F480601

General Info

Members Datasets Scaffolds Average Seq Length
782 510 561 270

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100095369|Ga0070684_1000953693
Length 304
Sequence MPCAIGVARHSGHAGKYRAGAGRRTGASFGGRRILAKVVVITSGKGGVGKTTSSAAFAAGLALRGHRTVVIDFDVGLRNLDLIMGCERRVVFDFINVINRDANLNQALIKDKRNDNLYVFPTSQTRDKDALKREGVERVLEELRQQFDYIVCDSPAGIEHGAITALYFADAAIIVTNPEVSSVRDSDRIIGILASRSRRAERNEAPVELNLLLTRYDSGRVSRGEMMTVEDVQEILSIPLLGVIPESESVLRASNTGTPVTFDTESPAGRAYHDAVARFLGETREMRFVKPERRNFFRVLFGRA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231024 Pseudomonas sp. GM84 Isolate Nodule
24 2511231031 Pseudomonas sp. GM16 Isolate Nodule
25 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
26 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
27 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
28 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
29 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
30 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
31 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
32 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
33 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
34 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
35 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
36 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
37 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
38 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
39 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
40 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
41 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
42 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
43 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
44 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
45 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
46 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
47 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
48 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
49 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
50 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
51 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
52 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
53 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
54 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
55 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
56 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
57 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
58 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
59 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
60 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
61 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
62 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
63 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
64 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
65 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
66 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
67 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
68 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
69 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
70 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
71 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
72 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
73 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
74 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
75 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
76 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
77 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
78 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
79 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
80 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
81 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
82 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
83 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
84 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
85 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
86 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
87 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
90 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
91 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
92 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
93 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
94 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
95 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
96 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
97 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
98 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
99 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
100 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
101 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
102 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
103 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
104 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
105 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
106 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
107 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
108 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
109 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
110 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
111 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
112 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
113 2765235841 Pseudomonas putida AA7 Isolate Unclassified
114 2773857670 Pseudomonas sp. 478 Isolate Unclassified
115 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
116 2773857673 Pseudomonas sp. 443 Isolate Unclassified
117 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
118 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
119 2784132063 Pseudomonas sp. 424 Isolate Unclassified
120 2784132072 Pseudomonas sp. 460 Isolate Unclassified
121 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
122 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
123 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
124 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
125 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
126 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
127 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
128 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
129 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
130 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
131 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
132 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
133 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
134 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
135 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
136 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
137 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
138 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
139 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
140 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
141 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
142 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
143 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
144 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
145 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
146 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
147 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
148 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
149 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
150 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
151 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
152 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
153 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
154 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
155 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
156 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
157 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
158 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
159 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
160 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
161 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
162 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
163 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
164 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
165 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
166 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
167 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
168 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
169 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
170 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
171 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
172 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
173 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
174 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
175 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
176 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
177 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
178 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
179 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
180 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
181 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
182 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
183 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
184 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
185 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
186 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
187 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
188 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
189 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
190 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
191 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
192 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
193 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
194 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
195 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
196 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
197 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
198 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
199 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
200 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
201 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
202 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
203 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
204 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
205 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
206 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
207 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
208 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
209 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
210 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
211 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
212 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
213 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
214 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
215 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
216 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
217 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
218 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
219 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
220 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
221 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
222 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
223 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
224 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
225 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
226 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
227 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
228 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
229 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
230 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
231 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
232 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
233 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
234 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
235 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
236 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
237 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
238 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
239 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
240 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
241 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
242 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
243 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
244 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
245 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
246 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
247 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
248 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
249 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
250 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
251 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
252 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
253 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
254 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
255 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
258 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
259 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
260 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
261 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
262 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
263 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
264 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
265 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
266 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
267 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
268 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
269 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
270 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
271 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
272 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
273 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
274 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
275 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
276 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
277 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
278 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
279 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
281 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
282 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
283 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
284 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
285 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
314 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
315 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
321 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
322 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
323 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
326 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
329 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
330 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
331 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
332 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
333 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
334 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
335 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
336 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
337 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
338 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
339 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
340 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
341 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
342 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
343 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
345 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
346 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
347 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
348 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
349 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
350 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
351 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
352 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
353 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
354 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
355 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
356 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
357 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
358 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
359 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
360 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
361 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
362 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
363 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
364 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
365 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
366 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
367 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
368 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
369 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
370 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
371 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
372 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
373 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
374 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
375 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
376 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
377 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
378 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
379 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
380 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
381 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
382 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
383 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
384 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
385 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
386 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
387 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
388 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
389 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
390 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
391 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
392 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
393 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
394 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
395 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
396 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
397 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
398 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
399 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
400 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
401 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
402 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
403 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
404 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
405 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
406 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
407 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
408 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
409 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
410 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
411 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
412 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
413 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
414 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
415 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
416 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
417 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
418 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
419 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
420 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
421 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
422 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
423 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
424 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
425 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
426 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
427 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
428 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
429 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
430 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
431 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
432 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
433 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
434 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
435 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
436 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
437 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
438 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
439 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
440 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
441 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
442 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
443 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
444 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
445 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
446 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
447 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
448 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
449 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
450 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
451 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
452 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
453 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
454 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
455 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
456 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
457 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
458 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
459 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
460 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
461 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
462 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
463 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
464 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
465 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
466 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
467 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
468 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
469 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
470 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
471 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
472 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
473 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
474 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
475 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
477 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
479 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
480 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
481 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
482 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
485 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
486 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
487 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
488 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
489 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
490 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
491 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
492 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
493 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
494 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
495 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
496 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
497 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
498 8052494512 Pseudomonas putida LD6 Isolate Unclassified
499 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
500 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
501 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
502 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
503 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
504 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
505 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
506 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
507 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
508 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
509 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
510 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.1
Metatranscriptomes 0.64
Isolates 28.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 4.86
Nodule 3.32
Rhizoplane 8.44
Rhizosphere 69.05
Stem 0
Stem Tuber 0
Unclassified 13.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_23 2124908027 Bacteria 55080
2 MRS2a_Contig_6280 2124908027 Bacteria 1660
3 SwRhRL2b_contig_2798511 2162886007 Bacteria 2305
4 JGI25162J39368_1000251 3300002737 Bacteria 52332
5 JGI25162J39368_1000315 3300002737 Bacteria 42934
6 JGI25163J39215_1001111 3300002771 Bacteria 5465
7 JGI25164J39214_1000194 3300002772 Bacteria 52332
8 JGI25164J39214_1000411 3300002772 Bacteria 24391
9 JGI25159J45721_1001567 3300002987 Bacteria 9372
10 JGI25165J46597_1000348 3300003214 Bacteria 52332
11 JGI25165J46597_1000430 3300003214 Bacteria 42934
12 rootH2_10091229 3300003320 Bacteria 5621
13 rootH1_10005337 3300003323 Bacteria 42291
14 rootH1_10167004 3300003323 Bacteria 9914
15 Ga0006562J51391_1018591 3300003578 Bacteria 3510
16 Ga0006562J51391_1037971 3300003578 Bacteria 1941
17 Ga0055524_1000017 3300003775 Bacteria 235608
18 Ga0055536_1004018 3300003781 Bacteria 7673
19 Ga0055531_10000997 3300003794 Bacteria 22497
20 Ga0058692_1000014 3300003856 Bacteria 313984
21 Ga0065703_1000184 3300005272 Bacteria 28729
22 Ga0065714_10000034 3300005288 Bacteria 15985
23 Ga0065714_10070725 3300005288 Bacteria 3783
24 Ga0065714_10183392 3300005288 Bacteria 954
25 Ga0065704_10015961 3300005289 Bacteria 3535
26 Ga0065704_10194481 3300005289 Bacteria 1174
27 Ga0065712_10067911 3300005290 Bacteria 21555
28 Ga0065712_10069558 3300005290 Bacteria 7067
29 Ga0065715_10234727 3300005293 Bacteria 1215
30 Ga0070682_100033828 3300005337 Bacteria 3108
31 Ga0070660_100030566 3300005339 Bacteria 4040
32 Ga0070669_100008078 3300005353 Bacteria 7518
33 Ga0070671_100029170 3300005355 Bacteria 4550
34 Ga0070671_100179916 3300005355 Bacteria 1790
35 Ga0070709_10010843 3300005434 Bacteria 5058
36 Ga0070714_100032520 3300005435 Bacteria 4355
37 Ga0070714_100254214 3300005435 Bacteria 1626
38 Ga0070713_100091115 3300005436 Bacteria 2622
39 Ga0070713_100288260 3300005436 Bacteria 1508
40 Ga0070710_10111820 3300005437 Bacteria 1641
41 Ga0070711_100024685 3300005439 Bacteria 3925
42 Ga0070711_100210121 3300005439 Bacteria 1507
43 Ga0070711_100494301 3300005439 Bacteria 1008
44 Ga0070708_100310713 3300005445 Bacteria 1485
45 Ga0070662_100032504 3300005457 Bacteria 3667
46 Ga0070706_100018287 3300005467 Bacteria 6467
47 Ga0070706_100093967 3300005467 Bacteria 2783
48 Ga0070707_100020705 3300005468 Bacteria 6207
49 Ga0070698_100017589 3300005471 Bacteria 7533
50 Ga0070698_100401646 3300005471 Bacteria 1304
51 Ga0070698_100406750 3300005471 Bacteria 1295
52 Ga0070699_100172711 3300005518 Bacteria 1915
53 Ga0070699_100382835 3300005518 Bacteria 1270
54 Ga0070699_100466838 3300005518 Bacteria 1145
55 Ga0070684_100095369 3300005535 Bacteria 2650
56 Ga0070697_100031861 3300005536 Bacteria 4242
57 Ga0070697_100336889 3300005536 Bacteria 1301
58 Ga0070665_100018863 3300005548 Bacteria 6917
59 Ga0068861_100552079 3300005719 Bacteria 1050
60 Ga0070717_10011796 3300006028 Bacteria 6647
61 Ga0075364_10068387 3300006051 Bacteria 2336
62 Ga0075432_10101495 3300006058 Bacteria 1063
63 Ga0075432_10130832 3300006058 Bacteria 950
64 Ga0070716_100029621 3300006173 Bacteria 2962
65 Ga0070716_100053936 3300006173 Bacteria 2294
66 Ga0070712_100013081 3300006175 Bacteria 5292
67 Ga0070712_100027336 3300006175 Bacteria 3809
68 Ga0075362_10056973 3300006177 Bacteria 1760
69 Ga0075370_10143729 3300006353 Bacteria 1395
70 Ga0075434_100059625 3300006871 Bacteria 3794
71 Ga0075436_100012460 3300006914 Bacteria 5827
72 Ga0079104_1000982 3300006946 Bacteria 22250
73 Ga0099826_10003959 3300006948 Bacteria 10255
74 Ga0099795_10001078 3300007788 Bacteria 5642
75 Ga0099795_10008269 3300007788 Bacteria 2958
76 Ga0105251_10000035 3300009011 Bacteria 117861
77 Ga0105251_10005924 3300009011 Bacteria 7901
78 Ga0105251_10032130 3300009011 Bacteria 2619
79 Ga0105251_10065962 3300009011 Bacteria 1693
80 Ga0105251_10083088 3300009011 Bacteria 1479
81 Ga0105251_10083294 3300009011 Bacteria 1477
82 Ga0105251_10200108 3300009011 Bacteria 900
83 Ga0105244_10001134 3300009036 Bacteria 22154
84 Ga0105244_10017376 3300009036 Bacteria 4066
85 Ga0105244_10031086 3300009036 Bacteria 2835
86 Ga0105244_10091482 3300009036 Bacteria 1495
87 Ga0105250_10000056 3300009092 Bacteria 114085
88 Ga0105250_10011835 3300009092 Bacteria 3616
89 Ga0105250_10023276 3300009092 Bacteria 2496
90 Ga0105250_10023995 3300009092 Bacteria 2458
91 Ga0105250_10041937 3300009092 Bacteria 1834
92 Ga0105240_10004855 3300009093 Bacteria 20243
93 Ga0105240_10041595 3300009093 Bacteria 5864
94 Ga0105240_10260407 3300009093 Bacteria 2001
95 Ga0105243_10000249 3300009148 Bacteria 61872
96 Ga0105243_10001441 3300009148 Bacteria 20939
97 Ga0105243_10002007 3300009148 Bacteria 17310
98 Ga0105243_10036370 3300009148 Bacteria 3822
99 Ga0105242_10306473 3300009176 Bacteria 1451
100 Ga0105242_10554592 3300009176 Bacteria 1102
101 Ga0105249_10000342 3300009553 Bacteria 47083
102 Ga0099796_10010745 3300010159 Bacteria 2527
103 Ga0099796_10028241 3300010159 Bacteria 1799
104 Ga0105239_10344886 3300010375 Bacteria 1681
105 Ga0105246_10001895 3300011119 Bacteria 12596
106 Ga0105246_10007270 3300011119 Bacteria 6785
107 Ga0105246_10270088 3300011119 Bacteria 1359
108 Ga0157373_10009442 3300013100 Bacteria 7206
109 Ga0157373_10036301 3300013100 Bacteria 3538
110 Ga0157373_10133656 3300013100 Bacteria 1744
111 Ga0157371_10014441 3300013102 Bacteria 5959
112 Ga0157371_10017060 3300013102 Bacteria 5402
113 Ga0157371_10029699 3300013102 Bacteria 3949
114 Ga0157371_10209200 3300013102 Bacteria 1400
115 Ga0157370_10064240 3300013104 Bacteria 3475
116 Ga0157370_10383435 3300013104 Bacteria 1294
117 Ga0157369_10004688 3300013105 Bacteria 16077
118 Ga0157374_10430858 3300013296 Bacteria 1318
119 Ga0163162_10065357 3300013306 Bacteria 3684
120 Ga0157372_10038059 3300013307 Bacteria 5308
121 Ga0157372_10727607 3300013307 Bacteria 1154
122 Ga0157375_10308655 3300013308 Bacteria 1746
123 Ga0182008_10023277 3300014497 Bacteria 3166
124 Ga0182008_10029769 3300014497 Bacteria 2756
125 Ga0182008_10090027 3300014497 Bacteria 1512
126 Ga0157377_10222222 3300014745 Bacteria 1210
127 Ga0157379_10316027 3300014968 Bacteria 1425
128 Ga0182006_1006419 3300015261 Bacteria 5469
129 Ga0182006_1009493 3300015261 Bacteria 4358
130 Ga0182006_1035789 3300015261 Bacteria 1976
131 Ga0182007_10001991 3300015262 Bacteria 10535
132 Ga0182005_1008729 3300015265 Bacteria 2976
133 Ga0182005_1076232 3300015265 Bacteria 923
134 Ga0163161_10084202 3300017792 Bacteria 2345
135 Ga0206352_11149150 3300020078 Bacteria 2530
136 Ga0213873_10014176 3300021358 Bacteria 1762
137 Ga0213872_10000652 3300021361 Bacteria 26299
138 Ga0213872_10001532 3300021361 Bacteria 14857
139 Ga0213872_10001557 3300021361 Bacteria 14685
140 Ga0213872_10001677 3300021361 Bacteria 13937
141 Ga0213872_10026800 3300021361 Bacteria 2647
142 Ga0213874_10009670 3300021377 Bacteria 2391
143 Ga0213875_10000145 3300021388 Bacteria 75194
144 Ga0213875_10006534 3300021388 Bacteria 6104
145 Ga0209760_100011 3300025207 Bacteria 197221
146 Ga0209760_100064 3300025207 Bacteria 91180
147 Ga0209563_100495 3300025230 Bacteria 13358
148 Ga0207427_100008 3300025231 Bacteria 740731
149 Ga0207427_100082 3300025231 Bacteria 142809
150 Ga0209437_100006 3300025233 Bacteria 1042724
151 Ga0209437_100014 3300025233 Bacteria 740714
152 Ga0209759_1007138 3300025256 Bacteria 3642
153 Ga0209233_1000008 3300025261 Bacteria 1356712
154 Ga0209233_1000105 3300025261 Bacteria 272035
155 Ga0209675_1017364 3300025291 Bacteria 2058
156 Ga0209676_1000006 3300025292 Bacteria 1039588
157 Ga0209676_1000369 3300025292 Bacteria 83704
158 Ga0209676_1000803 3300025292 Bacteria 41332
159 Ga0209676_1001140 3300025292 Bacteria 29053
160 Ga0209050_1000070 3300025298 Bacteria 296366
161 Ga0209050_1000235 3300025298 Bacteria 121420
162 Ga0209050_1000380 3300025298 Bacteria 83704
163 Ga0209050_1001241 3300025298 Bacteria 29500
164 Ga0209051_1000086 3300025303 Bacteria 183550
165 Ga0209051_1000123 3300025303 Bacteria 144298
166 Ga0209051_1001064 3300025303 Bacteria 25530
167 Ga0209257_1000421 3300025304 Bacteria 81748
168 Ga0209257_1005819 3300025304 Bacteria 8368
169 Ga0207696_1000025 3300025711 Bacteria 418650
170 Ga0207696_1000144 3300025711 Bacteria 122345
171 Ga0207696_1003214 3300025711 Bacteria 7545
172 Ga0207696_1006143 3300025711 Bacteria 4883
173 Ga0207696_1006846 3300025711 Bacteria 4537
174 Ga0207696_1013375 3300025711 Bacteria 2862
175 Ga0207655_1000183 3300025728 Bacteria 112295
176 Ga0207655_1000592 3300025728 Bacteria 44578
177 Ga0207655_1000976 3300025728 Bacteria 29345
178 Ga0207655_1001969 3300025728 Bacteria 17531
179 Ga0207655_1003070 3300025728 Bacteria 12720
180 Ga0207655_1005485 3300025728 Bacteria 8608
181 Ga0207655_1006081 3300025728 Bacteria 8057
182 Ga0207655_1008047 3300025728 Bacteria 6758
183 Ga0207655_1010633 3300025728 Bacteria 5564
184 Ga0207655_1012126 3300025728 Bacteria 5067
185 Ga0207655_1025877 3300025728 Bacteria 2835
186 Ga0207713_1001249 3300025735 Bacteria 21049
187 Ga0207713_1001767 3300025735 Bacteria 16571
188 Ga0207713_1003135 3300025735 Bacteria 11460
189 Ga0207713_1003177 3300025735 Bacteria 11369
190 Ga0207713_1006088 3300025735 Bacteria 7431
191 Ga0207713_1014429 3300025735 Bacteria 4108
192 Ga0207713_1047856 3300025735 Bacteria 1727
193 Ga0207692_10010663 3300025898 Bacteria 3882
194 Ga0207692_10023731 3300025898 Bacteria 2841
195 Ga0207710_10000122 3300025900 Bacteria 94509
196 Ga0207684_10378695 3300025910 Bacteria 1217
197 Ga0207707_10030684 3300025912 Bacteria 4703
198 Ga0207707_10231927 3300025912 Bacteria 1606
199 Ga0207695_10015272 3300025913 Bacteria 9052
200 Ga0207693_10005303 3300025915 Bacteria 10773
201 Ga0207693_10052530 3300025915 Bacteria 3197
202 Ga0207693_10071210 3300025915 Bacteria 2721
203 Ga0207663_10341937 3300025916 Bacteria 1130
204 Ga0207660_10387537 3300025917 Bacteria 1124
205 Ga0207652_10100233 3300025921 Bacteria 2557
206 Ga0207646_10009040 3300025922 Bacteria 9898
207 Ga0207681_10005882 3300025923 Bacteria 7524
208 Ga0207681_10088241 3300025923 Bacteria 2208
209 Ga0207700_10002928 3300025928 Bacteria 9849
210 Ga0207700_10183041 3300025928 Bacteria 1756
211 Ga0207700_10208336 3300025928 Bacteria 1651
212 Ga0207664_10016110 3300025929 Bacteria 5446
213 Ga0207664_10127472 3300025929 Bacteria 2138
214 Ga0207664_10520324 3300025929 Bacteria 1066
215 Ga0207644_10109678 3300025931 Bacteria 2085
216 Ga0207709_10000001 3300025935 Bacteria 2228154
217 Ga0207709_10000223 3300025935 Bacteria 71537
218 Ga0207709_10000835 3300025935 Bacteria 23621
219 Ga0207709_10030554 3300025935 Bacteria 3135
220 Ga0207665_10006644 3300025939 Bacteria 7673
221 Ga0207665_10033004 3300025939 Bacteria 3429
222 Ga0207665_10049356 3300025939 Bacteria 2827
223 Ga0207712_10001909 3300025961 Bacteria 13702
224 Ga0207703_10319423 3300026035 Bacteria 1422
225 Ga0207702_10031690 3300026078 Bacteria 4407
226 Ga0207641_10435466 3300026088 Bacteria 1265
227 Ga0207676_10416744 3300026095 Bacteria 1259
228 Ga0209281_1000010 3300027111 Bacteria 726106
229 Ga0209281_1000331 3300027111 Bacteria 81645
230 Ga0209281_1005471 3300027111 Bacteria 3515
231 Ga0209389_1000031 3300027296 Bacteria 138036
232 Ga0209371_1000040 3300027312 Bacteria 340804
233 Ga0209371_1000182 3300027312 Bacteria 92399
234 Ga0209371_1000589 3300027312 Bacteria 32598
235 Ga0209371_1017352 3300027312 Bacteria 1867
236 Ga0209969_1013169 3300027360 Bacteria 1196
237 Ga0209984_1001806 3300027424 Bacteria 2351
238 Ga0209179_1019988 3300027512 Bacteria 1295
239 Ga0209999_1002159 3300027543 Bacteria 3443
240 Ga0209982_1009659 3300027552 Bacteria 1427
241 Ga0209983_1000763 3300027665 Bacteria 7000
242 Ga0209282_1054335 3300027666 Bacteria 2273
243 Ga0209971_1000554 3300027682 Bacteria 9762
244 Ga0209974_10007616 3300027876 Bacteria 3729
245 Ga0207428_10238370 3300027907 Bacteria 1360
246 Ga0268266_10014923 3300028379 Bacteria 6671
247 Ga0268266_10055084 3300028379 Bacteria 3418
248 Ga0268265_10473215 3300028380 Bacteria 1175
249 Ga0307515_10002349 3300028794 Bacteria 41308
250 Ga0265338_10006011 3300028800 Bacteria 15594
251 Ga0265338_10155737 3300028800 Bacteria 1770
252 Ga0268256_1000041 3300030500 Bacteria 340725
253 Ga0268256_1000153 3300030500 Bacteria 92399
254 Ga0268256_1000511 3300030500 Bacteria 32598
255 Ga0268256_1019341 3300030500 Bacteria 1867
256 Ga0316177_1211506 3300030731 Bacteria 2006
257 Ga0316179_1028994 3300030734 Bacteria 2584
258 Ga0316178_1108793 3300030735 Bacteria 13326
259 Ga0316183_1189572 3300030742 Bacteria 1868
260 Ga0265327_10013441 3300031251 Bacteria 5435
261 Ga0265327_10031808 3300031251 Bacteria 2960
262 Ga0307408_100000025 3300031548 Bacteria 267563
263 Ga0307408_100000192 3300031548 Bacteria 65993
264 Ga0265314_10038335 3300031711 Bacteria 3463
265 Ga0307413_10226145 3300031824 Bacteria 1370
266 Ga0307406_10004592 3300031901 Bacteria 7515
267 Ga0307416_100018095 3300032002 Bacteria 4953
268 Ga0307416_100311510 3300032002 Bacteria 1571
269 Ga0307414_10009804 3300032004 Bacteria 5521
270 Ga0307510_10084516 3300033180 Bacteria 3056
271 Ga0316592_1010457 3300033524 Bacteria 1873
272 Ga0373926_0056900 3300035083 Bacteria 1419
273 Ga0373934_0048463 3300035086 Bacteria 1682
274 Ga0373936_0078468 3300035113 Bacteria 1371
275 Ga0373936_0144144 3300035113 Bacteria 1030
276 Ga0373945_0004496 3300035116 Bacteria 4435
277 Ga0373954_0015261 3300035118 Bacteria 3433
278 Ga0373956_0025169 3300035119 Bacteria 2570
279 Ga0373943_0015057 3300035170 Bacteria 3511
280 Ga0373946_0011231 3300035171 Bacteria 3336
281 Ga0373955_0012134 3300035172 Bacteria 4135
282 Ga0373931_0031538 3300035691 Bacteria 2736
283 Ga0373935_0070416 3300035692 Bacteria 2254
284 Ga0373935_0258906 3300035692 Bacteria 1220
285 Ga0373927_0027023 3300035695 Bacteria 3750
286 Ga0373933_0029653 3300035724 Bacteria 3165
287 Ga0373933_0086916 3300035724 Bacteria 1925
288 Ga0373947_0035501 3300035725 Bacteria 2952
289 Ga0373947_0128505 3300035725 Bacteria 1615
290 Ga0373937_0006327 3300036401 Bacteria 10209
291 Ga0373937_0020176 3300036401 Bacteria 5973
292 Ga0373937_0027602 3300036401 Bacteria 5135
293 Ga0373937_0216263 3300036401 Bacteria 1804
294 Ga0373925_0257410 3300037068 Bacteria 1401
295 Ga0395905_0004104 3300037471 Bacteria 15258
296 Ga0436364_0056880 3300037853 Bacteria 87492
297 Ga0436364_0723260 3300037853 Bacteria 46751
298 Ga0436364_1260460 3300037853 Bacteria 34019
299 Ga0395901_0180939 3300038443 Bacteria 2211
300 Ga0237819_09277 3300038705 Bacteria 1326
301 Ga0400487_28623 3300039110 Bacteria 17274
302 Ga0436365_0036381 3300039437 Bacteria 1551
303 Ga0436365_1164564 3300039437 Bacteria 2425
304 Ga0436360_0186592 3300039438 Bacteria 4129
305 Ga0436360_0307969 3300039438 Bacteria 1537
306 Ga0436360_0572509 3300039438 Bacteria 1403
307 Ga0436360_0734628 3300039438 Bacteria 2392
308 Ga0436360_0800231 3300039438 Bacteria 2473
309 Ga0436360_0839587 3300039438 Bacteria 1977
310 Ga0436361_0284071 3300039447 Bacteria 50310
311 Ga0436361_0606756 3300039447 Bacteria 2209
312 Ga0436361_0714916 3300039447 Bacteria 984
313 Ga0436361_1053619 3300039447 Bacteria 7181
314 Ga0436361_1216557 3300039447 Bacteria 1915
315 Ga0436363_0451735 3300039450 Bacteria 2405
316 Ga0436363_1129503 3300039450 Bacteria 1188
317 Ga0436363_1381957 3300039450 Bacteria 1375
318 Ga0436363_1460963 3300039450 Bacteria 4458
319 Ga0436362_0220171 3300039453 Bacteria 1319
320 Ga0436362_0436236 3300039453 Bacteria 3595
321 Ga0436362_0656757 3300039453 Bacteria 2439
322 Ga0436362_0999455 3300039453 Bacteria 1321
323 Ga0439438_001471 3300041405 Bacteria 10380
324 Ga0439438_005024 3300041405 Bacteria 4936
325 Ga0439438_008558 3300041405 Bacteria 3382
326 Ga0439438_008813 3300041405 Bacteria 3309
327 Ga0439447_002251 3300041407 Bacteria 7074
328 Ga0439466_0002838 3300041411 Bacteria 6779
329 Ga0439466_0004194 3300041411 Bacteria 5560
330 Ga0439466_0008003 3300041411 Bacteria 3986
331 Ga0439432_000967 3300042006 Bacteria 10835
332 Ga0439432_002797 3300042006 Bacteria 6506
333 Ga0439451_015276 3300042009 Bacteria 1547
334 Ga0439452_001447 3300042010 Bacteria 9700
335 Ga0439452_005155 3300042010 Bacteria 4250
336 Ga0439456_003614 3300042013 Bacteria 3141
337 Ga0439463_003014 3300042016 Bacteria 4274
338 Ga0450905_003390 3300042142 Bacteria 2094
339 Ga0450907_000326 3300042146 Bacteria 15234
340 Ga0439446_0000172 3300042156 Bacteria 11417
341 Ga0439446_0007048 3300042156 Bacteria 2946
342 Ga0439444_0004568 3300042437 Bacteria 2020
343 Ga0439460_0002152 3300042461 Bacteria 4727
344 Ga0451577_0157217 3300042876 Bacteria 2046
345 Ga0451577_0290548 3300042876 Bacteria 1481
346 Ga0439440_0004886 3300042993 Bacteria 2644
347 Ga0466966_0102598 3300044684 Bacteria 1768
348 Ga0453684_0002079 3300044712 Bacteria 50825
349 Ga0453684_0003561 3300044712 Bacteria 34833
350 Ga0466957_0378394 3300044842 Bacteria 965
351 Ga0466959_0620050 3300045049 Unclassified 727
352 Ga0451576_0001285 3300045051 Bacteria 43656
353 Ga0451576_0021642 3300045051 Bacteria 6987
354 Ga0451576_0024670 3300045051 Bacteria 6492
355 Ga0466958_0001326 3300045836 Bacteria 11669
356 Ga0466958_0302669 3300045836 Bacteria 1027
357 Ga0466967_0416720 3300045976 Bacteria 1308
358 Ga0466967_0558682 3300045976 Bacteria 1127
359 Ga0495617_001158 3300046452 Bacteria 11919
360 Ga0495627_000040 3300046453 Bacteria 195248
361 Ga0495627_000137 3300046453 Bacteria 87495
362 Ga0495603_0003767 3300046455 Bacteria 9020
363 Ga0495603_0049463 3300046455 Bacteria 2502
364 Ga0495590_0002219 3300046457 Bacteria 8116
365 Ga0495591_000023 3300046458 Bacteria 191598
366 Ga0495591_001514 3300046458 Bacteria 14316
367 Ga0495591_007986 3300046458 Bacteria 4398
368 Ga0495638_0077961 3300046460 Bacteria 2016
369 Ga0495653_0029603 3300046463 Bacteria 4369
370 Ga0495650_0007260 3300046471 Bacteria 6710
371 Ga0495650_0050834 3300046471 Bacteria 1711
372 Ga0495580_0022084 3300046472 Bacteria 4689
373 Ga0495605_0000245 3300046474 Bacteria 64374
374 Ga0495605_0001067 3300046474 Bacteria 18295
375 Ga0495605_0002605 3300046474 Bacteria 11085
376 Ga0495605_0010029 3300046474 Bacteria 5306
377 Ga0495605_0029245 3300046474 Bacteria 2839
378 Ga0495662_0101796 3300046476 Bacteria 1405
379 Ga0495584_0014523 3300046491 Bacteria 4011
380 Ga0495585_0002457 3300046492 Bacteria 13263
381 Ga0495585_0011404 3300046492 Bacteria 5259
382 Ga0495585_0013930 3300046492 Bacteria 4696
383 Ga0495585_0058023 3300046492 Bacteria 2135
384 Ga0495596_0000001 3300046500 Bacteria 501331
385 Ga0495596_0000375 3300046500 Bacteria 28559
386 Ga0495607_0000097 3300046501 Bacteria 92021
387 Ga0495607_0000234 3300046501 Bacteria 59488
388 Ga0495607_0000893 3300046501 Bacteria 27775
389 Ga0495607_0000972 3300046501 Bacteria 26545
390 Ga0495607_0004021 3300046501 Bacteria 11034
391 Ga0495607_0022053 3300046501 Bacteria 4003
392 Ga0495583_0003081 3300046506 Bacteria 13200
393 Ga0495583_0003683 3300046506 Bacteria 11408
394 Ga0495606_0000167 3300046507 Bacteria 115739
395 Ga0495606_0003593 3300046507 Bacteria 16335
396 Ga0495606_0004329 3300046507 Bacteria 14275
397 Ga0495606_0045902 3300046507 Bacteria 2891
398 Ga0495610_0026298 3300046512 Bacteria 3108
399 Ga0495610_0045368 3300046512 Bacteria 2175
400 Ga0495616_0018868 3300046513 Bacteria 3772
401 Ga0495616_0039392 3300046513 Bacteria 2420
402 Ga0495616_0058008 3300046513 Bacteria 1907
403 Ga0495620_0000003 3300046515 Bacteria 345923
404 Ga0495620_0009640 3300046515 Bacteria 5125
405 Ga0495620_0052081 3300046515 Bacteria 1740
406 Ga0495630_0094256 3300046517 Bacteria 2263
407 Ga0495631_0001015 3300046518 Bacteria 17434
408 Ga0495631_0006645 3300046518 Bacteria 5946
409 Ga0495631_0055140 3300046518 Bacteria 1731
410 Ga0495632_0001340 3300046519 Bacteria 20692
411 Ga0495632_0003328 3300046519 Bacteria 11458
412 Ga0495632_0004266 3300046519 Bacteria 9758
413 Ga0495632_0079706 3300046519 Bacteria 1563
414 Ga0495637_0000583 3300046520 Bacteria 25971
415 Ga0495637_0002931 3300046520 Bacteria 9200
416 Ga0495637_0003057 3300046520 Bacteria 8945
417 Ga0495637_0024711 3300046520 Bacteria 2717
418 Ga0495643_0000673 3300046522 Bacteria 40197
419 Ga0495643_0001803 3300046522 Bacteria 18339
420 Ga0495644_0003207 3300046523 Bacteria 6461
421 Ga0495648_0003579 3300046524 Bacteria 13596
422 Ga0495648_0004170 3300046524 Bacteria 12431
423 Ga0495648_0010693 3300046524 Bacteria 6971
424 Ga0495642_0001942 3300046528 Bacteria 8738
425 Ga0495642_0006012 3300046528 Bacteria 4661
426 Ga0495654_0008388 3300046530 Bacteria 5712
427 Ga0495654_0015800 3300046530 Bacteria 4003
428 Ga0495654_0035682 3300046530 Bacteria 2501
429 Ga0495654_0040236 3300046530 Bacteria 2330
430 Ga0495586_0034252 3300046535 Bacteria 2727
431 Ga0495587_0006269 3300046536 Bacteria 7762
432 Ga0495609_0000167 3300046538 Bacteria 68911
433 Ga0495609_0003356 3300046538 Bacteria 9226
434 Ga0495609_0006411 3300046538 Bacteria 6005
435 Ga0495597_0000016 3300046542 Bacteria 167456
436 Ga0495597_0008843 3300046542 Bacteria 5024
437 Ga0495622_0001305 3300046557 Bacteria 12775
438 Ga0495622_0012102 3300046557 Bacteria 3990
439 Ga0495622_0142618 3300046557 Bacteria 1087
440 Ga0495633_0003087 3300046558 Bacteria 11324
441 Ga0495667_0031187 3300046559 Bacteria 3579
442 Ga0495667_0142330 3300046559 Bacteria 1545
443 Ga0495656_0004946 3300046615 Bacteria 4588
444 Ga0495625_0000134 3300046660 Bacteria 115073
445 Ga0495625_0051221 3300046660 Bacteria 2960
446 Ga0495625_0135573 3300046660 Bacteria 1664
447 Ga0495635_0027178 3300046663 Bacteria 3981
448 Ga0495635_0102510 3300046663 Bacteria 1956
449 Ga0495659_0001323 3300046664 Bacteria 8509
450 Ga0495661_0000030 3300046665 Bacteria 171980
451 Ga0495661_0000088 3300046665 Bacteria 111782
452 Ga0495661_0009503 3300046665 Bacteria 6674
453 Ga0495661_0025395 3300046665 Bacteria 3826
454 Ga0495657_0104340 3300046675 Bacteria 1803
455 Ga0495599_0057891 3300046678 Bacteria 2425
456 Ga0495623_0024699 3300046679 Bacteria 3869
457 Ga0495669_0033833 3300046684 Bacteria 2251
458 Ga0495670_0002914 3300046691 Bacteria 8429
459 Ga0495670_0030265 3300046691 Bacteria 2689
460 Ga0495671_0023443 3300046692 Bacteria 3224
461 Ga0495671_0030450 3300046692 Bacteria 2763
462 Ga0495649_0000864 3300046694 Bacteria 24358
463 Ga0495649_0001550 3300046694 Bacteria 17244
464 Ga0495649_0050595 3300046694 Bacteria 2254
465 Ga0495589_0000881 3300046794 Bacteria 18650
466 Ga0495589_0007709 3300046794 Bacteria 5633
467 Ga0495589_0057115 3300046794 Bacteria 1920
468 Ga0495600_0060110 3300046809 Bacteria 2481
469 Ga0495600_0096446 3300046809 Bacteria 1928
470 Ga0495660_0001771 3300046810 Bacteria 14286
471 Ga0495660_0005240 3300046810 Bacteria 7778
472 Ga0495660_0027927 3300046810 Bacteria 3190
473 Ga0495660_0084170 3300046810 Bacteria 1663
474 Ga0495604_0036434 3300047317 Bacteria 3878
475 Ga0495636_0005048 3300047318 Bacteria 5181
476 Ga0495636_0009958 3300047318 Bacteria 3745
477 Ga0495672_0002710 3300047320 Bacteria 15891
478 Ga0495672_0012883 3300047320 Bacteria 5799
479 Ga0495672_0013396 3300047320 Bacteria 5659
480 Ga0495672_0139527 3300047320 Bacteria 1267
481 Ga0495676_0000018 3300047321 Bacteria 178380
482 Ga0495680_0156474 3300047322 Bacteria 1657
483 Ga0495680_0238027 3300047322 Bacteria 1294
484 Ga0495683_0000081 3300047323 Bacteria 95260
485 Ga0495683_0001199 3300047323 Bacteria 17691
486 Ga0495687_011688 3300047443 Bacteria 4696
487 Ga0495675_0005746 3300047444 Bacteria 7588
488 Ga0495679_007522 3300047446 Bacteria 4528
489 Ga0495673_0003548 3300047469 Bacteria 10270
490 Ga0495673_0005161 3300047469 Bacteria 7955
491 Ga0495673_0011087 3300047469 Bacteria 4870
492 Ga0495681_0002659 3300047470 Bacteria 12664
493 Ga0495681_0004092 3300047470 Bacteria 10026
494 Ga0495681_0007297 3300047470 Bacteria 7087
495 Ga0495681_0018194 3300047470 Bacteria 3878
496 Ga0495681_0044875 3300047470 Bacteria 2120
497 Ga0495684_0034497 3300047471 Bacteria 3882
498 Ga0495593_0029162 3300047673 Bacteria 3027
499 Ga0495626_0000125 3300048091 Bacteria 99451
500 Ga0495626_0003758 3300048091 Bacteria 9556
501 Ga0495626_0004444 3300048091 Bacteria 8605
502 Ga0496102_0008143 3300048905 Bacteria 8969
503 Ga0496106_0247213 3300048909 Bacteria 1426
504 Ga0496112_0038138 3300048915 Bacteria 4692
505 Ga0496113_0052589 3300048916 Bacteria 3043
506 Ga0496114_0012877 3300048917 Bacteria 6699
507 Ga0496114_0014042 3300048917 Bacteria 6423
508 Ga0496114_0040220 3300048917 Bacteria 3870
509 Ga0496116_0001043 3300048919 Bacteria 33784
510 Ga0496117_0015449 3300048920 Bacteria 6510
511 Ga0496117_0105712 3300048920 Bacteria 1768
512 Ga0496118_0009485 3300048921 Bacteria 9816
513 Ga0496118_0022994 3300048921 Bacteria 5428
514 Ga0496118_0060355 3300048921 Bacteria 2816
515 Ga0496119_0000444 3300048922 Bacteria 56759
516 Ga0496120_0001654 3300048923 Bacteria 25753
517 Ga0496121_0005707 3300048924 Bacteria 15809
518 Ga0496121_0063203 3300048924 Bacteria 3027
519 Ga0496121_0185589 3300048924 Bacteria 1496
520 Ga0496122_0006709 3300048925 Bacteria 13098
521 Ga0496122_0020183 3300048925 Bacteria 6039
522 Ga0496122_0077198 3300048925 Bacteria 2340
523 Ga0496123_0000887 3300048926 Bacteria 47327
524 Ga0496123_0001511 3300048926 Bacteria 32223
525 Ga0496123_0027233 3300048926 Bacteria 4262
526 Ga0496124_0022637 3300048927 Bacteria 5754
527 Ga0496124_0033678 3300048927 Bacteria 4505
528 Ga0496124_0098145 3300048927 Bacteria 2377
529 Ga0496124_0145885 3300048927 Bacteria 1862
530 Ga0496124_0295162 3300048927 Bacteria 1174
531 Ga0496125_0003525 3300048928 Bacteria 18884
532 Ga0496125_0034533 3300048928 Bacteria 4456
533 Ga0496125_0151532 3300048928 Bacteria 1591
534 Ga0496126_0050942 3300048929 Bacteria 3772
535 Ga0496126_0070794 3300048929 Bacteria 3106
536 Ga0496126_0099536 3300048929 Bacteria 2546
537 Ga0495678_000918 3300049459 Bacteria 25900
538 Ga0495682_0000050 3300049460 Bacteria 110280
539 Ga0495682_0001437 3300049460 Bacteria 12877
540 Ga0495682_0009054 3300049460 Bacteria 3904
541 Ga0501315_006626 3300049531 Bacteria 1295
542 Ga0501034_0000150 3300049571 Bacteria 131760
543 Ga0501034_0081970 3300049571 Bacteria 3228
544 Ga0501034_0101361 3300049571 Bacteria 2873
545 Ga0501034_0131785 3300049571 Bacteria 2483
546 Ga0501037_0019636 3300049573 Bacteria 4986
547 Ga0501070_0509753 3300049586 Bacteria 966
548 Ga0501076_0353512 3300049592 Bacteria 1207
549 Ga0501083_0007057 3300049744 Bacteria 7978
550 nmdc:mga0n895_145778_c1 3300050512 Bacteria 2397
551 nmdc:mga0n895_381445_c1 3300050512 Bacteria 1426
552 nmdc:mga0rr50_54084_c1 3300050513 Bacteria 2989
553 Ga0495601_0008558 3300053077 Bacteria 6043
554 Ga0495601_0091978 3300053077 Bacteria 1953
555 Ga0495619_0010468 3300053085 Bacteria 5833
556 Ga0495619_0050642 3300053085 Bacteria 2742
557 Ga0495619_0134760 3300053085 Bacteria 1698
558 Ga0495619_0183361 3300053085 Bacteria 1448
559 Ga0495619_0322549 3300053085 Bacteria 1069
560 Ga0500659_0002281 3300053135 Bacteria 11593
561 Ga0501082_0020563 3300060353 Bacteria 5689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0620050 Ga0466959_0620050_40_711 215
2 3300039450 Ga0436363_1381957 Ga0436363_1381957_390_1298 255
3 3300002737 JGI25162J39368_1000315 JGI25162J39368_100031526 257
4 3300002771 JGI25163J39215_1001111 JGI25163J39215_10011111 257
5 3300002772 JGI25164J39214_1000411 JGI25164J39214_100041126 257
6 3300003214 JGI25165J46597_1000430 JGI25165J46597_100043020 257
7 3300003578 Ga0006562J51391_1037971 Ga0006562J51391_10379712 257
8 3300005288 Ga0065714_10000034 Ga0065714_100000344 257
9 3300005289 Ga0065704_10194481 Ga0065704_101944811 257
10 3300005290 Ga0065712_10069558 Ga0065712_100695585 257
11 3300005457 Ga0070662_100032504 Ga0070662_1000325042 257
12 3300046492 Ga0495585_0011404 Ga0495585_0011404_4210_4986 257
13 3300046665 Ga0495661_0000030 Ga0495661_0000030_81846_82622 257
14 3300048927 Ga0496124_0098145 Ga0496124_0098145_1546_2319 257
15 3300048929 Ga0496126_0070794 Ga0496126_0070794_2031_2804 257
16 iso_pu_bacteria 2511231156 2511826334 261
17 iso_pu_bacteria 2651869719 2652544538 261
18 3300039447 Ga0436361_0284071 Ga0436361_0284071_41409_42206 264
19 3300002737 JGI25162J39368_1000251 JGI25162J39368_100025129 265
20 3300002772 JGI25164J39214_1000194 JGI25164J39214_100019425 265
21 3300003214 JGI25165J46597_1000348 JGI25165J46597_100034825 265
22 3300003781 Ga0055536_1004018 Ga0055536_10040188 265
23 3300003794 Ga0055531_10000997 Ga0055531_1000099710 265
24 3300006058 Ga0075432_10101495 Ga0075432_101014951 265
25 3300006946 Ga0079104_1000982 Ga0079104_10009829 265
26 3300006948 Ga0099826_10003959 Ga0099826_1000395910 265
27 3300009093 Ga0105240_10041595 Ga0105240_100415953 265
28 3300025207 Ga0209760_100064 Ga0209760_10006424 265
29 3300025230 Ga0209563_100495 Ga0209563_1004956 265
30 3300025292 Ga0209676_1000006 Ga0209676_1000006220 265
31 3300025292 Ga0209676_1000803 Ga0209676_100080324 265
32 3300025292 Ga0209676_1001140 Ga0209676_100114020 265
33 3300025298 Ga0209050_1000070 Ga0209050_1000070299 265
34 3300025298 Ga0209050_1000235 Ga0209050_100023594 265
35 3300025303 Ga0209051_1000086 Ga0209051_1000086132 265
36 3300025711 Ga0207696_1000025 Ga0207696_1000025279 265
37 3300025728 Ga0207655_1000183 Ga0207655_100018338 265
38 3300025728 Ga0207655_1000592 Ga0207655_100059225 265
39 3300025728 Ga0207655_1005485 Ga0207655_10054858 265
40 3300025728 Ga0207655_1012126 Ga0207655_10121264 265
41 3300025735 Ga0207713_1001249 Ga0207713_10012498 265
42 3300025735 Ga0207713_1003177 Ga0207713_10031775 265
43 3300025923 Ga0207681_10088241 Ga0207681_100882411 265
44 3300027111 Ga0209281_1000010 Ga0209281_1000010574 265
45 3300027111 Ga0209281_1005471 Ga0209281_10054714 265
46 3300027312 Ga0209371_1000182 Ga0209371_100018234 265
47 3300030500 Ga0268256_1000153 Ga0268256_100015343 265
48 3300030735 Ga0316178_1108793 Ga0316178_11087936 265
49 3300032004 Ga0307414_10009804 Ga0307414_100098046 265
50 3300037068 Ga0373925_0257410 Ga0373925_0257410_336_1169 265
51 3300039438 Ga0436360_0186592 Ga0436360_0186592_2882_3679 265
52 3300039438 Ga0436360_0734628 Ga0436360_0734628_1138_1935 265
53 iso_pu_bacteria 2547132103 2547373211 265
54 iso_pu_bacteria 2639762793 2640733241 265
55 iso_pu_bacteria 2643221665 2644363266 265
56 iso_pu_bacteria 2675903507 2678230292 265
57 iso_pu_bacteria 2744054655 2745161280 265
58 iso_pu_bacteria 2773857761 2774389159 265
59 iso_pu_bacteria 2773857770 2774439347 265
60 iso_pu_bacteria 2843690924 2843694272 265
61 iso_pu_bacteria 2846033681 2846035820 265
62 iso_pu_bacteria 2846037992 2846040381 265
63 iso_pu_bacteria 2916699645 2916701370 265
64 iso_pu_bacteria 2919182534 2919185422 265
65 iso_pu_bacteria 2919506607 2919508533 265
66 iso_pu_bacteria 2928515477 2928516348 265
67 iso_pu_bacteria 2984568884 2984572338 265
68 iso_pu_bacteria 8002745576 8002750044 265
69 iso_pu_bacteria 8033232454 8033233664 265
70 3300053085 Ga0495619_0322549 Ga0495619_0322549_227_1027 266
71 iso_pu_bacteria 2510065053 2510285129 266
72 iso_pu_bacteria 2510065055 2510294034 266
73 iso_pu_bacteria 2510065058 2510313068 266
74 iso_pu_bacteria 2511231004 2511254566 266
75 iso_pu_bacteria 2511231006 2511267037 266
76 iso_pu_bacteria 2511231007 2511273791 266
77 iso_pu_bacteria 2511231008 2511276685 266
78 iso_pu_bacteria 2511231010 2511292990 266
79 iso_pu_bacteria 2511231011 2511293233 266
80 iso_pu_bacteria 2511231012 2511301881 266
81 iso_pu_bacteria 2511231014 2511314629 266
82 iso_pu_bacteria 2511231015 2511317210 266
83 iso_pu_bacteria 2511231016 2511323969 266
84 iso_pu_bacteria 2511231017 2511331559 266
85 iso_pu_bacteria 2511231018 2511339606 266
86 iso_pu_bacteria 2511231019 2511344680 266
87 iso_pu_bacteria 2511231020 2511349360 266
88 iso_pu_bacteria 2511231021 2511355243 266
89 iso_pu_bacteria 2511231022 2511366151 266
90 iso_pu_bacteria 2511231023 2511368708 266
91 iso_pu_bacteria 2511231024 2511374558 266
92 iso_pu_bacteria 2511231031 2511413526 266
93 iso_pu_bacteria 2512047018 2512324133 266
94 iso_pu_bacteria 2554235341 2555671395 266
95 iso_pu_bacteria 2582580891 2583793803 266
96 iso_pu_bacteria 2597489887 2597859477 266
97 iso_pu_bacteria 2599185155 2599328601 266
98 iso_pu_bacteria 2599185160 2599354448 266
99 iso_pu_bacteria 2599185161 2599359838 266
100 iso_pu_bacteria 2599185162 2599366160 266
101 iso_pu_bacteria 2599185163 2599372950 266
102 iso_pu_bacteria 2599185164 2599379556 266
103 iso_pu_bacteria 2599185165 2599385466 266
104 iso_pu_bacteria 2599185166 2599391809 266
105 iso_pu_bacteria 2599185168 2599403575 266
106 iso_pu_bacteria 2599185181 2599461282 266
107 iso_pu_bacteria 2599185182 2599469826 266
108 iso_pu_bacteria 2599185185 2599482307 266
109 iso_pu_bacteria 2599185186 2599490302 266
110 iso_pu_bacteria 2599185188 2599504166 266
111 iso_pu_bacteria 2599185212 2599613451 266
112 iso_pu_bacteria 2599185248 2599772358 266
113 iso_pu_bacteria 2599185257 2599803974 266
114 iso_pu_bacteria 2599185289 2599888921 266
115 iso_pu_bacteria 2599185291 2599900550 266
116 iso_pu_bacteria 2599185300 2599933573 266
117 iso_pu_bacteria 2599185302 2599943976 266
118 iso_pu_bacteria 2599185304 2599955812 266
119 iso_pu_bacteria 2599185305 2599961446 266
120 iso_pu_bacteria 2599185306 2599969718 266
121 iso_pu_bacteria 2599185307 2599975238 266
122 iso_pu_bacteria 2599185308 2599981192 266
123 iso_pu_bacteria 2599185309 2599985613 266
124 iso_pu_bacteria 2599185310 2599989537 266
125 iso_pu_bacteria 2599185311 2599994409 266
126 iso_pu_bacteria 2599185312 2600000118 266
127 iso_pu_bacteria 2599185313 2600009097 266
128 iso_pu_bacteria 2599185314 2600015037 266
129 iso_pu_bacteria 2599185315 2600019612 266
130 iso_pu_bacteria 2599185316 2600023703 266
131 iso_pu_bacteria 2599185317 2600032347 266
132 iso_pu_bacteria 2599185318 2600038791 266
133 iso_pu_bacteria 2599185319 2600044165 266
134 iso_pu_bacteria 2599185320 2600048373 266
135 iso_pu_bacteria 2599185321 2600054122 266
136 iso_pu_bacteria 2599185322 2600060340 266
137 iso_pu_bacteria 2599185323 2600066570 266
138 iso_pu_bacteria 2599185324 2600074351 266
139 iso_pu_bacteria 2599185325 2600078122 266
140 iso_pu_bacteria 2599185356 2600213898 266
141 iso_pu_bacteria 2600254930 2600361909 266
142 iso_pu_bacteria 2600254931 2600364382 266
143 iso_pu_bacteria 2600254954 2600443225 266
144 iso_pu_bacteria 2600255283 2601626598 266
145 iso_pu_bacteria 2600255313 2601774064 266
146 iso_pu_bacteria 2600255318 2601795609 266
147 iso_pu_bacteria 2600255389 2602009294 266
148 iso_pu_bacteria 2603880185 2606075678 266
149 iso_pu_bacteria 2603880199 2606128409 266
150 iso_pu_bacteria 2623620443 2624479548 266
151 iso_pu_bacteria 2623620446 2624493443 266
152 iso_pu_bacteria 2643221565 2643842729 266
153 iso_pu_bacteria 2643221589 2643952678 266
154 iso_pu_bacteria 2643221602 2644022440 266
155 iso_pu_bacteria 2643221633 2644185511 266
156 iso_pu_bacteria 2643221650 2644286888 266
157 iso_pu_bacteria 2667528170 2671093211 266
158 iso_pu_bacteria 2667528171 2671097029 266
159 iso_pu_bacteria 2667528176 2671128922 266
160 iso_pu_bacteria 2671180172 2671770458 266
161 iso_pu_bacteria 2675903515 2678264682 266
162 iso_pu_bacteria 2713897148 2715753949 266
163 iso_pu_bacteria 2713897149 2715757813 266
164 iso_pu_bacteria 2718217725 2718633376 266
165 iso_pu_bacteria 2728369097 2729147540 266
166 iso_pu_bacteria 2738541271 2738691377 266
167 iso_pu_bacteria 2738543004 2739201221 266
168 iso_pu_bacteria 2738543015 2739262410 266
169 iso_pu_bacteria 2738543016 2739267152 266
170 iso_pu_bacteria 2738543025 2739316180 266
171 iso_pu_bacteria 2740892503 2743739007 266
172 iso_pu_bacteria 2744054620 2745005136 266
173 iso_pu_bacteria 2765235841 2765585448 266
174 iso_pu_bacteria 2773857670 2774119164 266
175 iso_pu_bacteria 2773857672 2774128221 266
176 iso_pu_bacteria 2773857673 2774138438 266
177 iso_pu_bacteria 2784132063 2784265541 266
178 iso_pu_bacteria 2784132072 2784314814 266
179 iso_pu_bacteria 2791355520 2794595055 266
180 iso_pu_bacteria 2808606361 2808857082 266
181 iso_pu_bacteria 2808606376 2808926692 266
182 iso_pu_bacteria 2808606377 2808927476 266
183 iso_pu_bacteria 2808606378 2808937154 266
184 iso_pu_bacteria 2808606379 2808939301 266
185 iso_pu_bacteria 2808606380 2808948853 266
186 iso_pu_bacteria 2808606381 2808949984 266
187 iso_pu_bacteria 2808606382 2808959008 266
188 iso_pu_bacteria 2808606383 2808965470 266
189 iso_pu_bacteria 2808606389 2809000289 266
190 iso_pu_bacteria 2808606445 2809216490 266
191 iso_pu_bacteria 2811994881 2812371261 266
192 iso_pu_bacteria 2818991456 2819654682 266
193 iso_pu_bacteria 2818991464 2819702123 266
194 iso_pu_bacteria 2823421272 2823424845 266
195 iso_pu_bacteria 2825651385 2825656430 266
196 iso_pu_bacteria 2826581358 2826584512 266
197 iso_pu_bacteria 2842815866 2842818066 266
198 iso_pu_bacteria 2842832357 2842832582 266
199 iso_pu_bacteria 2842843487 2842848858 266
200 iso_pu_bacteria 2842849001 2842849298 266
201 iso_pu_bacteria 2842854478 2842856814 266
202 iso_pu_bacteria 2844665904 2844671914 266
203 iso_pu_bacteria 2852657418 2852659034 266
204 iso_pu_bacteria 2860339153 2860339905 266
205 iso_pu_bacteria 2878029506 2878031553 266
206 iso_pu_bacteria 2880230671 2880232424 266
207 iso_pu_bacteria 2904518522 2904523884 266
208 iso_pu_bacteria 2904550169 2904552865 266
209 iso_pu_bacteria 2912963787 2912967682 266
210 iso_pu_bacteria 2913036834 2913041158 266
211 iso_pu_bacteria 2917070673 2917075261 266
212 iso_pu_bacteria 2917832318 2917835429 266
213 iso_pu_bacteria 2919063839 2919063978 266
214 iso_pu_bacteria 2919125081 2919129239 266
215 iso_pu_bacteria 2919155634 2919159939 266
216 iso_pu_bacteria 2919385768 2919386519 266
217 iso_pu_bacteria 2919456309 2919457000 266
218 iso_pu_bacteria 2919481497 2919486084 266
219 iso_pu_bacteria 2919487758 2919491201 266
220 iso_pu_bacteria 2919697872 2919699292 266
221 iso_pu_bacteria 2923153595 2923158086 266
222 iso_pu_bacteria 2923519811 2923525372 266
223 iso_pu_bacteria 2923586266 2923590141 266
224 iso_pu_bacteria 2929144301 2929148611 266
225 iso_pu_bacteria 2931369376 2931373953 266
226 iso_pu_bacteria 2931396565 2931400202 266
227 iso_pu_bacteria 2935353572 2935356249 266
228 iso_pu_bacteria 2939636861 2939639632 266
229 iso_pu_bacteria 2939651529 2939655856 266
230 iso_pu_bacteria 2969304461 2969306335 266
231 iso_pu_bacteria 2974289157 2974292010 266
232 iso_pu_bacteria 2974298342 2974299622 266
233 iso_pu_bacteria 2984286254 2984288092 266
234 iso_pu_bacteria 2984499530 2984501979 266
235 iso_pu_bacteria 2984504281 2984504522 266
236 iso_pu_bacteria 2988728565 2988730200 266
237 iso_pu_bacteria 2998139840 2998141734 266
238 iso_pu_bacteria 3007252601 3007256631 266
239 iso_pu_bacteria 3007315729 3007319129 266
240 iso_pu_bacteria 3007395558 3007397391 266
241 iso_pu_bacteria 3007511990 3007515258 266
242 iso_pu_bacteria 3007614139 3007616560 266
243 iso_pu_bacteria 3007619802 3007620058 266
244 iso_pu_bacteria 3007718800 3007719374 266
245 iso_pu_bacteria 3007803356 3007809266 266
246 iso_pu_bacteria 3007855910 3007856321 266
247 iso_pu_bacteria 3007861166 3007863032 266
248 iso_pu_bacteria 3007866637 3007870544 266
249 iso_pu_bacteria 3007872151 3007875289 266
250 iso_pu_bacteria 637000220 637321717 266
251 iso_pu_bacteria 651053060 651175314 266
252 iso_pu_bacteria 8011350971 8011353895 266
253 iso_pu_bacteria 8015687852 8015692182 266
254 iso_pu_bacteria 8016728285 8016733672 266
255 iso_pu_bacteria 8019769354 8019773034 266
256 iso_pu_bacteria 8019775933 8019776438 266
257 iso_pu_bacteria 8029995093 8029999026 266
258 iso_pu_bacteria 8034962539 8034962823 266
259 iso_pu_bacteria 8052494512 8052495917 266
260 iso_pu_bacteria 8054929484 8054932285 266
261 iso_pu_bacteria 8055770955 8055775391 266
262 iso_pu_bacteria 8055878733 8055878910 266
263 iso_pu_bacteria 8056125926 8056130076 266
264 iso_pu_bacteria 8056137416 8056138843 266
265 iso_pu_bacteria 8056143049 8056144771 266
266 iso_pu_bacteria 8056155041 8056156120 266
267 iso_pu_bacteria 8056166840 8056169261 266
268 iso_pu_bacteria 8056172158 8056175450 266
269 iso_pu_bacteria 8056177738 8056181254 266
270 iso_pu_bacteria 8056569372 8056571464 266
271 iso_pu_bacteria 8057798959 8057804207 266
272 3300006871 Ga0075434_100059625 Ga0075434_1000596254 267
273 3300039437 Ga0436365_0036381 Ga0436365_0036381_317_1120 267
274 3300039447 Ga0436361_1053619 Ga0436361_1053619_1333_2136 267
275 3300044712 Ga0453684_0002079 Ga0453684_0002079_1464_2339 267
276 3300050512 nmdc:mga0n895_145778_c1 nmdc:mga0n895_145778_c1_390_1202 267
277 3300039110 Ga0400487_28623 Ga0400487_28623_2406_3212 268
278 3300044712 Ga0453684_0003561 Ga0453684_0003561_9496_10302 268
279 2162886007 SwRhRL2b_contig_2798511 SwRhRL2b_0656.00007630 269
280 3300003320 rootH2_10091229 rootH2_100912295 269
281 3300003323 rootH1_10005337 rootH1_1000533713 269
282 3300003578 Ga0006562J51391_1018591 Ga0006562J51391_10185913 269
283 3300003856 Ga0058692_1000014 Ga0058692_1000014277 269
284 3300005272 Ga0065703_1000184 Ga0065703_100018414 269
285 3300005289 Ga0065704_10015961 Ga0065704_100159613 269
286 3300005353 Ga0070669_100008078 Ga0070669_1000080786 269
287 3300005548 Ga0070665_100018863 Ga0070665_1000188636 269
288 3300006051 Ga0075364_10068387 Ga0075364_100683872 269
289 3300006177 Ga0075362_10056973 Ga0075362_100569732 269
290 3300009011 Ga0105251_10083294 Ga0105251_100832942 269
291 3300009036 Ga0105244_10031086 Ga0105244_100310863 269
292 3300009092 Ga0105250_10041937 Ga0105250_100419372 269
293 3300009093 Ga0105240_10004855 Ga0105240_1000485513 269
294 3300009148 Ga0105243_10000249 Ga0105243_1000024948 269
295 3300009553 Ga0105249_10000342 Ga0105249_1000034220 269
296 3300013102 Ga0157371_10029699 Ga0157371_100296993 269
297 3300021361 Ga0213872_10000652 Ga0213872_1000065217 269
298 3300021361 Ga0213872_10001532 Ga0213872_1000153210 269
299 3300021361 Ga0213872_10001557 Ga0213872_1000155713 269
300 3300021361 Ga0213872_10001677 Ga0213872_1000167710 269
301 3300021361 Ga0213872_10026800 Ga0213872_100268004 269
302 3300025711 Ga0207696_1006846 Ga0207696_10068465 269
303 3300025728 Ga0207655_1006081 Ga0207655_10060816 269
304 3300025728 Ga0207655_1025877 Ga0207655_10258773 269
305 3300025735 Ga0207713_1001767 Ga0207713_10017676 269
306 3300025900 Ga0207710_10000122 Ga0207710_1000012213 269
307 3300025913 Ga0207695_10015272 Ga0207695_100152728 269
308 3300025923 Ga0207681_10005882 Ga0207681_100058824 269
309 3300025935 Ga0207709_10000001 Ga0207709_100000012106 269
310 3300025961 Ga0207712_10001909 Ga0207712_100019097 269
311 3300027312 Ga0209371_1000040 Ga0209371_100004013 269
312 3300028379 Ga0268266_10014923 Ga0268266_100149235 269
313 3300030500 Ga0268256_1000041 Ga0268256_1000041302 269
314 3300031548 Ga0307408_100000192 Ga0307408_10000019239 269
315 3300031711 Ga0265314_10038335 Ga0265314_100383353 269
316 3300031824 Ga0307413_10226145 Ga0307413_102261452 269
317 3300031901 Ga0307406_10004592 Ga0307406_100045925 269
318 3300037471 Ga0395905_0004104 Ga0395905_0004104_11111_11923 269
319 3300039438 Ga0436360_0307969 Ga0436360_0307969_18_830 269
320 3300039447 Ga0436361_0606756 Ga0436361_0606756_591_1427 269
321 3300039447 Ga0436361_0714916 Ga0436361_0714916_46_858 269
322 3300039447 Ga0436361_1216557 Ga0436361_1216557_277_1089 269
323 3300042876 Ga0451577_0157217 Ga0451577_0157217_57_869 269
324 3300044684 Ga0466966_0102598 Ga0466966_0102598_203_1015 269
325 3300045051 Ga0451576_0001285 Ga0451576_0001285_18404_19216 269
326 3300045051 Ga0451576_0021642 Ga0451576_0021642_1031_1843 269
327 3300045051 Ga0451576_0024670 Ga0451576_0024670_500_1312 269
328 3300045836 Ga0466958_0001326 Ga0466958_0001326_5416_6228 269
329 3300049592 Ga0501076_0353512 Ga0501076_0353512_309_1121 269
330 iso_pu_bacteria 2551306352 2552746210 269
331 2124908027 MRS2a_Contig_23 MRS2a_00132680 270
332 2124908027 MRS2a_Contig_6280 MRS2a_00181460 270
333 3300002987 JGI25159J45721_1001567 JGI25159J45721_10015675 270
334 3300003323 rootH1_10167004 rootH1_101670046 270
335 3300003775 Ga0055524_1000017 Ga0055524_1000017135 270
336 3300005288 Ga0065714_10070725 Ga0065714_100707253 270
337 3300005288 Ga0065714_10183392 Ga0065714_101833921 270
338 3300005290 Ga0065712_10067911 Ga0065712_1006791112 270
339 3300005293 Ga0065715_10234727 Ga0065715_102347271 270
340 3300005337 Ga0070682_100033828 Ga0070682_1000338283 270
341 3300005339 Ga0070660_100030566 Ga0070660_1000305663 270
342 3300005355 Ga0070671_100029170 Ga0070671_1000291703 270
343 3300005355 Ga0070671_100179916 Ga0070671_1001799161 270
344 3300005434 Ga0070709_10010843 Ga0070709_100108435 270
345 3300005435 Ga0070714_100032520 Ga0070714_1000325205 270
346 3300005435 Ga0070714_100254214 Ga0070714_1002542142 270
347 3300005436 Ga0070713_100091115 Ga0070713_1000911153 270
348 3300005436 Ga0070713_100288260 Ga0070713_1002882602 270
349 3300005437 Ga0070710_10111820 Ga0070710_101118201 270
350 3300005439 Ga0070711_100024685 Ga0070711_1000246855 270
351 3300005439 Ga0070711_100210121 Ga0070711_1002101211 270
352 3300005439 Ga0070711_100494301 Ga0070711_1004943011 270
353 3300005445 Ga0070708_100310713 Ga0070708_1003107132 270
354 3300005467 Ga0070706_100018287 Ga0070706_1000182878 270
355 3300005467 Ga0070706_100093967 Ga0070706_1000939674 270
356 3300005468 Ga0070707_100020705 Ga0070707_1000207053 270
357 3300005471 Ga0070698_100017589 Ga0070698_1000175897 270
358 3300005471 Ga0070698_100401646 Ga0070698_1004016462 270
359 3300005471 Ga0070698_100406750 Ga0070698_1004067501 270
360 3300005518 Ga0070699_100172711 Ga0070699_1001727113 270
361 3300005518 Ga0070699_100382835 Ga0070699_1003828351 270
362 3300005518 Ga0070699_100466838 Ga0070699_1004668382 270
363 3300005535 Ga0070684_100095369 Ga0070684_1000953693 270
364 3300005536 Ga0070697_100031861 Ga0070697_1000318615 270
365 3300005536 Ga0070697_100336889 Ga0070697_1003368892 270
366 3300005719 Ga0068861_100552079 Ga0068861_1005520791 270
367 3300006028 Ga0070717_10011796 Ga0070717_100117965 270
368 3300006058 Ga0075432_10130832 Ga0075432_101308322 270
369 3300006173 Ga0070716_100029621 Ga0070716_1000296213 270
370 3300006173 Ga0070716_100053936 Ga0070716_1000539361 270
371 3300006175 Ga0070712_100013081 Ga0070712_1000130812 270
372 3300006175 Ga0070712_100027336 Ga0070712_1000273365 270
373 3300006353 Ga0075370_10143729 Ga0075370_101437291 270
374 3300006914 Ga0075436_100012460 Ga0075436_1000124606 270
375 3300007788 Ga0099795_10001078 Ga0099795_100010782 270
376 3300007788 Ga0099795_10008269 Ga0099795_100082692 270
377 3300009011 Ga0105251_10000035 Ga0105251_10000035120 270
378 3300009011 Ga0105251_10005924 Ga0105251_100059247 270
379 3300009011 Ga0105251_10032130 Ga0105251_100321301 270
380 3300009011 Ga0105251_10065962 Ga0105251_100659623 270
381 3300009011 Ga0105251_10083088 Ga0105251_100830882 270
382 3300009011 Ga0105251_10200108 Ga0105251_102001081 270
383 3300009036 Ga0105244_10001134 Ga0105244_1000113418 270
384 3300009036 Ga0105244_10017376 Ga0105244_100173764 270
385 3300009036 Ga0105244_10091482 Ga0105244_100914823 270
386 3300009092 Ga0105250_10000056 Ga0105250_1000005663 270
387 3300009092 Ga0105250_10011835 Ga0105250_100118355 270
388 3300009092 Ga0105250_10023276 Ga0105250_100232764 270
389 3300009092 Ga0105250_10023995 Ga0105250_100239953 270
390 3300009093 Ga0105240_10260407 Ga0105240_102604073 270
391 3300009148 Ga0105243_10001441 Ga0105243_100014411 270
392 3300009148 Ga0105243_10002007 Ga0105243_100020072 270
393 3300009148 Ga0105243_10036370 Ga0105243_100363704 270
394 3300009176 Ga0105242_10306473 Ga0105242_103064731 270
395 3300009176 Ga0105242_10554592 Ga0105242_105545921 270
396 3300010159 Ga0099796_10010745 Ga0099796_100107454 270
397 3300010159 Ga0099796_10028241 Ga0099796_100282413 270
398 3300010375 Ga0105239_10344886 Ga0105239_103448862 270
399 3300011119 Ga0105246_10001895 Ga0105246_100018956 270
400 3300011119 Ga0105246_10007270 Ga0105246_100072703 270
401 3300011119 Ga0105246_10270088 Ga0105246_102700883 270
402 3300013100 Ga0157373_10009442 Ga0157373_100094424 270
403 3300013100 Ga0157373_10036301 Ga0157373_100363013 270
404 3300013100 Ga0157373_10133656 Ga0157373_101336563 270
405 3300013102 Ga0157371_10014441 Ga0157371_100144412 270
406 3300013102 Ga0157371_10017060 Ga0157371_100170605 270
407 3300013102 Ga0157371_10209200 Ga0157371_102092002 270
408 3300013104 Ga0157370_10064240 Ga0157370_100642404 270
409 3300013104 Ga0157370_10383435 Ga0157370_103834352 270
410 3300013105 Ga0157369_10004688 Ga0157369_1000468816 270
411 3300013296 Ga0157374_10430858 Ga0157374_104308582 270
412 3300013306 Ga0163162_10065357 Ga0163162_100653573 270
413 3300013307 Ga0157372_10038059 Ga0157372_100380596 270
414 3300013307 Ga0157372_10727607 Ga0157372_107276072 270
415 3300013308 Ga0157375_10308655 Ga0157375_103086552 270
416 3300014497 Ga0182008_10023277 Ga0182008_100232773 270
417 3300014497 Ga0182008_10029769 Ga0182008_100297693 270
418 3300014497 Ga0182008_10090027 Ga0182008_100900272 270
419 3300014745 Ga0157377_10222222 Ga0157377_102222222 270
420 3300014968 Ga0157379_10316027 Ga0157379_103160271 270
421 3300015261 Ga0182006_1006419 Ga0182006_10064195 270
422 3300015261 Ga0182006_1009493 Ga0182006_10094935 270
423 3300015261 Ga0182006_1035789 Ga0182006_10357891 270
424 3300015262 Ga0182007_10001991 Ga0182007_100019917 270
425 3300015265 Ga0182005_1008729 Ga0182005_10087294 270
426 3300015265 Ga0182005_1076232 Ga0182005_10762321 270
427 3300017792 Ga0163161_10084202 Ga0163161_100842023 270
428 3300020078 Ga0206352_11149150 Ga0206352_111491504 270
429 3300021358 Ga0213873_10014176 Ga0213873_100141763 270
430 3300021377 Ga0213874_10009670 Ga0213874_100096703 270
431 3300021388 Ga0213875_10000145 Ga0213875_1000014557 270
432 3300021388 Ga0213875_10006534 Ga0213875_100065345 270
433 3300025207 Ga0209760_100011 Ga0209760_10001116 270
434 3300025231 Ga0207427_100008 Ga0207427_100008197 270
435 3300025231 Ga0207427_100082 Ga0207427_100082110 270
436 3300025233 Ga0209437_100006 Ga0209437_100006241 270
437 3300025233 Ga0209437_100014 Ga0209437_100014514 270
438 3300025256 Ga0209759_1007138 Ga0209759_10071382 270
439 3300025261 Ga0209233_1000008 Ga0209233_1000008514 270
440 3300025261 Ga0209233_1000105 Ga0209233_1000105222 270
441 3300025291 Ga0209675_1017364 Ga0209675_10173644 270
442 3300025292 Ga0209676_1000369 Ga0209676_100036963 270
443 3300025298 Ga0209050_1000380 Ga0209050_100038063 270
444 3300025298 Ga0209050_1001241 Ga0209050_100124116 270
445 3300025303 Ga0209051_1000123 Ga0209051_100012322 270
446 3300025303 Ga0209051_1001064 Ga0209051_10010641 270
447 3300025304 Ga0209257_1000421 Ga0209257_100042163 270
448 3300025304 Ga0209257_1005819 Ga0209257_10058193 270
449 3300025711 Ga0207696_1000144 Ga0207696_100014497 270
450 3300025711 Ga0207696_1003214 Ga0207696_10032144 270
451 3300025711 Ga0207696_1006143 Ga0207696_10061436 270
452 3300025711 Ga0207696_1013375 Ga0207696_10133752 270
453 3300025728 Ga0207655_1000976 Ga0207655_100097621 270
454 3300025728 Ga0207655_1001969 Ga0207655_10019697 270
455 3300025728 Ga0207655_1003070 Ga0207655_100307012 270
456 3300025728 Ga0207655_1008047 Ga0207655_10080473 270
457 3300025728 Ga0207655_1010633 Ga0207655_10106332 270
458 3300025735 Ga0207713_1003135 Ga0207713_10031357 270
459 3300025735 Ga0207713_1006088 Ga0207713_10060883 270
460 3300025735 Ga0207713_1014429 Ga0207713_10144293 270
461 3300025735 Ga0207713_1047856 Ga0207713_10478562 270
462 3300025898 Ga0207692_10010663 Ga0207692_100106635 270
463 3300025898 Ga0207692_10023731 Ga0207692_100237313 270
464 3300025910 Ga0207684_10378695 Ga0207684_103786952 270
465 3300025912 Ga0207707_10030684 Ga0207707_100306843 270
466 3300025912 Ga0207707_10231927 Ga0207707_102319272 270
467 3300025915 Ga0207693_10005303 Ga0207693_100053035 270
468 3300025915 Ga0207693_10052530 Ga0207693_100525303 270
469 3300025915 Ga0207693_10071210 Ga0207693_100712104 270
470 3300025916 Ga0207663_10341937 Ga0207663_103419372 270
471 3300025917 Ga0207660_10387537 Ga0207660_103875372 270
472 3300025921 Ga0207652_10100233 Ga0207652_101002333 270
473 3300025922 Ga0207646_10009040 Ga0207646_100090403 270
474 3300025928 Ga0207700_10002928 Ga0207700_1000292810 270
475 3300025928 Ga0207700_10183041 Ga0207700_101830412 270
476 3300025928 Ga0207700_10208336 Ga0207700_102083362 270
477 3300025929 Ga0207664_10016110 Ga0207664_100161108 270
478 3300025929 Ga0207664_10127472 Ga0207664_101274723 270
479 3300025929 Ga0207664_10520324 Ga0207664_105203241 270
480 3300025931 Ga0207644_10109678 Ga0207644_101096782 270
481 3300025935 Ga0207709_10000223 Ga0207709_1000022321 270
482 3300025935 Ga0207709_10000835 Ga0207709_100008351 270
483 3300025935 Ga0207709_10030554 Ga0207709_100305542 270
484 3300025939 Ga0207665_10006644 Ga0207665_100066447 270
485 3300025939 Ga0207665_10033004 Ga0207665_100330044 270
486 3300025939 Ga0207665_10049356 Ga0207665_100493563 270
487 3300026035 Ga0207703_10319423 Ga0207703_103194231 270
488 3300026078 Ga0207702_10031690 Ga0207702_100316905 270
489 3300026088 Ga0207641_10435466 Ga0207641_104354662 270
490 3300026095 Ga0207676_10416744 Ga0207676_104167442 270
491 3300027111 Ga0209281_1000331 Ga0209281_100033180 270
492 3300027296 Ga0209389_1000031 Ga0209389_100003140 270
493 3300027312 Ga0209371_1000589 Ga0209371_100058921 270
494 3300027312 Ga0209371_1017352 Ga0209371_10173523 270
495 3300027360 Ga0209969_1013169 Ga0209969_10131691 270
496 3300027424 Ga0209984_1001806 Ga0209984_10018062 270
497 3300027512 Ga0209179_1019988 Ga0209179_10199882 270
498 3300027543 Ga0209999_1002159 Ga0209999_10021593 270
499 3300027552 Ga0209982_1009659 Ga0209982_10096592 270
500 3300027665 Ga0209983_1000763 Ga0209983_10007633 270
501 3300027666 Ga0209282_1054335 Ga0209282_10543353 270
502 3300027682 Ga0209971_1000554 Ga0209971_10005543 270
503 3300027876 Ga0209974_10007616 Ga0209974_100076164 270
504 3300027907 Ga0207428_10238370 Ga0207428_102383702 270
505 3300028379 Ga0268266_10055084 Ga0268266_100550843 270
506 3300028380 Ga0268265_10473215 Ga0268265_104732151 270
507 3300028794 Ga0307515_10002349 Ga0307515_100023494 270
508 3300028800 Ga0265338_10006011 Ga0265338_1000601110 270
509 3300028800 Ga0265338_10155737 Ga0265338_101557372 270
510 3300030500 Ga0268256_1000511 Ga0268256_100051121 270
511 3300030500 Ga0268256_1019341 Ga0268256_10193413 270
512 3300030731 Ga0316177_1211506 Ga0316177_12115063 270
513 3300030734 Ga0316179_1028994 Ga0316179_10289943 270
514 3300030742 Ga0316183_1189572 Ga0316183_11895722 270
515 3300031251 Ga0265327_10013441 Ga0265327_100134413 270
516 3300031251 Ga0265327_10031808 Ga0265327_100318084 270
517 3300031548 Ga0307408_100000025 Ga0307408_100000025135 270
518 3300032002 Ga0307416_100018095 Ga0307416_1000180952 270
519 3300032002 Ga0307416_100311510 Ga0307416_1003115102 270
520 3300033180 Ga0307510_10084516 Ga0307510_100845163 270
521 3300033524 Ga0316592_1010457 Ga0316592_10104573 270
522 3300035083 Ga0373926_0056900 Ga0373926_0056900_520_1335 270
523 3300035086 Ga0373934_0048463 Ga0373934_0048463_738_1550 270
524 3300035113 Ga0373936_0078468 Ga0373936_0078468_485_1300 270
525 3300035113 Ga0373936_0144144 Ga0373936_0144144_32_847 270
526 3300035116 Ga0373945_0004496 Ga0373945_0004496_2819_3634 270
527 3300035118 Ga0373954_0015261 Ga0373954_0015261_1657_2472 270
528 3300035119 Ga0373956_0025169 Ga0373956_0025169_750_1562 270
529 3300035170 Ga0373943_0015057 Ga0373943_0015057_1837_2652 270
530 3300035171 Ga0373946_0011231 Ga0373946_0011231_230_1045 270
531 3300035172 Ga0373955_0012134 Ga0373955_0012134_1161_1976 270
532 3300035691 Ga0373931_0031538 Ga0373931_0031538_970_1785 270
533 3300035692 Ga0373935_0070416 Ga0373935_0070416_606_1421 270
534 3300035692 Ga0373935_0258906 Ga0373935_0258906_375_1187 270
535 3300035695 Ga0373927_0027023 Ga0373927_0027023_2295_3110 270
536 3300035724 Ga0373933_0029653 Ga0373933_0029653_1237_2052 270
537 3300035724 Ga0373933_0086916 Ga0373933_0086916_297_1109 270
538 3300035725 Ga0373947_0035501 Ga0373947_0035501_511_1362 270
539 3300035725 Ga0373947_0128505 Ga0373947_0128505_731_1546 270
540 3300036401 Ga0373937_0006327 Ga0373937_0006327_1267_2082 270
541 3300036401 Ga0373937_0020176 Ga0373937_0020176_412_1224 270
542 3300036401 Ga0373937_0027602 Ga0373937_0027602_1653_2465 270
543 3300036401 Ga0373937_0216263 Ga0373937_0216263_332_1144 270
544 3300037853 Ga0436364_0056880 Ga0436364_0056880_57447_58328 270
545 3300037853 Ga0436364_0723260 Ga0436364_0723260_38019_38858 270
546 3300037853 Ga0436364_1260460 Ga0436364_1260460_13256_14137 270
547 3300038443 Ga0395901_0180939 Ga0395901_0180939_338_1150 270
548 3300038705 Ga0237819_09277 Ga0237819_09277_278_1090 270
549 3300039437 Ga0436365_1164564 Ga0436365_1164564_248_1120 270
550 3300039438 Ga0436360_0572509 Ga0436360_0572509_119_934 270
551 3300039438 Ga0436360_0800231 Ga0436360_0800231_131_943 270
552 3300039438 Ga0436360_0839587 Ga0436360_0839587_432_1244 270
553 3300039450 Ga0436363_0451735 Ga0436363_0451735_1407_2312 270
554 3300039450 Ga0436363_1129503 Ga0436363_1129503_342_1157 270
555 3300039450 Ga0436363_1460963 Ga0436363_1460963_457_1269 270
556 3300039453 Ga0436362_0220171 Ga0436362_0220171_164_976 270
557 3300039453 Ga0436362_0436236 Ga0436362_0436236_816_1628 270
558 3300039453 Ga0436362_0656757 Ga0436362_0656757_1249_2088 270
559 3300039453 Ga0436362_0999455 Ga0436362_0999455_39_851 270
560 3300041405 Ga0439438_001471 Ga0439438_001471_6975_7787 270
561 3300041405 Ga0439438_005024 Ga0439438_005024_1211_2023 270
562 3300041405 Ga0439438_008558 Ga0439438_008558_931_1743 270
563 3300041405 Ga0439438_008813 Ga0439438_008813_1208_2020 270
564 3300041407 Ga0439447_002251 Ga0439447_002251_5852_6664 270
565 3300041411 Ga0439466_0002838 Ga0439466_0002838_3137_3949 270
566 3300041411 Ga0439466_0004194 Ga0439466_0004194_4133_4948 270
567 3300041411 Ga0439466_0008003 Ga0439466_0008003_2656_3468 270
568 3300042006 Ga0439432_000967 Ga0439432_000967_5849_6661 270
569 3300042006 Ga0439432_002797 Ga0439432_002797_5565_6380 270
570 3300042009 Ga0439451_015276 Ga0439451_015276_265_1077 270
571 3300042010 Ga0439452_001447 Ga0439452_001447_435_1247 270
572 3300042010 Ga0439452_005155 Ga0439452_005155_411_1223 270
573 3300042013 Ga0439456_003614 Ga0439456_003614_2118_2930 270
574 3300042016 Ga0439463_003014 Ga0439463_003014_3228_4040 270
575 3300042142 Ga0450905_003390 Ga0450905_003390_270_1082 270
576 3300042146 Ga0450907_000326 Ga0450907_000326_6188_7000 270
577 3300042156 Ga0439446_0000172 Ga0439446_0000172_4000_4815 270
578 3300042156 Ga0439446_0007048 Ga0439446_0007048_1120_1935 270
579 3300042437 Ga0439444_0004568 Ga0439444_0004568_15_899 270
580 3300042461 Ga0439460_0002152 Ga0439460_0002152_3087_3899 270
581 3300042876 Ga0451577_0290548 Ga0451577_0290548_394_1209 270
582 3300042993 Ga0439440_0004886 Ga0439440_0004886_202_1014 270
583 3300044842 Ga0466957_0378394 Ga0466957_0378394_140_952 270
584 3300045836 Ga0466958_0302669 Ga0466958_0302669_106_921 270
585 3300045976 Ga0466967_0416720 Ga0466967_0416720_324_1139 270
586 3300045976 Ga0466967_0558682 Ga0466967_0558682_50_865 270
587 3300046452 Ga0495617_001158 Ga0495617_001158_6445_7257 270
588 3300046453 Ga0495627_000040 Ga0495627_000040_77662_78474 270
589 3300046453 Ga0495627_000137 Ga0495627_000137_84630_85445 270
590 3300046455 Ga0495603_0003767 Ga0495603_0003767_6126_6938 270
591 3300046455 Ga0495603_0049463 Ga0495603_0049463_378_1190 270
592 3300046457 Ga0495590_0002219 Ga0495590_0002219_2122_2934 270
593 3300046458 Ga0495591_000023 Ga0495591_000023_79465_80277 270
594 3300046458 Ga0495591_001514 Ga0495591_001514_9105_9917 270
595 3300046458 Ga0495591_007986 Ga0495591_007986_150_962 270
596 3300046460 Ga0495638_0077961 Ga0495638_0077961_978_1790 270
597 3300046463 Ga0495653_0029603 Ga0495653_0029603_2174_2986 270
598 3300046471 Ga0495650_0007260 Ga0495650_0007260_5512_6324 270
599 3300046471 Ga0495650_0050834 Ga0495650_0050834_663_1478 270
600 3300046472 Ga0495580_0022084 Ga0495580_0022084_2759_3574 270
601 3300046474 Ga0495605_0000245 Ga0495605_0000245_62008_62820 270
602 3300046474 Ga0495605_0001067 Ga0495605_0001067_12220_13032 270
603 3300046474 Ga0495605_0002605 Ga0495605_0002605_4174_4986 270
604 3300046474 Ga0495605_0010029 Ga0495605_0010029_3914_4726 270
605 3300046474 Ga0495605_0029245 Ga0495605_0029245_1851_2663 270
606 3300046476 Ga0495662_0101796 Ga0495662_0101796_401_1213 270
607 3300046491 Ga0495584_0014523 Ga0495584_0014523_2190_3002 270
608 3300046492 Ga0495585_0002457 Ga0495585_0002457_6094_6906 270
609 3300046492 Ga0495585_0013930 Ga0495585_0013930_648_1460 270
610 3300046492 Ga0495585_0058023 Ga0495585_0058023_805_1617 270
611 3300046500 Ga0495596_0000001 Ga0495596_0000001_193509_194321 270
612 3300046500 Ga0495596_0000375 Ga0495596_0000375_7473_8285 270
613 3300046501 Ga0495607_0000097 Ga0495607_0000097_70084_70896 270
614 3300046501 Ga0495607_0000234 Ga0495607_0000234_57181_57993 270
615 3300046501 Ga0495607_0000893 Ga0495607_0000893_17209_18021 270
616 3300046501 Ga0495607_0000972 Ga0495607_0000972_21387_22199 270
617 3300046501 Ga0495607_0004021 Ga0495607_0004021_93_905 270
618 3300046501 Ga0495607_0022053 Ga0495607_0022053_323_1135 270
619 3300046506 Ga0495583_0003081 Ga0495583_0003081_12242_13054 270
620 3300046506 Ga0495583_0003683 Ga0495583_0003683_3509_4321 270
621 3300046507 Ga0495606_0000167 Ga0495606_0000167_35588_36400 270
622 3300046507 Ga0495606_0003593 Ga0495606_0003593_1260_2072 270
623 3300046507 Ga0495606_0004329 Ga0495606_0004329_4454_5269 270
624 3300046507 Ga0495606_0045902 Ga0495606_0045902_1126_1938 270
625 3300046512 Ga0495610_0026298 Ga0495610_0026298_1946_2758 270
626 3300046512 Ga0495610_0045368 Ga0495610_0045368_345_1157 270
627 3300046513 Ga0495616_0018868 Ga0495616_0018868_2297_3109 270
628 3300046513 Ga0495616_0039392 Ga0495616_0039392_1559_2371 270
629 3300046513 Ga0495616_0058008 Ga0495616_0058008_967_1779 270
630 3300046515 Ga0495620_0000003 Ga0495620_0000003_300627_301439 270
631 3300046515 Ga0495620_0009640 Ga0495620_0009640_1473_2285 270
632 3300046515 Ga0495620_0052081 Ga0495620_0052081_148_960 270
633 3300046517 Ga0495630_0094256 Ga0495630_0094256_510_1322 270
634 3300046518 Ga0495631_0001015 Ga0495631_0001015_7231_8043 270
635 3300046518 Ga0495631_0006645 Ga0495631_0006645_3056_3871 270
636 3300046518 Ga0495631_0055140 Ga0495631_0055140_152_964 270
637 3300046519 Ga0495632_0001340 Ga0495632_0001340_6430_7242 270
638 3300046519 Ga0495632_0003328 Ga0495632_0003328_354_1166 270
639 3300046519 Ga0495632_0004266 Ga0495632_0004266_3773_4585 270
640 3300046519 Ga0495632_0079706 Ga0495632_0079706_400_1212 270
641 3300046520 Ga0495637_0000583 Ga0495637_0000583_323_1135 270
642 3300046520 Ga0495637_0002931 Ga0495637_0002931_1433_2245 270
643 3300046520 Ga0495637_0003057 Ga0495637_0003057_324_1136 270
644 3300046520 Ga0495637_0024711 Ga0495637_0024711_1316_2128 270
645 3300046522 Ga0495643_0000673 Ga0495643_0000673_29176_29988 270
646 3300046522 Ga0495643_0001803 Ga0495643_0001803_11434_12246 270
647 3300046523 Ga0495644_0003207 Ga0495644_0003207_2450_3262 270
648 3300046524 Ga0495648_0003579 Ga0495648_0003579_3306_4118 270
649 3300046524 Ga0495648_0004170 Ga0495648_0004170_2009_2821 270
650 3300046524 Ga0495648_0010693 Ga0495648_0010693_5041_5853 270
651 3300046528 Ga0495642_0001942 Ga0495642_0001942_5623_6435 270
652 3300046528 Ga0495642_0006012 Ga0495642_0006012_3259_4071 270
653 3300046530 Ga0495654_0008388 Ga0495654_0008388_1322_2134 270
654 3300046530 Ga0495654_0015800 Ga0495654_0015800_1429_2244 270
655 3300046530 Ga0495654_0035682 Ga0495654_0035682_591_1403 270
656 3300046530 Ga0495654_0040236 Ga0495654_0040236_58_870 270
657 3300046535 Ga0495586_0034252 Ga0495586_0034252_1761_2630 270
658 3300046536 Ga0495587_0006269 Ga0495587_0006269_1866_2678 270
659 3300046538 Ga0495609_0000167 Ga0495609_0000167_137_949 270
660 3300046538 Ga0495609_0003356 Ga0495609_0003356_6375_7187 270
661 3300046538 Ga0495609_0006411 Ga0495609_0006411_4917_5729 270
662 3300046542 Ga0495597_0000016 Ga0495597_0000016_73527_74339 270
663 3300046542 Ga0495597_0008843 Ga0495597_0008843_2291_3103 270
664 3300046557 Ga0495622_0001305 Ga0495622_0001305_6167_6979 270
665 3300046557 Ga0495622_0012102 Ga0495622_0012102_2904_3716 270
666 3300046557 Ga0495622_0142618 Ga0495622_0142618_59_871 270
667 3300046558 Ga0495633_0003087 Ga0495633_0003087_6619_7431 270
668 3300046559 Ga0495667_0031187 Ga0495667_0031187_684_1499 270
669 3300046559 Ga0495667_0142330 Ga0495667_0142330_216_1028 270
670 3300046615 Ga0495656_0004946 Ga0495656_0004946_3013_3825 270
671 3300046660 Ga0495625_0000134 Ga0495625_0000134_98709_99521 270
672 3300046660 Ga0495625_0051221 Ga0495625_0051221_1721_2533 270
673 3300046660 Ga0495625_0135573 Ga0495625_0135573_591_1403 270
674 3300046663 Ga0495635_0027178 Ga0495635_0027178_2119_2931 270
675 3300046663 Ga0495635_0102510 Ga0495635_0102510_687_1556 270
676 3300046664 Ga0495659_0001323 Ga0495659_0001323_3262_4074 270
677 3300046665 Ga0495661_0000088 Ga0495661_0000088_57247_58059 270
678 3300046665 Ga0495661_0009503 Ga0495661_0009503_381_1193 270
679 3300046665 Ga0495661_0025395 Ga0495661_0025395_1527_2339 270
680 3300046675 Ga0495657_0104340 Ga0495657_0104340_450_1319 270
681 3300046678 Ga0495599_0057891 Ga0495599_0057891_1351_2220 270
682 3300046679 Ga0495623_0024699 Ga0495623_0024699_788_1600 270
683 3300046684 Ga0495669_0033833 Ga0495669_0033833_635_1447 270
684 3300046691 Ga0495670_0002914 Ga0495670_0002914_4353_5165 270
685 3300046691 Ga0495670_0030265 Ga0495670_0030265_1241_2053 270
686 3300046692 Ga0495671_0023443 Ga0495671_0023443_1813_2628 270
687 3300046692 Ga0495671_0030450 Ga0495671_0030450_1116_1928 270
688 3300046694 Ga0495649_0000864 Ga0495649_0000864_4092_4907 270
689 3300046694 Ga0495649_0001550 Ga0495649_0001550_9988_10800 270
690 3300046694 Ga0495649_0050595 Ga0495649_0050595_141_953 270
691 3300046794 Ga0495589_0000881 Ga0495589_0000881_7710_8522 270
692 3300046794 Ga0495589_0007709 Ga0495589_0007709_47_859 270
693 3300046794 Ga0495589_0057115 Ga0495589_0057115_746_1558 270
694 3300046809 Ga0495600_0060110 Ga0495600_0060110_578_1390 270
695 3300046809 Ga0495600_0096446 Ga0495600_0096446_538_1350 270
696 3300046810 Ga0495660_0001771 Ga0495660_0001771_6066_6878 270
697 3300046810 Ga0495660_0005240 Ga0495660_0005240_1433_2245 270
698 3300046810 Ga0495660_0027927 Ga0495660_0027927_662_1474 270
699 3300046810 Ga0495660_0084170 Ga0495660_0084170_805_1617 270
700 3300047317 Ga0495604_0036434 Ga0495604_0036434_2148_2960 270
701 3300047318 Ga0495636_0005048 Ga0495636_0005048_438_1250 270
702 3300047318 Ga0495636_0009958 Ga0495636_0009958_483_1295 270
703 3300047320 Ga0495672_0002710 Ga0495672_0002710_5579_6391 270
704 3300047320 Ga0495672_0012883 Ga0495672_0012883_2536_3348 270
705 3300047320 Ga0495672_0013396 Ga0495672_0013396_1607_2422 270
706 3300047320 Ga0495672_0139527 Ga0495672_0139527_133_945 270
707 3300047321 Ga0495676_0000018 Ga0495676_0000018_16398_17210 270
708 3300047322 Ga0495680_0156474 Ga0495680_0156474_58_870 270
709 3300047322 Ga0495680_0238027 Ga0495680_0238027_113_982 270
710 3300047323 Ga0495683_0000081 Ga0495683_0000081_36710_37525 270
711 3300047323 Ga0495683_0001199 Ga0495683_0001199_7572_8384 270
712 3300047443 Ga0495687_011688 Ga0495687_011688_3608_4420 270
713 3300047444 Ga0495675_0005746 Ga0495675_0005746_452_1264 270
714 3300047446 Ga0495679_007522 Ga0495679_007522_554_1366 270
715 3300047469 Ga0495673_0003548 Ga0495673_0003548_9401_10213 270
716 3300047469 Ga0495673_0005161 Ga0495673_0005161_3212_4024 270
717 3300047469 Ga0495673_0011087 Ga0495673_0011087_4042_4854 270
718 3300047470 Ga0495681_0002659 Ga0495681_0002659_7080_7892 270
719 3300047470 Ga0495681_0004092 Ga0495681_0004092_3265_4077 270
720 3300047470 Ga0495681_0007297 Ga0495681_0007297_5437_6249 270
721 3300047470 Ga0495681_0018194 Ga0495681_0018194_324_1136 270
722 3300047470 Ga0495681_0044875 Ga0495681_0044875_1177_1989 270
723 3300047471 Ga0495684_0034497 Ga0495684_0034497_347_1159 270
724 3300047673 Ga0495593_0029162 Ga0495593_0029162_810_1622 270
725 3300048091 Ga0495626_0000125 Ga0495626_0000125_192_1004 270
726 3300048091 Ga0495626_0003758 Ga0495626_0003758_4190_5002 270
727 3300048091 Ga0495626_0004444 Ga0495626_0004444_324_1136 270
728 3300048905 Ga0496102_0008143 Ga0496102_0008143_2158_2970 270
729 3300048909 Ga0496106_0247213 Ga0496106_0247213_298_1113 270
730 3300048915 Ga0496112_0038138 Ga0496112_0038138_177_992 270
731 3300048916 Ga0496113_0052589 Ga0496113_0052589_464_1279 270
732 3300048917 Ga0496114_0012877 Ga0496114_0012877_2626_3438 270
733 3300048917 Ga0496114_0014042 Ga0496114_0014042_1754_2569 270
734 3300048917 Ga0496114_0040220 Ga0496114_0040220_2046_2858 270
735 3300048919 Ga0496116_0001043 Ga0496116_0001043_13959_14771 270
736 3300048920 Ga0496117_0015449 Ga0496117_0015449_2526_3338 270
737 3300048920 Ga0496117_0105712 Ga0496117_0105712_909_1721 270
738 3300048921 Ga0496118_0009485 Ga0496118_0009485_354_1166 270
739 3300048921 Ga0496118_0022994 Ga0496118_0022994_34_846 270
740 3300048921 Ga0496118_0060355 Ga0496118_0060355_808_1620 270
741 3300048922 Ga0496119_0000444 Ga0496119_0000444_39528_40340 270
742 3300048923 Ga0496120_0001654 Ga0496120_0001654_18603_19415 270
743 3300048924 Ga0496121_0005707 Ga0496121_0005707_3214_4026 270
744 3300048924 Ga0496121_0063203 Ga0496121_0063203_274_1086 270
745 3300048924 Ga0496121_0185589 Ga0496121_0185589_636_1448 270
746 3300048925 Ga0496122_0006709 Ga0496122_0006709_12239_13051 270
747 3300048925 Ga0496122_0020183 Ga0496122_0020183_612_1424 270
748 3300048925 Ga0496122_0077198 Ga0496122_0077198_156_968 270
749 3300048926 Ga0496123_0000887 Ga0496123_0000887_5830_6642 270
750 3300048926 Ga0496123_0001511 Ga0496123_0001511_14488_15300 270
751 3300048926 Ga0496123_0027233 Ga0496123_0027233_137_949 270
752 3300048927 Ga0496124_0022637 Ga0496124_0022637_2532_3347 270
753 3300048927 Ga0496124_0033678 Ga0496124_0033678_90_902 270
754 3300048927 Ga0496124_0145885 Ga0496124_0145885_377_1189 270
755 3300048927 Ga0496124_0295162 Ga0496124_0295162_274_1086 270
756 3300048928 Ga0496125_0003525 Ga0496125_0003525_15302_16117 270
757 3300048928 Ga0496125_0034533 Ga0496125_0034533_351_1163 270
758 3300048928 Ga0496125_0151532 Ga0496125_0151532_431_1243 270
759 3300048929 Ga0496126_0050942 Ga0496126_0050942_237_1049 270
760 3300048929 Ga0496126_0099536 Ga0496126_0099536_883_1695 270
761 3300049459 Ga0495678_000918 Ga0495678_000918_24766_25578 270
762 3300049460 Ga0495682_0000050 Ga0495682_0000050_46944_47756 270
763 3300049460 Ga0495682_0001437 Ga0495682_0001437_123_935 270
764 3300049460 Ga0495682_0009054 Ga0495682_0009054_2573_3385 270
765 3300049531 Ga0501315_006626 Ga0501315_006626_452_1267 270
766 3300049571 Ga0501034_0000150 Ga0501034_0000150_84333_85145 270
767 3300049571 Ga0501034_0081970 Ga0501034_0081970_1958_2773 270
768 3300049571 Ga0501034_0101361 Ga0501034_0101361_332_1153 270
769 3300049571 Ga0501034_0131785 Ga0501034_0131785_1362_2177 270
770 3300049573 Ga0501037_0019636 Ga0501037_0019636_709_1524 270
771 3300049586 Ga0501070_0509753 Ga0501070_0509753_53_865 270
772 3300049744 Ga0501083_0007057 Ga0501083_0007057_6740_7552 270
773 3300050512 nmdc:mga0n895_381445_c1 nmdc:mga0n895_381445_c1_164_979 270
774 3300050513 nmdc:mga0rr50_54084_c1 nmdc:mga0rr50_54084_c1_182_994 270
775 3300053077 Ga0495601_0008558 Ga0495601_0008558_2892_3761 270
776 3300053077 Ga0495601_0091978 Ga0495601_0091978_756_1571 270
777 3300053085 Ga0495619_0010468 Ga0495619_0010468_854_1666 270
778 3300053085 Ga0495619_0050642 Ga0495619_0050642_1613_2428 270
779 3300053085 Ga0495619_0134760 Ga0495619_0134760_27_842 270
780 3300053085 Ga0495619_0183361 Ga0495619_0183361_197_1093 270
781 3300053135 Ga0500659_0002281 Ga0500659_0002281_8620_9432 270
782 3300060353 Ga0501082_0020563 Ga0501082_0020563_923_1735 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

39

260

0.95

PF02374

ArsA_ATPase

Anion-transporting ATPase

37

84

0.93

PF13614

AAA_31

AAA domain

36

203

0.84

PF06564

CBP_BcsQ

Cellulose biosynthesis protein BcsQ

36

188

0.82

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

34

280

0.75

PF09140

MipZ

ATPase MipZ

37

202

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6riq-assembly1.cif.gz_C mincd filament from pseudomonas aeruginosa 0.9852 2 255
3q9l-assembly1.cif.gz_A the structure of the dimeric e.coli mind-atp complex 0.985 2 257
6riq-assembly1.cif.gz_C mincd filament from pseudomonas aeruginosa 0.9814 2 255
3r9i-assembly2.cif.gz_C 2.6a resolution structure of mind complexed with mine (12-31) peptide 0.9812 2 257
3q9l-assembly1.cif.gz_A the structure of the dimeric e.coli mind-atp complex 0.9774 2 257
ID Description Score Start End Superfamily
3r9iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9812 2 257 3.40.50.300
3r9iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9774 2 257 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9267 2 257 3.40.50.300
4v02A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9231 2 257 3.40.50.300
af_K7L057_1_178_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9037 17 159 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A381GKQ0-F1-model_v4 deleted 0.9938 131 214
AF-A0A3D0CB54-F1-model_v4 Septum site-determining protein MinD 0.9936 86 234 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A7Y0SDY5-F1-model_v4 Septum site-determining protein MinD 0.9934 134 225 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-W7QEY8-F1-model_v4 Septum site-determining protein MinD (Cell division inhibitor MinD) 0.9927 1 238 GO:0000917
GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A2M7WVW0-F1-model_v4 Septum site-determining protein MinD (Cell division inhibitor MinD) 0.9918 1 248 GO:0000917
GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782

Feature Viewer

pLDDT pTM Quality
91.08 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map