 230 |
| 699 | 3300048918 | Ga0496115_0270767 | Ga0496115_0270767_428_1144 | 230 |
| 700 | 3300048918 | Ga0496115_0378098 | Ga0496115_0378098_365_1057 | 230 |
| 701 | 3300048921 | Ga0496118_0030366 | Ga0496118_0030366_2026_2721 | 230 |
| 702 | 3300048922 | Ga0496119_0012629 | Ga0496119_0012629_6022_6714 | 230 |
| 703 | 3300048923 | Ga0496120_0030873 | Ga0496120_0030873_125_817 | 230 |
| 704 | 3300048924 | Ga0496121_0039412 | Ga0496121_0039412_2428_3123 | 230 |
| 705 | 3300048924 | Ga0496121_0059965 | Ga0496121_0059965_2076_2768 | 230 |
| 706 | 3300048927 | Ga0496124_0057877 | Ga0496124_0057877_1482_2174 | 230 |
| 707 | 3300048928 | Ga0496125_0051128 | Ga0496125_0051128_1838_2533 | 230 |
| 708 | 3300048929 | Ga0496126_0007749 | Ga0496126_0007749_1962_2660 | 230 |
| 709 | 3300048929 | Ga0496126_0047853 | Ga0496126_0047853_3083_3775 | 230 |
| 710 | 3300048929 | Ga0496126_0065391 | Ga0496126_0065391_2425_3117 | 230 |
| 711 | 3300048929 | Ga0496126_0088727 | Ga0496126_0088727_1854_2546 | 230 |
| 712 | 3300048929 | Ga0496126_0089186 | Ga0496126_0089186_976_1671 | 230 |
| 713 | 3300048929 | Ga0496126_0218791 | Ga0496126_0218791_52_744 | 230 |
| 714 | 3300049571 | Ga0501034_0313442 | Ga0501034_0313442_734_1432 | 230 |
| 715 | 3300049582 | Ga0501048_0000115 | Ga0501048_0000115_24020_24718 | 230 |
| 716 | 3300049585 | Ga0501069_0135581 | Ga0501069_0135581_137_829 | 230 |
| 717 | 3300050489 | nmdc:mga03683_24331_c2 | nmdc:mga03683_24331_c2_646_1350 | 230 |
| 718 | 3300050491 | nmdc:mga00v17_133351_c1 | nmdc:mga00v17_133351_c1_297_989 | 230 |
| 719 | 3300050491 | nmdc:mga00v17_30266_c1 | nmdc:mga00v17_30266_c1_846_1550 | 230 |
| 720 | 3300050491 | nmdc:mga00v17_32317_c1 | nmdc:mga00v17_32317_c1_1716_2411 | 230 |
| 721 | 3300050491 | nmdc:mga00v17_325276_c1 | nmdc:mga00v17_325276_c1_88_783 | 230 |
| 722 | 3300050492 | nmdc:mga0yw44_11952_c1 | nmdc:mga0yw44_11952_c1_850_1545 | 230 |
| 723 | 3300050492 | nmdc:mga0yw44_126266_c1 | nmdc:mga0yw44_126266_c1_783_1475 | 230 |
| 724 | 3300050492 | nmdc:mga0yw44_34727_c1 | nmdc:mga0yw44_34727_c1_1557_2261 | 230 |
| 725 | 3300050492 | nmdc:mga0yw44_9567_c1 | nmdc:mga0yw44_9567_c1_2805_3500 | 230 |
| 726 | 3300050493 | nmdc:mga0k408_139207_c1 | nmdc:mga0k408_139207_c1_384_1085 | 230 |
| 727 | 3300050494 | nmdc:mga06z11_23452_c1 | nmdc:mga06z11_23452_c1_1350_2042 | 230 |
| 728 | 3300050494 | nmdc:mga06z11_59498_c1 | nmdc:mga06z11_59498_c1_368_1060 | 230 |
| 729 | 3300050496 | nmdc:mga07m45_5386_c1 | nmdc:mga07m45_5386_c1_59_751 | 230 |
| 730 | 3300050507 | nmdc:mga05p37_124_c1 | nmdc:mga05p37_124_c1_31703_32395 | 230 |
| 731 | 3300050507 | nmdc:mga05p37_333562_c1 | nmdc:mga05p37_333562_c1_1041_1736 | 230 |
| 732 | 3300050508 | nmdc:mga09592_547888_c1 | nmdc:mga09592_547888_c1_222_935 | 230 |
| 733 | 3300050508 | nmdc:mga09592_5518_c1 | nmdc:mga09592_5518_c1_5410_6102 | 230 |
| 734 | 3300050509 | nmdc:mga0qj67_16363_c1 | nmdc:mga0qj67_16363_c1_4336_5028 | 230 |
| 735 | 3300050509 | nmdc:mga0qj67_316236_c1 | nmdc:mga0qj67_316236_c1_16_720 | 230 |
| 736 | 3300050509 | nmdc:mga0qj67_3618_c1 | nmdc:mga0qj67_3618_c1_430_1131 | 230 |
| 737 | 3300050510 | nmdc:mga06r32_145140_c1 | nmdc:mga06r32_145140_c1_552_1247 | 230 |
| 738 | 3300050510 | nmdc:mga06r32_847_c1 | nmdc:mga06r32_847_c1_7159_7851 | 230 |
| 739 | 3300050511 | nmdc:mga08y16_2124_c1 | nmdc:mga08y16_2124_c1_13330_14022 | 230 |
| 740 | 3300050511 | nmdc:mga08y16_233220_c1 | nmdc:mga08y16_233220_c1_1050_1751 | 230 |
| 741 | 3300050511 | nmdc:mga08y16_238003_c1 | nmdc:mga08y16_238003_c1_821_1513 | 230 |
| 742 | 3300050512 | nmdc:mga0n895_18346_c1 | nmdc:mga0n895_18346_c1_5384_6085 | 230 |
| 743 | 3300050512 | nmdc:mga0n895_426935_c1 | nmdc:mga0n895_426935_c1_131_838 | 230 |
| 744 | 3300050512 | nmdc:mga0n895_45308_c1 | nmdc:mga0n895_45308_c1_437_1132 | 230 |
| 745 | 3300050512 | nmdc:mga0n895_56526_c1 | nmdc:mga0n895_56526_c1_1810_2508 | 230 |
| 746 | 3300050512 | nmdc:mga0n895_790415_c1 | nmdc:mga0n895_790415_c1_202_912 | 230 |
| 747 | 3300050513 | nmdc:mga0rr50_353686_c1 | nmdc:mga0rr50_353686_c1_441_1136 | 230 |
| 748 | 3300050513 | nmdc:mga0rr50_678961_c1 | nmdc:mga0rr50_678961_c1_10_711 | 230 |
| 749 | 3300050513 | nmdc:mga0rr50_73213_c1 | nmdc:mga0rr50_73213_c1_1567_2265 | 230 |
| 750 | 3300050514 | nmdc:mga08x19_206289_c1 | nmdc:mga08x19_206289_c1_487_1182 | 230 |
| 751 | 3300050514 | nmdc:mga08x19_23380_c1 | nmdc:mga08x19_23380_c1_415_1128 | 230 |
| 752 | 3300050515 | nmdc:mga0a205_154174_c1 | nmdc:mga0a205_154174_c1_374_1075 | 230 |
| 753 | 3300050515 | nmdc:mga0a205_469041_c1 | nmdc:mga0a205_469041_c1_275_985 | 230 |
| 754 | 3300050515 | nmdc:mga0a205_543441_c1 | nmdc:mga0a205_543441_c1_39_737 | 230 |
| 755 | 3300050515 | nmdc:mga0a205_97632_c1 | nmdc:mga0a205_97632_c1_833_1528 | 230 |
| 756 | 3300050516 | nmdc:mga0sz30_98102_c1 | nmdc:mga0sz30_98102_c1_497_1198 | 230 |
| 757 | 3300053077 | Ga0495601_0010338 | Ga0495601_0010338_2797_3555 | 230 |
| 758 | 3300053077 | Ga0495601_0060130 | Ga0495601_0060130_715_1506 | 230 |
| 759 | 3300053077 | Ga0495601_0195387 | Ga0495601_0195387_327_1019 | 230 |
| 760 | 3300053078 | Ga0495612_0021763 | Ga0495612_0021763_1014_1772 | 230 |
| 761 | 3300053085 | Ga0495619_0001572 | Ga0495619_0001572_5942_6640 | 230 |
| 762 | 3300053085 | Ga0495619_0006981 | Ga0495619_0006981_5526_6284 | 230 |
| 763 | 3300053085 | Ga0495619_0027144 | Ga0495619_0027144_1831_2532 | 230 |
| 764 | 3300053085 | Ga0495619_0200622 | Ga0495619_0200622_392_1084 | 230 |
| 765 | 3300053096 | Ga0500641_0001698 | Ga0500641_0001698_6897_7589 | 230 |
| 766 | 3300053119 | Ga0500595_000941 | Ga0500595_000941_9467_10165 | 230 |
| 767 | 3300053119 | Ga0500595_006818 | Ga0500595_006818_40_768 | 230 |
| 768 | 3300053119 | Ga0500595_019376 | Ga0500595_019376_454_1149 | 230 |
| 769 | 3300053119 | Ga0500595_052847 | Ga0500595_052847_389_1081 | 230 |
| 770 | 3300053121 | Ga0500607_050885 | Ga0500607_050885_201_911 | 230 |
| 771 | 3300053122 | Ga0500608_197859 | Ga0500608_197859_42_740 | 230 |
| 772 | 3300053136 | Ga0500559_0002260 | Ga0500559_0002260_5682_6392 | 230 |
| 773 | 3300053145 | Ga0500586_016591 | Ga0500586_016591_875_1585 | 230 |
| 774 | 3300053150 | Ga0500603_001309 | Ga0500603_001309_3530_4222 | 230 |
| 775 | 3300053150 | Ga0500603_026355 | Ga0500603_026355_74_766 | 230 |
| 776 | 3300053153 | Ga0500616_0027152 | Ga0500616_0027152_2085_2786 | 230 |
| 777 | 3300053153 | Ga0500616_0034208 | Ga0500616_0034208_1459_2157 | 230 |
| 778 | 3300053155 | Ga0500620_063141 | Ga0500620_063141_82_777 | 230 |
| 779 | 3300053162 | Ga0500638_000054 | Ga0500638_000054_16937_17635 | 230 |
| 780 | 3300053178 | Ga0500637_0000775 | Ga0500637_0000775_128_826 | 230 |
| 781 | 3300053178 | Ga0500637_0013609 | Ga0500637_0013609_1218_1910 | 230 |
| 782 | 3300055283 | Ga0500661_000301 | Ga0500661_000301_7019_7717 | 230 |
| 783 | 3300061734 | Ga0530510_0292637 | Ga0530510_0292637_225_917 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4w66-assembly1.cif.gz_B | crystal structure of glutathione s-transferase domain protein from haliangium ochraceum dsm 14365 | 0.7678 | 2 | 224 |
| 4iel-assembly1.cif.gz_A-2 | crystal structure of a glutathione s-transferase family protein from burkholderia ambifaria, target efi-507141, with bound glutathione | 0.7565 | 1 | 227 |
| 5djm-assembly1.cif.gz_B | structure of wt human glutathione transferase in complex with cisplatin in the absence of glutathione. | 0.7544 | 1 | 227 |
| 3zmk-assembly1.cif.gz_C | anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa | 0.7543 | 1 | 223 |
| 4jed-assembly1.cif.gz_A-2 | crystal structure of glutathione s-transferase mrad2831_1084 (target efi-507060) from methylobacterium radiotolerans jcm 2831, complex with glutathione sulfonate | 0.7533 | 2 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4D4W9_85_180_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.964 | 22 | 98 | 3.40.30.10 |
| af_Q95RI5_238_344_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9266 | 135 | 225 | 1.20.1050.10 |
| af_G5EDZ7_45_152_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9229 | 1 | 98 | 3.40.30.10 |
| af_E9QGX6_115_210_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8952 | 19 | 111 | 3.40.30.10 |
| af_Q9NA74_166_268_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.8882 | 148 | 226 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P1R2W7-F1-model_v4 | Glutathione S-transferase family protein | 0.9991 | 1 | 229 |
GO:0016740
|
| AF-A0A850IMW0-F1-model_v4 | Glutathione S-transferase family protein | 0.9976 | 1 | 230 |
|
| AF-A0A841A5U8-F1-model_v4 | deleted | 0.9948 | 1 | 228 |
|
| AF-A0A562L9H8-F1-model_v4 | Glutathione S-transferase-like protein | 0.9917 | 1 | 198 |
GO:0016740
|
| AF-A0A6P1R2W7-F1-model_v4 | Glutathione S-transferase family protein | 0.9904 | 1 | 229 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar