F480340

General Info

Members Datasets Scaffolds Average Seq Length
776 383 1552 553

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0003182|Ga0501070_0003182_7114_8934
Length 606
Sequence MQRHDESPLRKGDALRINDQPRRRKGDIVPANHSTPQEYPFVKWLMIPALALTLSVSACADNKSSDTAADAEPAKTYAPTFDAARLSGEVKTLSSDAFEGRGPATAGETKTIDYLVAQMQAAGLEPGGDLVDGKRGWTQDVPLARFQISGAPAIELDVAGKPQKLTQGEEIALRAAQDGSKRVDIEHAPLVFVGYGVTAPERNWDDFKGMDLRGKIAVALVNDPDYETGKGDFGGKAMTYYGRWTYKYEEAARRGALGLLIVHETKPASYGWPTVRNSNTNAQFDIVRDDPAAAHPKVEGWIQRDLAVSLFKRAGLDFEALKKQAQTRDFKPVVLKGETFSAHYDVAVDEITSHNVVGRVTGSKYPDETIIYSAHWDHLGIGAPDDNGDRIYNGAVDNATGTAALIEMGRAFAHAPKPERSVVFLAVTAEEKGLLGSEYYASHPLYPLAKTVANINTDALSPGGVARDFSISGSARLGLLDDLIAIAKRHDLSFTPDSHPEAGYFFRSDHFSFAKRGVPALSFGSGEDLLDGGKQAGEAQGREYGIKHYHQPSDEWQASWTFAGMAHDLPVLYDLGAQLANSREWPTWSGDSEFRAARDKSADERS

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
107 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
226 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
229 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
230 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
231 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
298 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
299 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
300 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
301 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
302 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
303 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
304 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
305 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
308 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
316 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
319 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
320 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
321 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
322 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
323 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
324 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
327 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
334 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
335 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
336 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
337 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
338 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
339 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
340 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
341 2643221559 Lysobacter sp. Root559 Isolate Unclassified
342 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
343 2643221573 Lysobacter sp. Root604 Isolate Unclassified
344 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
345 2643221586 Lysobacter sp. Root667 Isolate Unclassified
346 2643221612 Lysobacter sp. Root76 Isolate Unclassified
347 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
348 2643221695 Lysobacter sp. Root494 Isolate Unclassified
349 2643221720 Lysobacter sp. Root916 Isolate Unclassified
350 2643221727 Lysobacter sp. Root96 Isolate Unclassified
351 2643221728 Lysobacter sp. Root983 Isolate Unclassified
352 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
353 2739367700 Dyella sp. YR388 Isolate Unclassified
354 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
355 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
356 2818991446 Variovorax sp. 1180 Isolate Unclassified
357 2818991457 Xanthomonas translucens 569 Isolate Unclassified
358 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
359 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
360 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
361 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
362 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
363 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
364 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
365 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
366 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
367 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
368 2899924645 Variovorax sp. 369 Isolate Unclassified
369 2928037797 Variovorax sp. 1126 Isolate Unclassified
370 2928044640 Variovorax sp. 1128 Isolate Unclassified
371 2928051484 Variovorax sp. 1133 Isolate Unclassified
372 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
373 2928070936 Variovorax gossypii 1167 Isolate Unclassified
374 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
375 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
376 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
377 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
378 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
379 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
380 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
381 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
382 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
383 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.04
Metatranscriptomes 0.39
Isolates 6.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.62
Nodule 0.26
Rhizoplane 2.06
Rhizosphere 71.13
Stem 0
Stem Tuber 0.13
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0003182 3300049586 Bacteria 14276
2 JGI24741J21665_1005862 3300001915 Bacteria 2517
3 JGI24740J21852_10004662 3300001979 Bacteria 5879
4 JGI24739J22299_10002751 3300001989 Bacteria 6764
5 JGI24737J22298_10006712 3300001990 Bacteria 3916
6 JGI25152J39213_1010079 3300002773 Bacteria 2188
7 JGI25150J39212_1000176 3300002774 Bacteria 35986
8 JGI25150J39212_1000722 3300002774 Bacteria 11801
9 JGI25150J39212_1007488 3300002774 Bacteria 2188
10 JGI25159J45721_1006579 3300002987 Bacteria 3460
11 JGI25159J45721_1010915 3300002987 Bacteria 2268
12 JGI25151J46595_10000519 3300003187 Bacteria 35984
13 JGI25151J46595_10018311 3300003187 Bacteria 3013
14 JGI25151J46595_10029181 3300003187 Bacteria 2188
15 JGI25153J46596_10000203 3300003215 Bacteria 54460
16 JGI25153J46596_10013628 3300003215 Bacteria 3425
17 JGI25153J46596_10024286 3300003215 Bacteria 2188
18 JGI25160J50197_1015002 3300003354 Bacteria 2563
19 JGI25160J50197_1017180 3300003354 Bacteria 2302
20 JGI25161J50226_1005878 3300003374 Bacteria 2302
21 Ga0006562J51391_1001894 3300003578 Bacteria 30450
22 Ga0006562J51391_1022678 3300003578 Bacteria 6740
23 Ga0055535_1000552 3300003761 Bacteria 32082
24 Ga0055542_1000003 3300003762 Bacteria 582721
25 Ga0055526_1000005 3300003771 Bacteria 344542
26 Ga0055526_1016151 3300003771 Bacteria 2942
27 Ga0055526_1020907 3300003771 Bacteria 2302
28 Ga0055537_1000042 3300003773 Bacteria 91406
29 Ga0055537_1008902 3300003773 Bacteria 2265
30 Ga0055524_1000005 3300003775 Bacteria 344542
31 Ga0055524_1000243 3300003775 Bacteria 56992
32 Ga0055524_1007494 3300003775 Bacteria 4623
33 Ga0055524_1019644 3300003775 Bacteria 2302
34 Ga0055536_1001196 3300003781 Bacteria 16129
35 Ga0055536_1008097 3300003781 Bacteria 4582
36 Ga0055534_1000002 3300003784 Bacteria 390762
37 Ga0055534_1008571 3300003784 Bacteria 2302
38 Ga0055528_1000002 3300003790 Bacteria 368879
39 Ga0055528_1019315 3300003790 Bacteria 2265
40 Ga0055530_10003657 3300003791 Bacteria 8609
41 Ga0055530_10004621 3300003791 Bacteria 7007
42 Ga0055531_10001271 3300003794 Bacteria 19060
43 Ga0055531_10009971 3300003794 Bacteria 4790
44 Ga0055531_10027053 3300003794 Bacteria 2025
45 Ga0058692_1000143 3300003856 Bacteria 45126
46 Ga0055543_1003064 3300004625 Bacteria 5137
47 Ga0055543_1008839 3300004625 Bacteria 2203
48 Ga0065165_1002495 3300005262 Bacteria 15406
49 Ga0065165_1010740 3300005262 Bacteria 3913
50 Ga0065165_1013547 3300005262 Bacteria 3234
51 Ga0065165_1022550 3300005262 Bacteria 2155
52 Ga0065712_10000357 3300005290 Bacteria 13537
53 Ga0065715_10091439 3300005293 Bacteria 5794
54 Ga0070658_10000002 3300005327 Bacteria 637290
55 Ga0070658_10007660 3300005327 Bacteria 8704
56 Ga0070658_10053628 3300005327 Bacteria 3273
57 Ga0070658_10108373 3300005327 Bacteria 2299
58 Ga0070676_10018733 3300005328 Bacteria 3841
59 Ga0070683_100007667 3300005329 Bacteria 9132
60 Ga0070683_100043585 3300005329 Bacteria 4135
61 Ga0070690_100040290 3300005330 Bacteria 2954
62 Ga0070670_100000203 3300005331 Bacteria 55342
63 Ga0068869_100055519 3300005334 Bacteria 2887
64 Ga0070666_10054233 3300005335 Bacteria 2704
65 Ga0070680_100001134 3300005336 Bacteria 19121
66 Ga0070680_100001426 3300005336 Bacteria 17294
67 Ga0070682_100008205 3300005337 Bacteria 5888
68 Ga0068868_100023986 3300005338 Bacteria 4623
69 Ga0070660_100000381 3300005339 Bacteria 29499
70 Ga0070660_100001066 3300005339 Bacteria 18437
71 Ga0070660_100069370 3300005339 Bacteria 2749
72 Ga0070660_100116868 3300005339 Bacteria 2127
73 Ga0070689_100003285 3300005340 Bacteria 10737
74 Ga0070689_100042076 3300005340 Bacteria 3508
75 Ga0070691_10001916 3300005341 Bacteria 9128
76 Ga0070687_100004457 3300005343 Bacteria 5587
77 Ga0070661_100003980 3300005344 Bacteria 10166
78 Ga0070661_100022213 3300005344 Bacteria 4541
79 Ga0070661_100060137 3300005344 Bacteria 2788
80 Ga0070668_100001658 3300005347 Bacteria 16155
81 Ga0070668_100008875 3300005347 Bacteria 7465
82 Ga0070668_100010445 3300005347 Bacteria 6899
83 Ga0070668_100021536 3300005347 Bacteria 4870
84 Ga0070669_100013888 3300005353 Bacteria 5727
85 Ga0070669_100021860 3300005353 Bacteria 4574
86 Ga0070675_100002343 3300005354 Bacteria 14076
87 Ga0070671_100072638 3300005355 Bacteria 2873
88 Ga0070674_100078252 3300005356 Bacteria 2356
89 Ga0070673_100040315 3300005364 Bacteria 3582
90 Ga0070673_100059383 3300005364 Bacteria 3027
91 Ga0070673_100106777 3300005364 Bacteria 2315
92 Ga0070688_100014385 3300005365 Bacteria 4482
93 Ga0070659_100007515 3300005366 Bacteria 7918
94 Ga0070659_100055632 3300005366 Bacteria 3119
95 Ga0070659_100107312 3300005366 Bacteria 2251
96 Ga0070659_100144953 3300005366 Bacteria 1934
97 Ga0070667_100000848 3300005367 Bacteria 28390
98 Ga0070667_100011178 3300005367 Bacteria 7426
99 Ga0070667_100018002 3300005367 Bacteria 5855
100 Ga0070667_100028888 3300005367 Bacteria 4617
101 Ga0070667_100029817 3300005367 Bacteria 4548
102 Ga0070667_100074031 3300005367 Bacteria 2905
103 Ga0070663_100001534 3300005455 Bacteria 12711
104 Ga0070663_100004672 3300005455 Bacteria 8075
105 Ga0070663_100016847 3300005455 Bacteria 4755
106 Ga0070663_100020512 3300005455 Bacteria 4378
107 Ga0070678_100028410 3300005456 Bacteria 3814
108 Ga0070678_100083528 3300005456 Bacteria 2428
109 Ga0070662_100008925 3300005457 Bacteria 6534
110 Ga0070662_100018814 3300005457 Bacteria 4679
111 Ga0070662_100046714 3300005457 Bacteria 3111
112 Ga0070662_100054701 3300005457 Bacteria 2893
113 Ga0070662_100095381 3300005457 Bacteria 2242
114 Ga0070681_10000915 3300005458 Bacteria 24938
115 Ga0070681_10002608 3300005458 Bacteria 16544
116 Ga0070681_10017444 3300005458 Bacteria 7176
117 Ga0070681_10022121 3300005458 Bacteria 6381
118 Ga0070681_10223578 3300005458 Bacteria 1797
119 Ga0068867_100011529 3300005459 Bacteria 6241
120 Ga0070685_10022976 3300005466 Bacteria 3408
121 Ga0070699_100037887 3300005518 Bacteria 4174
122 Ga0070679_100000150 3300005530 Bacteria 56196
123 Ga0070679_100002356 3300005530 Bacteria 17116
124 Ga0070684_100006790 3300005535 Bacteria 8875
125 Ga0068853_100003225 3300005539 Bacteria 12471
126 Ga0068853_100021486 3300005539 Bacteria 5383
127 Ga0068853_100023574 3300005539 Bacteria 5153
128 Ga0068853_100039004 3300005539 Bacteria 4049
129 Ga0070672_100003386 3300005543 Bacteria 10335
130 Ga0070672_100003719 3300005543 Bacteria 9924
131 Ga0070672_100091034 3300005543 Bacteria 2461
132 Ga0070696_100002140 3300005546 Bacteria 12993
133 Ga0070696_100015715 3300005546 Bacteria 5087
134 Ga0070696_100020593 3300005546 Bacteria 4468
135 Ga0070696_100096424 3300005546 Bacteria 2113
136 Ga0070693_100023576 3300005547 Bacteria 3291
137 Ga0070665_100000108 3300005548 Bacteria 155204
138 Ga0070665_100008714 3300005548 Bacteria 10264
139 Ga0070665_100014764 3300005548 Bacteria 7840
140 Ga0070665_100041220 3300005548 Bacteria 4640
141 Ga0070665_100049723 3300005548 Bacteria 4206
142 Ga0070665_100053376 3300005548 Bacteria 4054
143 Ga0070665_100153791 3300005548 Bacteria 2302
144 Ga0068855_100004282 3300005563 Bacteria 17432
145 Ga0068855_100016141 3300005563 Bacteria 8980
146 Ga0068855_100040970 3300005563 Bacteria 5492
147 Ga0068855_100073910 3300005563 Bacteria 3960
148 Ga0070664_100000093 3300005564 Bacteria 57415
149 Ga0070664_100031702 3300005564 Bacteria 4419
150 Ga0070664_100049864 3300005564 Bacteria 3541
151 Ga0070664_100082310 3300005564 Bacteria 2776
152 Ga0070664_100088978 3300005564 Bacteria 2670
153 Ga0068857_100000180 3300005577 Bacteria 40331
154 Ga0068857_100007385 3300005577 Bacteria 9464
155 Ga0068857_100037792 3300005577 Bacteria 4277
156 Ga0068854_100002304 3300005578 Bacteria 11763
157 Ga0068854_100003859 3300005578 Bacteria 9395
158 Ga0068854_100006695 3300005578 Bacteria 7345
159 Ga0068854_100010449 3300005578 Bacteria 6020
160 Ga0068856_100042942 3300005614 Bacteria 4449
161 Ga0068852_100078409 3300005616 Bacteria 2922
162 Ga0068852_100116098 3300005616 Bacteria 2441
163 Ga0068852_100128721 3300005616 Bacteria 2329
164 Ga0068859_100004108 3300005617 Bacteria 14849
165 Ga0068864_100000078 3300005618 Bacteria 103622
166 Ga0068861_100067243 3300005719 Bacteria 2765
167 Ga0068851_10019700 3300005834 Bacteria 3261
168 Ga0068851_10021255 3300005834 Bacteria 3151
169 Ga0068870_10010469 3300005840 Bacteria 4266
170 Ga0068863_100000019 3300005841 Bacteria 205585
171 Ga0068863_100001062 3300005841 Bacteria 27480
172 Ga0068863_100014482 3300005841 Bacteria 7594
173 Ga0068858_100000832 3300005842 Bacteria 32118
174 Ga0068858_100183903 3300005842 Bacteria 1974
175 Ga0068860_100051125 3300005843 Bacteria 3932
176 Ga0068862_100000844 3300005844 Bacteria 30147
177 Ga0068862_100082384 3300005844 Bacteria 2792
178 Ga0081540_1023946 3300005983 Bacteria 3555
179 Ga0081539_10004451 3300005985 Bacteria 15469
180 Ga0075367_10088788 3300006178 Bacteria 1879
181 Ga0075369_10013722 3300006186 Bacteria 3223
182 Ga0075366_10009173 3300006195 Bacteria 5516
183 Ga0097621_100109868 3300006237 Bacteria 2329
184 Ga0097621_100111656 3300006237 Bacteria 2310
185 Ga0068871_100026443 3300006358 Bacteria 4528
186 Ga0075431_100020241 3300006847 Bacteria 6797
187 Ga0075433_10058341 3300006852 Bacteria 3376
188 Ga0075433_10104124 3300006852 Bacteria 2514
189 Ga0075434_100002845 3300006871 Bacteria 15342
190 Ga0075434_100002906 3300006871 Bacteria 15211
191 Ga0075436_100028303 3300006914 Bacteria 3855
192 Ga0097620_100004108 3300006931 Bacteria 14849
193 Ga0079104_1006894 3300006946 Bacteria 4204
194 Ga0105251_10000074 3300009011 Bacteria 95770
195 Ga0105240_10000941 3300009093 Bacteria 51739
196 Ga0105240_10001400 3300009093 Bacteria 41411
197 Ga0105240_10011719 3300009093 Bacteria 12182
198 Ga0105240_10211115 3300009093 Bacteria 2269
199 Ga0111539_10150332 3300009094 Bacteria 2726
200 Ga0105247_10037821 3300009101 Bacteria 2944
201 Ga0105243_10000732 3300009148 Bacteria 31470
202 Ga0105243_10059132 3300009148 Bacteria 3058
203 Ga0105242_10000382 3300009176 Bacteria 35202
204 Ga0105242_10002152 3300009176 Bacteria 15554
205 Ga0105248_10000317 3300009177 Bacteria 57281
206 Ga0105248_10001415 3300009177 Bacteria 26820
207 Ga0105248_10008933 3300009177 Bacteria 11019
208 Ga0105248_10009400 3300009177 Bacteria 10763
209 Ga0105248_10010064 3300009177 Bacteria 10416
210 Ga0105248_10062240 3300009177 Bacteria 4191
211 Ga0105248_10117134 3300009177 Bacteria 3004
212 Ga0105248_10168388 3300009177 Bacteria 2469
213 Ga0105237_10000214 3300009545 Bacteria 82061
214 Ga0105237_10003030 3300009545 Bacteria 20266
215 Ga0105237_10009465 3300009545 Bacteria 10436
216 Ga0105238_10004212 3300009551 Bacteria 14284
217 Ga0105238_10015966 3300009551 Bacteria 7598
218 Ga0105238_10026059 3300009551 Bacteria 5959
219 Ga0105249_10101887 3300009553 Bacteria 2701
220 Ga0105239_10000390 3300010375 Bacteria 64410
221 Ga0105239_10003689 3300010375 Bacteria 18664
222 Ga0105239_10009141 3300010375 Bacteria 11209
223 Ga0105239_10050557 3300010375 Bacteria 4559
224 Ga0105239_10054999 3300010375 Bacteria 4365
225 Ga0105239_10064857 3300010375 Bacteria 4010
226 Ga0157314_1000074 3300012500 Bacteria 10533
227 Ga0157347_1000018 3300012502 Bacteria 6171
228 Ga0157373_10004665 3300013100 Bacteria 10314
229 Ga0157371_10000372 3300013102 Bacteria 56552
230 Ga0157371_10029539 3300013102 Bacteria 3962
231 Ga0157371_10100455 3300013102 Bacteria 2052
232 Ga0157370_10000586 3300013104 Bacteria 45426
233 Ga0157370_10002097 3300013104 Bacteria 24354
234 Ga0157370_10011830 3300013104 Bacteria 9105
235 Ga0157370_10019302 3300013104 Bacteria 6842
236 Ga0157370_10058393 3300013104 Bacteria 3667
237 Ga0157369_10000172 3300013105 Bacteria 90979
238 Ga0157378_10020708 3300013297 Bacteria 5784
239 Ga0163162_10005268 3300013306 Bacteria 12475
240 Ga0157372_10001271 3300013307 Bacteria 27286
241 Ga0157372_10022113 3300013307 Bacteria 6878
242 Ga0157372_10047647 3300013307 Bacteria 4763
243 Ga0157375_10000835 3300013308 Bacteria 26923
244 Ga0157375_10010204 3300013308 Bacteria 8266
245 Ga0157375_10022691 3300013308 Bacteria 5779
246 Ga0157375_10057661 3300013308 Bacteria 3839
247 Ga0157375_10097116 3300013308 Bacteria 3020
248 Ga0157375_10124887 3300013308 Bacteria 2687
249 Ga0163163_10000588 3300014325 Bacteria 32034
250 Ga0157380_10091717 3300014326 Bacteria 2509
251 Ga0157379_10004364 3300014968 Bacteria 12098
252 Ga0157379_10069439 3300014968 Bacteria 3151
253 Ga0157376_10001051 3300014969 Bacteria 18102
254 Ga0182007_10000025 3300015262 Bacteria 172058
255 Ga0182005_1000063 3300015265 Bacteria 97663
256 Ga0182005_1002028 3300015265 Bacteria 7602
257 Ga0183360_10002 3300015689 Bacteria 953821
258 Ga0163161_10002498 3300017792 Bacteria 13119
259 Ga0163161_10003580 3300017792 Bacteria 10884
260 Ga0163161_10090228 3300017792 Bacteria 2268
261 Ga0206354_10853913 3300020081 Bacteria 7774
262 Ga0213875_10002677 3300021388 Bacteria 10515
263 Ga0213875_10008468 3300021388 Bacteria 5270
264 Ga0209436_102753 3300025208 Bacteria 5033
265 Ga0209672_100220 3300025228 Bacteria 44241
266 Ga0209672_101566 3300025228 Bacteria 7792
267 Ga0209147_101094 3300025229 Bacteria 11326
268 Ga0209258_100015 3300025242 Bacteria 706310
269 Ga0207425_1000021 3300025245 Bacteria 367537
270 Ga0207425_1000063 3300025245 Bacteria 134014
271 Ga0207425_1000155 3300025245 Bacteria 58218
272 Ga0207425_1000532 3300025245 Bacteria 23050
273 Ga0209148_1000028 3300025254 Bacteria 582773
274 Ga0209129_1000020 3300025258 Bacteria 457053
275 Ga0209129_1000160 3300025258 Bacteria 102457
276 Ga0209129_1000243 3300025258 Bacteria 58221
277 Ga0209129_1001346 3300025258 Bacteria 13879
278 Ga0209129_1008628 3300025258 Bacteria 2808
279 Ga0209129_1011158 3300025258 Bacteria 2169
280 Ga0209565_1000001 3300025263 Bacteria 2950419
281 Ga0209565_1002457 3300025263 Bacteria 6665
282 Ga0209565_1003157 3300025263 Bacteria 5492
283 Ga0209565_1006813 3300025263 Bacteria 3159
284 Ga0209673_1000001 3300025273 Bacteria 3176258
285 Ga0209673_1003706 3300025273 Bacteria 8757
286 Ga0209673_1010664 3300025273 Bacteria 3852
287 Ga0209673_1015001 3300025273 Bacteria 2968
288 Ga0209130_1000738 3300025284 Bacteria 28711
289 Ga0209130_1001341 3300025284 Bacteria 16656
290 Ga0209130_1008137 3300025284 Bacteria 3133
291 Ga0209675_1000001 3300025291 Bacteria 2950293
292 Ga0209675_1001553 3300025291 Bacteria 13041
293 Ga0209675_1010590 3300025291 Bacteria 3135
294 Ga0209676_1000074 3300025292 Bacteria 305770
295 Ga0209676_1000177 3300025292 Bacteria 151589
296 Ga0209025_1000002 3300025294 Bacteria 1393142
297 Ga0209025_1001271 3300025294 Bacteria 34705
298 Ga0209025_1005652 3300025294 Bacteria 10074
299 Ga0209025_1015645 3300025294 Bacteria 4553
300 Ga0209025_1016339 3300025294 Bacteria 4391
301 Ga0209564_1000001 3300025295 Bacteria 3176258
302 Ga0209564_1000346 3300025295 Bacteria 87680
303 Ga0209564_1003007 3300025295 Bacteria 12080
304 Ga0209758_1000003 3300025297 Bacteria 1398533
305 Ga0209758_1000013 3300025297 Bacteria 873003
306 Ga0209758_1000039 3300025297 Bacteria 428951
307 Ga0209758_1000288 3300025297 Bacteria 99096
308 Ga0209758_1000577 3300025297 Bacteria 57284
309 Ga0209758_1028707 3300025297 Bacteria 2345
310 Ga0209758_1030851 3300025297 Bacteria 2210
311 Ga0209050_1000015 3300025298 Bacteria 759102
312 Ga0209050_1000837 3300025298 Bacteria 42462
313 Ga0209256_1000006 3300025299 Bacteria 1250310
314 Ga0209256_1000079 3300025299 Bacteria 225382
315 Ga0209256_1000264 3300025299 Bacteria 92750
316 Ga0209256_1003261 3300025299 Bacteria 11654
317 Ga0207426_1000108 3300025302 Bacteria 242257
318 Ga0207426_1000130 3300025302 Bacteria 210271
319 Ga0207426_1017278 3300025302 Bacteria 2567
320 Ga0209051_1000010 3300025303 Bacteria 641298
321 Ga0209257_1000026 3300025304 Bacteria 723225
322 Ga0209257_1000253 3300025304 Bacteria 123508
323 Ga0209257_1010254 3300025304 Bacteria 4790
324 Ga0207656_10005343 3300025321 Bacteria 4534
325 Ga0207655_1030340 3300025728 Bacteria 2515
326 Ga0207713_1000206 3300025735 Bacteria 80103
327 Ga0207682_10028626 3300025893 Bacteria 2225
328 Ga0207688_10004545 3300025901 Bacteria 7555
329 Ga0207647_10003584 3300025904 Bacteria 11639
330 Ga0207647_10003912 3300025904 Bacteria 11125
331 Ga0207643_10014623 3300025908 Bacteria 4266
332 Ga0207705_10000005 3300025909 Bacteria 673478
333 Ga0207705_10000029 3300025909 Bacteria 239897
334 Ga0207705_10000196 3300025909 Bacteria 61246
335 Ga0207705_10000849 3300025909 Bacteria 25053
336 Ga0207705_10012438 3300025909 Bacteria 6148
337 Ga0207705_10042014 3300025909 Bacteria 3281
338 Ga0207707_10000049 3300025912 Bacteria 117480
339 Ga0207707_10000524 3300025912 Bacteria 39305
340 Ga0207707_10005763 3300025912 Bacteria 10830
341 Ga0207707_10010918 3300025912 Bacteria 7899
342 Ga0207707_10013235 3300025912 Bacteria 7187
343 Ga0207695_10001428 3300025913 Bacteria 40198
344 Ga0207695_10003902 3300025913 Bacteria 20634
345 Ga0207695_10005285 3300025913 Bacteria 17212
346 Ga0207695_10023694 3300025913 Bacteria 6927
347 Ga0207695_10034168 3300025913 Bacteria 5534
348 Ga0207695_10057260 3300025913 Bacteria 4050
349 Ga0207695_10117055 3300025913 Bacteria 2638
350 Ga0207671_10000057 3300025914 Bacteria 183729
351 Ga0207671_10000614 3300025914 Bacteria 47019
352 Ga0207660_10000738 3300025917 Bacteria 21706
353 Ga0207660_10000824 3300025917 Bacteria 20462
354 Ga0207660_10002809 3300025917 Bacteria 11416
355 Ga0207662_10010713 3300025918 Bacteria 5066
356 Ga0207657_10000366 3300025919 Bacteria 47556
357 Ga0207657_10001980 3300025919 Bacteria 22107
358 Ga0207657_10010520 3300025919 Bacteria 9225
359 Ga0207657_10011898 3300025919 Bacteria 8612
360 Ga0207657_10017023 3300025919 Bacteria 6993
361 Ga0207657_10089972 3300025919 Bacteria 2562
362 Ga0207649_10001327 3300025920 Bacteria 14714
363 Ga0207649_10019921 3300025920 Bacteria 3841
364 Ga0207652_10000014 3300025921 Bacteria 196569
365 Ga0207652_10002050 3300025921 Bacteria 17343
366 Ga0207652_10007253 3300025921 Bacteria 8932
367 Ga0207681_10008514 3300025923 Bacteria 6265
368 Ga0207681_10026462 3300025923 Bacteria 3742
369 Ga0207694_10000389 3300025924 Bacteria 40956
370 Ga0207694_10092007 3300025924 Bacteria 2394
371 Ga0207650_10003825 3300025925 Bacteria 10294
372 Ga0207650_10010658 3300025925 Bacteria 6313
373 Ga0207650_10026087 3300025925 Bacteria 4166
374 Ga0207650_10062203 3300025925 Bacteria 2789
375 Ga0207659_10000922 3300025926 Bacteria 17511
376 Ga0207644_10000863 3300025931 Bacteria 19167
377 Ga0207644_10014665 3300025931 Bacteria 5250
378 Ga0207644_10079406 3300025931 Bacteria 2421
379 Ga0207644_10126707 3300025931 Bacteria 1950
380 Ga0207690_10004132 3300025932 Bacteria 8576
381 Ga0207690_10005618 3300025932 Bacteria 7410
382 Ga0207690_10059620 3300025932 Bacteria 2586
383 Ga0207706_10009357 3300025933 Bacteria 8996
384 Ga0207706_10013061 3300025933 Bacteria 7557
385 Ga0207706_10028226 3300025933 Bacteria 5013
386 Ga0207706_10031994 3300025933 Bacteria 4686
387 Ga0207706_10079758 3300025933 Bacteria 2878
388 Ga0207706_10092126 3300025933 Bacteria 2665
389 Ga0207706_10138186 3300025933 Bacteria 2144
390 Ga0207686_10018261 3300025934 Bacteria 3969
391 Ga0207709_10002739 3300025935 Bacteria 10871
392 Ga0207709_10006002 3300025935 Bacteria 6846
393 Ga0207691_10003686 3300025940 Bacteria 14861
394 Ga0207691_10003724 3300025940 Bacteria 14795
395 Ga0207691_10005219 3300025940 Bacteria 12537
396 Ga0207691_10010329 3300025940 Bacteria 8955
397 Ga0207691_10050073 3300025940 Bacteria 3825
398 Ga0207711_10000042 3300025941 Bacteria 158782
399 Ga0207711_10001192 3300025941 Bacteria 24642
400 Ga0207711_10005184 3300025941 Bacteria 11040
401 Ga0207711_10024256 3300025941 Bacteria 5078
402 Ga0207711_10080795 3300025941 Bacteria 2840
403 Ga0207689_10046569 3300025942 Bacteria 3584
404 Ga0207679_10022572 3300025945 Bacteria 4288
405 Ga0207667_10000075 3300025949 Bacteria 169836
406 Ga0207667_10000139 3300025949 Bacteria 109949
407 Ga0207667_10000247 3300025949 Bacteria 76307
408 Ga0207667_10002560 3300025949 Bacteria 22615
409 Ga0207667_10005407 3300025949 Bacteria 15575
410 Ga0207667_10019569 3300025949 Bacteria 7552
411 Ga0207651_10010407 3300025960 Bacteria 5156
412 Ga0207651_10015296 3300025960 Bacteria 4455
413 Ga0207712_10000774 3300025961 Bacteria 23834
414 Ga0207712_10036576 3300025961 Bacteria 3345
415 Ga0207668_10001836 3300025972 Bacteria 12384
416 Ga0207668_10021703 3300025972 Bacteria 4098
417 Ga0207668_10032494 3300025972 Bacteria 3449
418 Ga0207668_10062228 3300025972 Bacteria 2627
419 Ga0207640_10000072 3300025981 Bacteria 80118
420 Ga0207640_10002140 3300025981 Bacteria 10613
421 Ga0207658_10000129 3300025986 Bacteria 81988
422 Ga0207658_10015261 3300025986 Bacteria 5270
423 Ga0207658_10033655 3300025986 Bacteria 3657
424 Ga0207658_10059774 3300025986 Bacteria 2841
425 Ga0207658_10072704 3300025986 Bacteria 2608
426 Ga0207677_10013281 3300026023 Bacteria 4766
427 Ga0207703_10000562 3300026035 Bacteria 38153
428 Ga0207703_10001651 3300026035 Bacteria 20064
429 Ga0207703_10001950 3300026035 Bacteria 18229
430 Ga0207703_10142838 3300026035 Bacteria 2079
431 Ga0207639_10000690 3300026041 Bacteria 23246
432 Ga0207639_10000761 3300026041 Bacteria 21962
433 Ga0207639_10003326 3300026041 Bacteria 10822
434 Ga0207639_10014100 3300026041 Bacteria 5612
435 Ga0207639_10030370 3300026041 Bacteria 3962
436 Ga0207639_10033443 3300026041 Bacteria 3794
437 Ga0207639_10046819 3300026041 Bacteria 3265
438 Ga0207678_10000915 3300026067 Bacteria 27002
439 Ga0207678_10003168 3300026067 Bacteria 14872
440 Ga0207678_10007726 3300026067 Bacteria 9500
441 Ga0207678_10008551 3300026067 Bacteria 9017
442 Ga0207678_10008759 3300026067 Bacteria 8903
443 Ga0207678_10009736 3300026067 Bacteria 8450
444 Ga0207678_10014318 3300026067 Bacteria 6973
445 Ga0207678_10038194 3300026067 Bacteria 4173
446 Ga0207678_10040977 3300026067 Bacteria 4015
447 Ga0207702_10020699 3300026078 Bacteria 5442
448 Ga0207702_10050438 3300026078 Bacteria 3514
449 Ga0207641_10000005 3300026088 Bacteria 470841
450 Ga0207641_10000444 3300026088 Bacteria 47425
451 Ga0207641_10055895 3300026088 Bacteria 3352
452 Ga0207648_10004770 3300026089 Bacteria 13848
453 Ga0207648_10007362 3300026089 Bacteria 10838
454 Ga0207648_10010683 3300026089 Bacteria 8678
455 Ga0207676_10000130 3300026095 Bacteria 66147
456 Ga0207676_10000740 3300026095 Bacteria 25562
457 Ga0207676_10047631 3300026095 Bacteria 3323
458 Ga0207674_10000371 3300026116 Bacteria 58464
459 Ga0207674_10000895 3300026116 Bacteria 38947
460 Ga0207674_10003700 3300026116 Bacteria 18670
461 Ga0207674_10004005 3300026116 Bacteria 17891
462 Ga0207674_10010501 3300026116 Bacteria 10481
463 Ga0207674_10014423 3300026116 Bacteria 8730
464 Ga0207674_10028341 3300026116 Bacteria 5912
465 Ga0207674_10097984 3300026116 Bacteria 2916
466 Ga0207675_100079459 3300026118 Bacteria 3074
467 Ga0207683_10012138 3300026121 Bacteria 7356
468 Ga0207683_10147012 3300026121 Bacteria 2126
469 Ga0207698_10012712 3300026142 Bacteria 5522
470 Ga0209371_1000048 3300027312 Bacteria 281705
471 Ga0209998_10000544 3300027717 Bacteria 10177
472 Ga0209974_10005851 3300027876 Bacteria 4312
473 Ga0268266_10000001 3300028379 Bacteria 4040580
474 Ga0268266_10058815 3300028379 Bacteria 3310
475 Ga0268265_10000478 3300028380 Bacteria 42016
476 Ga0268265_10005151 3300028380 Bacteria 8954
477 Ga0268265_10005187 3300028380 Bacteria 8927
478 Ga0268265_10033487 3300028380 Bacteria 3736
479 Ga0268265_10055897 3300028380 Bacteria 3000
480 Ga0268265_10071851 3300028380 Bacteria 2697
481 Ga0268264_10004535 3300028381 Bacteria 11838
482 Ga0268264_10015987 3300028381 Bacteria 6148
483 Ga0268264_10034303 3300028381 Bacteria 4173
484 Ga0268264_10035202 3300028381 Bacteria 4122
485 Ga0268264_10049864 3300028381 Bacteria 3484
486 Ga0307515_10132353 3300028794 Bacteria 2737
487 Ga0268256_1000049 3300030500 Bacteria 307229
488 Ga0265332_10010267 3300031238 Bacteria 4168
489 Ga0265327_10018116 3300031251 Bacteria 4380
490 Ga0307408_100000462 3300031548 Bacteria 35587
491 Ga0307408_100108699 3300031548 Bacteria 2126
492 Ga0307405_10004388 3300031731 Bacteria 6662
493 Ga0307405_10008078 3300031731 Bacteria 5311
494 Ga0307405_10008990 3300031731 Bacteria 5100
495 Ga0307413_10000510 3300031824 Bacteria 12804
496 Ga0307413_10002495 3300031824 Bacteria 7501
497 Ga0307413_10024198 3300031824 Bacteria 3307
498 Ga0307413_10058263 3300031824 Bacteria 2367
499 Ga0307410_10001464 3300031852 Bacteria 10671
500 Ga0307410_10002763 3300031852 Bacteria 8580
501 Ga0307410_10015868 3300031852 Bacteria 4477
502 Ga0307410_10024283 3300031852 Bacteria 3785
503 Ga0307410_10070532 3300031852 Bacteria 2421
504 Ga0307410_10071278 3300031852 Bacteria 2409
505 Ga0307406_10009693 3300031901 Bacteria 5415
506 Ga0307406_10014720 3300031901 Bacteria 4506
507 Ga0307406_10022466 3300031901 Bacteria 3743
508 Ga0307407_10022510 3300031903 Bacteria 3271
509 Ga0307412_10002004 3300031911 Bacteria 11292
510 Ga0307412_10013564 3300031911 Bacteria 4782
511 Ga0307412_10024666 3300031911 Bacteria 3714
512 Ga0307412_10098041 3300031911 Bacteria 2066
513 Ga0307409_100000754 3300031995 Bacteria 14606
514 Ga0307409_100013543 3300031995 Bacteria 5255
515 Ga0307409_100018441 3300031995 Bacteria 4693
516 Ga0307409_100020069 3300031995 Bacteria 4545
517 Ga0307409_100036398 3300031995 Bacteria 3617
518 Ga0307416_100015686 3300032002 Bacteria 5241
519 Ga0307416_100021152 3300032002 Bacteria 4663
520 Ga0307416_100022048 3300032002 Bacteria 4587
521 Ga0307416_100032175 3300032002 Bacteria 3959
522 Ga0307416_100041909 3300032002 Bacteria 3569
523 Ga0307416_100060889 3300032002 Bacteria 3077
524 Ga0307416_100130868 3300032002 Bacteria 2258
525 Ga0307414_10003324 3300032004 Bacteria 8582
526 Ga0307414_10006918 3300032004 Bacteria 6353
527 Ga0307414_10094021 3300032004 Bacteria 2236
528 Ga0307411_10001415 3300032005 Bacteria 9767
529 Ga0307411_10047603 3300032005 Bacteria 2773
530 Ga0307411_10058834 3300032005 Bacteria 2545
531 Ga0307411_10078997 3300032005 Bacteria 2257
532 Ga0307415_100006829 3300032126 Bacteria 6192
533 Ga0307415_100014221 3300032126 Bacteria 4670
534 Ga0307415_100047237 3300032126 Bacteria 2897
535 Ga0307415_100049359 3300032126 Bacteria 2845
536 Ga0307507_10080766 3300033179 Bacteria 2865
537 Ga0373943_0025424 3300035170 Bacteria 2767
538 Ga0395899_0007347 3300037312 Bacteria 8521
539 Ga0395899_0012121 3300037312 Bacteria 6601
540 Ga0395899_0046053 3300037312 Bacteria 3249
541 Ga0395899_0052209 3300037312 Bacteria 3031
542 Ga0395900_0021165 3300037418 Bacteria 6647
543 Ga0395900_0098541 3300037418 Bacteria 3003
544 Ga0395898_0050322 3300037466 Bacteria 4078
545 Ga0395898_0060432 3300037466 Bacteria 3683
546 Ga0436364_0152495 3300037853 Bacteria 7015
547 Ga0436364_0612163 3300037853 Bacteria 25384
548 Ga0395901_0002260 3300038443 Bacteria 19658
549 Ga0395901_0007279 3300038443 Bacteria 11168
550 Ga0395901_0026730 3300038443 Bacteria 5925
551 Ga0395901_0094401 3300038443 Bacteria 3133
552 Ga0395901_0109496 3300038443 Bacteria 2900
553 Ga0237819_00083 3300038705 Bacteria 34456
554 Ga0436363_0082884 3300039450 Bacteria 3186
555 Ga0439439_0007991 3300041406 Bacteria 2487
556 Ga0439447_004314 3300041407 Bacteria 4925
557 Ga0439433_0003763 3300041999 Bacteria 3260
558 Ga0439449_0005388 3300042007 Bacteria 4903
559 Ga0439449_0016059 3300042007 Bacteria 2815
560 Ga0450912_000740 3300042116 Bacteria 1757
561 Ga0450905_001664 3300042142 Bacteria 2836
562 Ga0450889_000099 3300042144 Bacteria 8306
563 Ga0439464_0000736 3300042439 Bacteria 7119
564 Ga0451577_0001431 3300042876 Bacteria 31788
565 Ga0466972_0009675 3300044658 Bacteria 4837
566 Ga0466972_0038923 3300044658 Bacteria 2322
567 Ga0466982_0000005 3300044672 Bacteria 364340
568 Ga0453683_0004013 3300044673 Bacteria 10620
569 Ga0466966_0002290 3300044684 Bacteria 12475
570 Ga0466963_0027502 3300044694 Bacteria 3643
571 Ga0453684_0000104 3300044712 Bacteria 365431
572 Ga0466971_0019335 3300044719 Bacteria 3024
573 Ga0466968_0029618 3300044735 Bacteria 2264
574 Ga0466970_0004188 3300044765 Bacteria 7094
575 Ga0466959_0034410 3300045049 Bacteria 3747
576 Ga0451576_0000024 3300045051 Bacteria 470499
577 Ga0451576_0007494 3300045051 Bacteria 13021
578 Ga0495590_0001372 3300046457 Bacteria 10587
579 Ga0495638_0000206 3300046460 Bacteria 83841
580 Ga0495638_0000601 3300046460 Bacteria 40489
581 Ga0495638_0000718 3300046460 Bacteria 35732
582 Ga0495638_0004955 3300046460 Bacteria 9998
583 Ga0495638_0013378 3300046460 Bacteria 5587
584 Ga0495650_0000206 3300046471 Bacteria 127713
585 Ga0495616_0000172 3300046513 Bacteria 54960
586 Ga0495616_0000301 3300046513 Bacteria 39844
587 Ga0495631_0000050 3300046518 Bacteria 71875
588 Ga0495631_0001386 3300046518 Bacteria 14723
589 Ga0495637_0006734 3300046520 Bacteria 5751
590 Ga0495637_0012745 3300046520 Bacteria 4012
591 Ga0495648_0000067 3300046524 Bacteria 140250
592 Ga0495663_0000603 3300046525 Bacteria 12535
593 Ga0495622_0000044 3300046557 Bacteria 115528
594 Ga0495633_0006549 3300046558 Bacteria 6882
595 Ga0495668_0000364 3300046616 Bacteria 59836
596 Ga0495625_0013179 3300046660 Bacteria 6659
597 Ga0495670_0052015 3300046691 Bacteria 2050
598 Ga0495671_0012049 3300046692 Bacteria 4729
599 Ga0495649_0000930 3300046694 Bacteria 23188
600 Ga0495581_0021648 3300047315 Bacteria 3725
601 Ga0495676_0028418 3300047321 Bacteria 4775
602 Ga0495673_0000549 3300047469 Bacteria 38306
603 Ga0495686_0000023 3300047472 Bacteria 400457
604 Ga0495686_0010453 3300047472 Bacteria 6601
605 Ga0495686_0025056 3300047472 Bacteria 3913
606 Ga0495626_0021808 3300048091 Bacteria 3171
607 Ga0496101_0048381 3300048904 Bacteria 3056
608 Ga0496104_0000038 3300048907 Bacteria 178150
609 Ga0496104_0037457 3300048907 Bacteria 4536
610 Ga0496105_0000038 3300048908 Bacteria 118666
611 Ga0496105_0013613 3300048908 Bacteria 6459
612 Ga0496108_0029449 3300048911 Bacteria 4547
613 Ga0496110_0000948 3300048913 Bacteria 20317
614 Ga0496111_0011178 3300048914 Bacteria 6041
615 Ga0496111_0013573 3300048914 Bacteria 5547
616 Ga0496112_0034335 3300048915 Bacteria 4936
617 Ga0496113_0012663 3300048916 Bacteria 5677
618 Ga0496114_0009311 3300048917 Bacteria 7795
619 Ga0496115_0002382 3300048918 Bacteria 13482
620 Ga0496115_0021889 3300048918 Bacteria 4943
621 Ga0496116_0044648 3300048919 Bacteria 3008
622 Ga0496117_0000483 3300048920 Bacteria 66226
623 Ga0496117_0003418 3300048920 Bacteria 18468
624 Ga0496117_0027503 3300048920 Bacteria 4431
625 Ga0496117_0035931 3300048920 Bacteria 3714
626 Ga0496118_0000520 3300048921 Bacteria 63206
627 Ga0496118_0000926 3300048921 Bacteria 45829
628 Ga0496118_0001750 3300048921 Bacteria 31523
629 Ga0496118_0002749 3300048921 Bacteria 23099
630 Ga0496118_0012543 3300048921 Bacteria 8122
631 Ga0496118_0046124 3300048921 Bacteria 3394
632 Ga0496119_0000165 3300048922 Bacteria 92447
633 Ga0496119_0002323 3300048922 Bacteria 20945
634 Ga0496119_0005152 3300048922 Bacteria 12652
635 Ga0496119_0014423 3300048922 Bacteria 6187
636 Ga0496120_0000054 3300048923 Bacteria 181170
637 Ga0496120_0000200 3300048923 Bacteria 103100
638 Ga0496120_0001064 3300048923 Bacteria 36264
639 Ga0496120_0002498 3300048923 Bacteria 18457
640 Ga0496121_0000364 3300048924 Bacteria 92919
641 Ga0496121_0007588 3300048924 Bacteria 13061
642 Ga0496121_0015077 3300048924 Bacteria 8133
643 Ga0496121_0064656 3300048924 Bacteria 2981
644 Ga0496121_0078524 3300048924 Bacteria 2623
645 Ga0496122_0000671 3300048925 Bacteria 68810
646 Ga0496122_0002256 3300048925 Bacteria 27891
647 Ga0496122_0006807 3300048925 Bacteria 12980
648 Ga0496123_0000489 3300048926 Bacteria 68892
649 Ga0496123_0008369 3300048926 Bacteria 9513
650 Ga0496123_0010473 3300048926 Bacteria 8192
651 Ga0496124_0000345 3300048927 Bacteria 85004
652 Ga0496124_0005789 3300048927 Bacteria 13748
653 Ga0496125_0000750 3300048928 Bacteria 53532
654 Ga0496125_0003859 3300048928 Bacteria 17767
655 Ga0496125_0013426 3300048928 Bacteria 8052
656 Ga0496126_0000206 3300048929 Bacteria 132028
657 Ga0496126_0000546 3300048929 Bacteria 72601
658 Ga0501032_0089521 3300049569 Bacteria 2043
659 Ga0501033_0008867 3300049570 Bacteria 7768
660 Ga0501034_0004271 3300049571 Bacteria 15941
661 Ga0501036_0042889 3300049572 Bacteria 3830
662 Ga0501037_0013659 3300049573 Bacteria 5983
663 Ga0501037_0083405 3300049573 Bacteria 2315
664 Ga0501043_0090753 3300049579 Bacteria 2402
665 Ga0501043_0116103 3300049579 Bacteria 2101
666 Ga0501046_0018913 3300049580 Bacteria 5721
667 Ga0501047_0003771 3300049581 Bacteria 14266
668 Ga0501047_0036233 3300049581 Bacteria 4767
669 Ga0501047_0046602 3300049581 Bacteria 4189
670 Ga0501047_0083596 3300049581 Bacteria 3068
671 Ga0501048_0069771 3300049582 Bacteria 2482
672 Ga0501069_0043029 3300049585 Bacteria 2499
673 Ga0501069_0043961 3300049585 Bacteria 2472
674 Ga0501070_0015429 3300049586 Bacteria 6426
675 Ga0501070_0018521 3300049586 Bacteria 5841
676 Ga0501070_0024174 3300049586 Bacteria 5095
677 Ga0501073_0008538 3300049589 Bacteria 7595
678 Ga0501074_0005391 3300049590 Bacteria 9204
679 Ga0501077_0027870 3300049593 Bacteria 3588
680 Ga0501216_000726 3300049660 Bacteria 4079
681 Ga0501224_000663 3300049664 Bacteria 4278
682 Ga0501235_000096 3300049669 Bacteria 13888
683 Ga0501257_001050 3300049686 Bacteria 5576
684 Ga0501259_001080 3300049688 Bacteria 4553
685 Ga0501221_001782 3300049704 Bacteria 3593
686 Ga0501225_0008487 3300049705 Bacteria 2946
687 Ga0501234_000510 3300049707 Bacteria 5955
688 Ga0501080_0019485 3300049742 Bacteria 6283
689 Ga0501080_0043854 3300049742 Bacteria 4165
690 Ga0501080_0099775 3300049742 Bacteria 2694
691 Ga0501266_001456 3300049763 Bacteria 3017
692 Ga0501268_000561 3300049765 Bacteria 4108
693 Ga0501035_0074178 3300049822 Bacteria 3010
694 Ga0501044_0007417 3300049823 Bacteria 12064
695 Ga0501044_0036767 3300049823 Bacteria 5121
696 Ga0501044_0070035 3300049823 Bacteria 3569
697 Ga0501044_0118210 3300049823 Bacteria 2654
698 nmdc:mga0k408_43360_c1 3300050493 Bacteria 2592
699 nmdc:mga07m45_21539_c1 3300050496 Bacteria 3511
700 nmdc:mga0n895_2035_c1 3300050512 Bacteria 15557
701 nmdc:mga0a205_17506_c1 3300050515 Bacteria 6721
702 nmdc:mga0a205_44533_c2 3300050515 Bacteria 3376
703 Ga0500643_006841 3300053087 Bacteria 4698
704 Ga0500643_009148 3300053087 Bacteria 3811
705 Ga0500644_0000166 3300053088 Bacteria 41856
706 Ga0500644_0033251 3300053088 Bacteria 1654
707 Ga0500651_0000162 3300053093 Bacteria 43090
708 Ga0500562_005788 3300053108 Bacteria 3112
709 Ga0500569_004372 3300053109 Bacteria 2965
710 Ga0500571_000042 3300053110 Bacteria 39585
711 Ga0500593_001127 3300053117 Bacteria 9623
712 Ga0500597_001835 3300053120 Bacteria 5623
713 Ga0500607_002840 3300053121 Bacteria 13383
714 Ga0500655_005137 3300053133 Bacteria 2359
715 Ga0500658_0000483 3300053134 Bacteria 17057
716 Ga0500658_0006589 3300053134 Bacteria 4307
717 Ga0500559_0006208 3300053136 Bacteria 5410
718 Ga0500559_0013482 3300053136 Bacteria 3462
719 Ga0500564_000316 3300053138 Bacteria 13593
720 Ga0500564_024076 3300053138 Bacteria 2793
721 Ga0500568_0003294 3300053139 Bacteria 9108
722 Ga0500627_0000732 3300053158 Bacteria 8739
723 Ga0501084_0062312 3300054114 Bacteria 3122
724 Ga0501082_0000954 3300060353 Bacteria 25550
725 Ga0466962_0022672 3300061719 Bacteria 3018
726 2512641998 2512564014 Bacteria 4639632
727 2525556495 2524614729 Bacteria 3091755
728 2538833957 2537561836 Bacteria 3910579
729 2572255982 2571042365 Bacteria 3289345
730 2599670556 2599185226 Bacteria 8233575
731 2599679046 2599185227 Bacteria 8246414
732 2599691271 2599185229 Bacteria 8216126
733 2630649724 2627854209 Bacteria 3093011
734 2643816986 2643221559 Bacteria 4424915
735 2643831351 2643221562 Bacteria 4048635
736 2643881266 2643221573 Bacteria 4784121
737 2643896772 2643221577 Bacteria 3710843
738 2643939407 2643221586 Bacteria 4446529
739 2644078088 2643221612 Bacteria 4361984
740 2644478977 2643221685 Bacteria 3673288
741 2644530248 2643221695 Bacteria 3441323
742 2644662040 2643221720 Bacteria 4694283
743 2644696390 2643221727 Bacteria 4415595
744 2644700177 2643221728 Bacteria 4797149
745 2687583419 2687453130 Bacteria 4227172
746 2739732294 2739367700 Bacteria 4747630
747 2739793734 2739367756 Bacteria 4553612
748 2748018752 2747842501 Bacteria 5293829
749 2819597928 2818991446 Bacteria 7757362
750 2819662352 2818991457 Bacteria 5323295
751 2831268907 2831265667 Bacteria 7184833
752 2838058345 2838054893 Bacteria 7451788
753 2848299555 2848297114 Bacteria 3608511
754 2849576406 2849573788 Bacteria 5421256
755 2852687943 2852684882 Bacteria 5463342
756 2884962344 2884960567 Bacteria 5437054
757 2885428668 2885427238 Bacteria 2291351
758 2895396497 2895395659 Bacteria 3983269
759 2896186312 2896184354 Bacteria 3258548
760 2896253668 2896253425 Bacteria 3418029
761 2899929348 2899924645 Bacteria 7487985
762 2928040209 2928037797 Bacteria 7273642
763 2928047042 2928044640 Bacteria 7271509
764 2928057753 2928051484 Bacteria 7773759
765 2928067864 2928064002 Bacteria 7419480
766 2928072428 2928070936 Bacteria 8062541
767 2928085626 2928084124 Bacteria 7159212
768 2929199363 2929195423 Bacteria 5325372
769 2939625337 2939622612 Bacteria 4698046
770 2941477580 2941475908 Bacteria 4145589
771 2941493218 2941489479 Bacteria 6313767
772 2945915052 2945909444 Bacteria 7065066
773 2945989545 2945984333 Bacteria 7358892
774 8021623988 8021622325 Bacteria 4844743
775 8021626686 8021626552 Bacteria 4665214
776 8021648272 8021648035 Bacteria 4772378
777 Ga0501070_0003182
778 JGI24741J21665_1005862
779 JGI24740J21852_10004662
780 JGI24739J22299_10002751
781 JGI24737J22298_10006712
782 JGI25152J39213_1010079
783 JGI25150J39212_1000176
784 JGI25150J39212_1000722
785 JGI25150J39212_1007488
786 JGI25159J45721_1006579
787 JGI25159J45721_1010915
788 JGI25151J46595_10000519
789 JGI25151J46595_10018311
790 JGI25151J46595_10029181
791 JGI25153J46596_10000203
792 JGI25153J46596_10013628
793 JGI25153J46596_10024286
794 JGI25160J50197_1015002
795 JGI25160J50197_1017180
796 JGI25161J50226_1005878
797 Ga0006562J51391_1001894
798 Ga0006562J51391_1022678
799 Ga0055535_1000552
800 Ga0055542_1000003
801 Ga0055526_1000005
802 Ga0055526_1016151
803 Ga0055526_1020907
804 Ga0055537_1000042
805 Ga0055537_1008902
806 Ga0055524_1000005
807 Ga0055524_1000243
808 Ga0055524_1007494
809 Ga0055524_1019644
810 Ga0055536_1001196
811 Ga0055536_1008097
812 Ga0055534_1000002
813 Ga0055534_1008571
814 Ga0055528_1000002
815 Ga0055528_1019315
816 Ga0055530_10003657
817 Ga0055530_10004621
818 Ga0055531_10001271
819 Ga0055531_10009971
820 Ga0055531_10027053
821 Ga0058692_1000143
822 Ga0055543_1003064
823 Ga0055543_1008839
824 Ga0065165_1002495
825 Ga0065165_1010740
826 Ga0065165_1013547
827 Ga0065165_1022550
828 Ga0065712_10000357
829 Ga0065715_10091439
830 Ga0070658_10000002
831 Ga0070658_10007660
832 Ga0070658_10053628
833 Ga0070658_10108373
834 Ga0070676_10018733
835 Ga0070683_100007667
836 Ga0070683_100043585
837 Ga0070690_100040290
838 Ga0070670_100000203
839 Ga0068869_100055519
840 Ga0070666_10054233
841 Ga0070680_100001134
842 Ga0070680_100001426
843 Ga0070682_100008205
844 Ga0068868_100023986
845 Ga0070660_100000381
846 Ga0070660_100001066
847 Ga0070660_100069370
848 Ga0070660_100116868
849 Ga0070689_100003285
850 Ga0070689_100042076
851 Ga0070691_10001916
852 Ga0070687_100004457
853 Ga0070661_100003980
854 Ga0070661_100022213
855 Ga0070661_100060137
856 Ga0070668_100001658
857 Ga0070668_100008875
858 Ga0070668_100010445
859 Ga0070668_100021536
860 Ga0070669_100013888
861 Ga0070669_100021860
862 Ga0070675_100002343
863 Ga0070671_100072638
864 Ga0070674_100078252
865 Ga0070673_100040315
866 Ga0070673_100059383
867 Ga0070673_100106777
868 Ga0070688_100014385
869 Ga0070659_100007515
870 Ga0070659_100055632
871 Ga0070659_100107312
872 Ga0070659_100144953
873 Ga0070667_100000848
874 Ga0070667_100011178
875 Ga0070667_100018002
876 Ga0070667_100028888
877 Ga0070667_100029817
878 Ga0070667_100074031
879 Ga0070663_100001534
880 Ga0070663_100004672
881 Ga0070663_100016847
882 Ga0070663_100020512
883 Ga0070678_100028410
884 Ga0070678_100083528
885 Ga0070662_100008925
886 Ga0070662_100018814
887 Ga0070662_100046714
888 Ga0070662_100054701
889 Ga0070662_100095381
890 Ga0070681_10000915
891 Ga0070681_10002608
892 Ga0070681_10017444
893 Ga0070681_10022121
894 Ga0070681_10223578
895 Ga0068867_100011529
896 Ga0070685_10022976
897 Ga0070699_100037887
898 Ga0070679_100000150
899 Ga0070679_100002356
900 Ga0070684_100006790
901 Ga0068853_100003225
902 Ga0068853_100021486
903 Ga0068853_100023574
904 Ga0068853_100039004
905 Ga0070672_100003386
906 Ga0070672_100003719
907 Ga0070672_100091034
908 Ga0070696_100002140
909 Ga0070696_100015715
910 Ga0070696_100020593
911 Ga0070696_100096424
912 Ga0070693_100023576
913 Ga0070665_100000108
914 Ga0070665_100008714
915 Ga0070665_100014764
916 Ga0070665_100041220
917 Ga0070665_100049723
918 Ga0070665_100053376
919 Ga0070665_100153791
920 Ga0068855_100004282
921 Ga0068855_100016141
922 Ga0068855_100040970
923 Ga0068855_100073910
924 Ga0070664_100000093
925 Ga0070664_100031702
926 Ga0070664_100049864
927 Ga0070664_100082310
928 Ga0070664_100088978
929 Ga0068857_100000180
930 Ga0068857_100007385
931 Ga0068857_100037792
932 Ga0068854_100002304
933 Ga0068854_100003859
934 Ga0068854_100006695
935 Ga0068854_100010449
936 Ga0068856_100042942
937 Ga0068852_100078409
938 Ga0068852_100116098
939 Ga0068852_100128721
940 Ga0068859_100004108
941 Ga0068864_100000078
942 Ga0068861_100067243
943 Ga0068851_10019700
944 Ga0068851_10021255
945 Ga0068870_10010469
946 Ga0068863_100000019
947 Ga0068863_100001062
948 Ga0068863_100014482
949 Ga0068858_100000832
950 Ga0068858_100183903
951 Ga0068860_100051125
952 Ga0068862_100000844
953 Ga0068862_100082384
954 Ga0081540_1023946
955 Ga0081539_10004451
956 Ga0075367_10088788
957 Ga0075369_10013722
958 Ga0075366_10009173
959 Ga0097621_100109868
960 Ga0097621_100111656
961 Ga0068871_100026443
962 Ga0075431_100020241
963 Ga0075433_10058341
964 Ga0075433_10104124
965 Ga0075434_100002845
966 Ga0075434_100002906
967 Ga0075436_100028303
968 Ga0097620_100004108
969 Ga0079104_1006894
970 Ga0105251_10000074
971 Ga0105240_10000941
972 Ga0105240_10001400
973 Ga0105240_10011719
974 Ga0105240_10211115
975 Ga0111539_10150332
976 Ga0105247_10037821
977 Ga0105243_10000732
978 Ga0105243_10059132
979 Ga0105242_10000382
980 Ga0105242_10002152
981 Ga0105248_10000317
982 Ga0105248_10001415
983 Ga0105248_10008933
984 Ga0105248_10009400
985 Ga0105248_10010064
986 Ga0105248_10062240
987 Ga0105248_10117134
988 Ga0105248_10168388
989 Ga0105237_10000214
990 Ga0105237_10003030
991 Ga0105237_10009465
992 Ga0105238_10004212
993 Ga0105238_10015966
994 Ga0105238_10026059
995 Ga0105249_10101887
996 Ga0105239_10000390
997 Ga0105239_10003689
998 Ga0105239_10009141
999 Ga0105239_10050557
1000 Ga0105239_10054999
1001 Ga0105239_10064857
1002 Ga0157314_1000074
1003 Ga0157347_1000018
1004 Ga0157373_10004665
1005 Ga0157371_10000372
1006 Ga0157371_10029539
1007 Ga0157371_10100455
1008 Ga0157370_10000586
1009 Ga0157370_10002097
1010 Ga0157370_10011830
1011 Ga0157370_10019302
1012 Ga0157370_10058393
1013 Ga0157369_10000172
1014 Ga0157378_10020708
1015 Ga0163162_10005268
1016 Ga0157372_10001271
1017 Ga0157372_10022113
1018 Ga0157372_10047647
1019 Ga0157375_10000835
1020 Ga0157375_10010204
1021 Ga0157375_10022691
1022 Ga0157375_10057661
1023 Ga0157375_10097116
1024 Ga0157375_10124887
1025 Ga0163163_10000588
1026 Ga0157380_10091717
1027 Ga0157379_10004364
1028 Ga0157379_10069439
1029 Ga0157376_10001051
1030 Ga0182007_10000025
1031 Ga0182005_1000063
1032 Ga0182005_1002028
1033 Ga0183360_10002
1034 Ga0163161_10002498
1035 Ga0163161_10003580
1036 Ga0163161_10090228
1037 Ga0206354_10853913
1038 Ga0213875_10002677
1039 Ga0213875_10008468
1040 Ga0209436_102753
1041 Ga0209672_100220
1042 Ga0209672_101566
1043 Ga0209147_101094
1044 Ga0209258_100015
1045 Ga0207425_1000021
1046 Ga0207425_1000063
1047 Ga0207425_1000155
1048 Ga0207425_1000532
1049 Ga0209148_1000028
1050 Ga0209129_1000020
1051 Ga0209129_1000160
1052 Ga0209129_1000243
1053 Ga0209129_1001346
1054 Ga0209129_1008628
1055 Ga0209129_1011158
1056 Ga0209565_1000001
1057 Ga0209565_1002457
1058 Ga0209565_1003157
1059 Ga0209565_1006813
1060 Ga0209673_1000001
1061 Ga0209673_1003706
1062 Ga0209673_1010664
1063 Ga0209673_1015001
1064 Ga0209130_1000738
1065 Ga0209130_1001341
1066 Ga0209130_1008137
1067 Ga0209675_1000001
1068 Ga0209675_1001553
1069 Ga0209675_1010590
1070 Ga0209676_1000074
1071 Ga0209676_1000177
1072 Ga0209025_1000002
1073 Ga0209025_1001271
1074 Ga0209025_1005652
1075 Ga0209025_1015645
1076 Ga0209025_1016339
1077 Ga0209564_1000001
1078 Ga0209564_1000346
1079 Ga0209564_1003007
1080 Ga0209758_1000003
1081 Ga0209758_1000013
1082 Ga0209758_1000039
1083 Ga0209758_1000288
1084 Ga0209758_1000577
1085 Ga0209758_1028707
1086 Ga0209758_1030851
1087 Ga0209050_1000015
1088 Ga0209050_1000837
1089 Ga0209256_1000006
1090 Ga0209256_1000079
1091 Ga0209256_1000264
1092 Ga0209256_1003261
1093 Ga0207426_1000108
1094 Ga0207426_1000130
1095 Ga0207426_1017278
1096 Ga0209051_1000010
1097 Ga0209257_1000026
1098 Ga0209257_1000253
1099 Ga0209257_1010254
1100 Ga0207656_10005343
1101 Ga0207655_1030340
1102 Ga0207713_1000206
1103 Ga0207682_10028626
1104 Ga0207688_10004545
1105 Ga0207647_10003584
1106 Ga0207647_10003912
1107 Ga0207643_10014623
1108 Ga0207705_10000005
1109 Ga0207705_10000029
1110 Ga0207705_10000196
1111 Ga0207705_10000849
1112 Ga0207705_10012438
1113 Ga0207705_10042014
1114 Ga0207707_10000049
1115 Ga0207707_10000524
1116 Ga0207707_10005763
1117 Ga0207707_10010918
1118 Ga0207707_10013235
1119 Ga0207695_10001428
1120 Ga0207695_10003902
1121 Ga0207695_10005285
1122 Ga0207695_10023694
1123 Ga0207695_10034168
1124 Ga0207695_10057260
1125 Ga0207695_10117055
1126 Ga0207671_10000057
1127 Ga0207671_10000614
1128 Ga0207660_10000738
1129 Ga0207660_10000824
1130 Ga0207660_10002809
1131 Ga0207662_10010713
1132 Ga0207657_10000366
1133 Ga0207657_10001980
1134 Ga0207657_10010520
1135 Ga0207657_10011898
1136 Ga0207657_10017023
1137 Ga0207657_10089972
1138 Ga0207649_10001327
1139 Ga0207649_10019921
1140 Ga0207652_10000014
1141 Ga0207652_10002050
1142 Ga0207652_10007253
1143 Ga0207681_10008514
1144 Ga0207681_10026462
1145 Ga0207694_10000389
1146 Ga0207694_10092007
1147 Ga0207650_10003825
1148 Ga0207650_10010658
1149 Ga0207650_10026087
1150 Ga0207650_10062203
1151 Ga0207659_10000922
1152 Ga0207644_10000863
1153 Ga0207644_10014665
1154 Ga0207644_10079406
1155 Ga0207644_10126707
1156 Ga0207690_10004132
1157 Ga0207690_10005618
1158 Ga0207690_10059620
1159 Ga0207706_10009357
1160 Ga0207706_10013061
1161 Ga0207706_10028226
1162 Ga0207706_10031994
1163 Ga0207706_10079758
1164 Ga0207706_10092126
1165 Ga0207706_10138186
1166 Ga0207686_10018261
1167 Ga0207709_10002739
1168 Ga0207709_10006002
1169 Ga0207691_10003686
1170 Ga0207691_10003724
1171 Ga0207691_10005219
1172 Ga0207691_10010329
1173 Ga0207691_10050073
1174 Ga0207711_10000042
1175 Ga0207711_10001192
1176 Ga0207711_10005184
1177 Ga0207711_10024256
1178 Ga0207711_10080795
1179 Ga0207689_10046569
1180 Ga0207679_10022572
1181 Ga0207667_10000075
1182 Ga0207667_10000139
1183 Ga0207667_10000247
1184 Ga0207667_10002560
1185 Ga0207667_10005407
1186 Ga0207667_10019569
1187 Ga0207651_10010407
1188 Ga0207651_10015296
1189 Ga0207712_10000774
1190 Ga0207712_10036576
1191 Ga0207668_10001836
1192 Ga0207668_10021703
1193 Ga0207668_10032494
1194 Ga0207668_10062228
1195 Ga0207640_10000072
1196 Ga0207640_10002140
1197 Ga0207658_10000129
1198 Ga0207658_10015261
1199 Ga0207658_10033655
1200 Ga0207658_10059774
1201 Ga0207658_10072704
1202 Ga0207677_10013281
1203 Ga0207703_10000562
1204 Ga0207703_10001651
1205 Ga0207703_10001950
1206 Ga0207703_10142838
1207 Ga0207639_10000690
1208 Ga0207639_10000761
1209 Ga0207639_10003326
1210 Ga0207639_10014100
1211 Ga0207639_10030370
1212 Ga0207639_10033443
1213 Ga0207639_10046819
1214 Ga0207678_10000915
1215 Ga0207678_10003168
1216 Ga0207678_10007726
1217 Ga0207678_10008551
1218 Ga0207678_10008759
1219 Ga0207678_10009736
1220 Ga0207678_10014318
1221 Ga0207678_10038194
1222 Ga0207678_10040977
1223 Ga0207702_10020699
1224 Ga0207702_10050438
1225 Ga0207641_10000005
1226 Ga0207641_10000444
1227 Ga0207641_10055895
1228 Ga0207648_10004770
1229 Ga0207648_10007362
1230 Ga0207648_10010683
1231 Ga0207676_10000130
1232 Ga0207676_10000740
1233 Ga0207676_10047631
1234 Ga0207674_10000371
1235 Ga0207674_10000895
1236 Ga0207674_10003700
1237 Ga0207674_10004005
1238 Ga0207674_10010501
1239 Ga0207674_10014423
1240 Ga0207674_10028341
1241 Ga0207674_10097984
1242 Ga0207675_100079459
1243 Ga0207683_10012138
1244 Ga0207683_10147012
1245 Ga0207698_10012712
1246 Ga0209371_1000048
1247 Ga0209998_10000544
1248 Ga0209974_10005851
1249 Ga0268266_10000001
1250 Ga0268266_10058815
1251 Ga0268265_10000478
1252 Ga0268265_10005151
1253 Ga0268265_10005187
1254 Ga0268265_10033487
1255 Ga0268265_10055897
1256 Ga0268265_10071851
1257 Ga0268264_10004535
1258 Ga0268264_10015987
1259 Ga0268264_10034303
1260 Ga0268264_10035202
1261 Ga0268264_10049864
1262 Ga0307515_10132353
1263 Ga0268256_1000049
1264 Ga0265332_10010267
1265 Ga0265327_10018116
1266 Ga0307408_100000462
1267 Ga0307408_100108699
1268 Ga0307405_10004388
1269 Ga0307405_10008078
1270 Ga0307405_10008990
1271 Ga0307413_10000510
1272 Ga0307413_10002495
1273 Ga0307413_10024198
1274 Ga0307413_10058263
1275 Ga0307410_10001464
1276 Ga0307410_10002763
1277 Ga0307410_10015868
1278 Ga0307410_10024283
1279 Ga0307410_10070532
1280 Ga0307410_10071278
1281 Ga0307406_10009693
1282 Ga0307406_10014720
1283 Ga0307406_10022466
1284 Ga0307407_10022510
1285 Ga0307412_10002004
1286 Ga0307412_10013564
1287 Ga0307412_10024666
1288 Ga0307412_10098041
1289 Ga0307409_100000754
1290 Ga0307409_100013543
1291 Ga0307409_100018441
1292 Ga0307409_100020069
1293 Ga0307409_100036398
1294 Ga0307416_100015686
1295 Ga0307416_100021152
1296 Ga0307416_100022048
1297 Ga0307416_100032175
1298 Ga0307416_100041909
1299 Ga0307416_100060889
1300 Ga0307416_100130868
1301 Ga0307414_10003324
1302 Ga0307414_10006918
1303 Ga0307414_10094021
1304 Ga0307411_10001415
1305 Ga0307411_10047603
1306 Ga0307411_10058834
1307 Ga0307411_10078997
1308 Ga0307415_100006829
1309 Ga0307415_100014221
1310 Ga0307415_100047237
1311 Ga0307415_100049359
1312 Ga0307507_10080766
1313 Ga0373943_0025424
1314 Ga0395899_0007347
1315 Ga0395899_0012121
1316 Ga0395899_0046053
1317 Ga0395899_0052209
1318 Ga0395900_0021165
1319 Ga0395900_0098541
1320 Ga0395898_0050322
1321 Ga0395898_0060432
1322 Ga0436364_0152495
1323 Ga0436364_0612163
1324 Ga0395901_0002260
1325 Ga0395901_0007279
1326 Ga0395901_0026730
1327 Ga0395901_0094401
1328 Ga0395901_0109496
1329 Ga0237819_00083
1330 Ga0436363_0082884
1331 Ga0439439_0007991
1332 Ga0439447_004314
1333 Ga0439433_0003763
1334 Ga0439449_0005388
1335 Ga0439449_0016059
1336 Ga0450912_000740
1337 Ga0450905_001664
1338 Ga0450889_000099
1339 Ga0439464_0000736
1340 Ga0451577_0001431
1341 Ga0466972_0009675
1342 Ga0466972_0038923
1343 Ga0466982_0000005
1344 Ga0453683_0004013
1345 Ga0466966_0002290
1346 Ga0466963_0027502
1347 Ga0453684_0000104
1348 Ga0466971_0019335
1349 Ga0466968_0029618
1350 Ga0466970_0004188
1351 Ga0466959_0034410
1352 Ga0451576_0000024
1353 Ga0451576_0007494
1354 Ga0495590_0001372
1355 Ga0495638_0000206
1356 Ga0495638_0000601
1357 Ga0495638_0000718
1358 Ga0495638_0004955
1359 Ga0495638_0013378
1360 Ga0495650_0000206
1361 Ga0495616_0000172
1362 Ga0495616_0000301
1363 Ga0495631_0000050
1364 Ga0495631_0001386
1365 Ga0495637_0006734
1366 Ga0495637_0012745
1367 Ga0495648_0000067
1368 Ga0495663_0000603
1369 Ga0495622_0000044
1370 Ga0495633_0006549
1371 Ga0495668_0000364
1372 Ga0495625_0013179
1373 Ga0495670_0052015
1374 Ga0495671_0012049
1375 Ga0495649_0000930
1376 Ga0495581_0021648
1377 Ga0495676_0028418
1378 Ga0495673_0000549
1379 Ga0495686_0000023
1380 Ga0495686_0010453
1381 Ga0495686_0025056
1382 Ga0495626_0021808
1383 Ga0496101_0048381
1384 Ga0496104_0000038
1385 Ga0496104_0037457
1386 Ga0496105_0000038
1387 Ga0496105_0013613
1388 Ga0496108_0029449
1389 Ga0496110_0000948
1390 Ga0496111_0011178
1391 Ga0496111_0013573
1392 Ga0496112_0034335
1393 Ga0496113_0012663
1394 Ga0496114_0009311
1395 Ga0496115_0002382
1396 Ga0496115_0021889
1397 Ga0496116_0044648
1398 Ga0496117_0000483
1399 Ga0496117_0003418
1400 Ga0496117_0027503
1401 Ga0496117_0035931
1402 Ga0496118_0000520
1403 Ga0496118_0000926
1404 Ga0496118_0001750
1405 Ga0496118_0002749
1406 Ga0496118_0012543
1407 Ga0496118_0046124
1408 Ga0496119_0000165
1409 Ga0496119_0002323
1410 Ga0496119_0005152
1411 Ga0496119_0014423
1412 Ga0496120_0000054
1413 Ga0496120_0000200
1414 Ga0496120_0001064
1415 Ga0496120_0002498
1416 Ga0496121_0000364
1417 Ga0496121_0007588
1418 Ga0496121_0015077
1419 Ga0496121_0064656
1420 Ga0496121_0078524
1421 Ga0496122_0000671
1422 Ga0496122_0002256
1423 Ga0496122_0006807
1424 Ga0496123_0000489
1425 Ga0496123_0008369
1426 Ga0496123_0010473
1427 Ga0496124_0000345
1428 Ga0496124_0005789
1429 Ga0496125_0000750
1430 Ga0496125_0003859
1431 Ga0496125_0013426
1432 Ga0496126_0000206
1433 Ga0496126_0000546
1434 Ga0501032_0089521
1435 Ga0501033_0008867
1436 Ga0501034_0004271
1437 Ga0501036_0042889
1438 Ga0501037_0013659
1439 Ga0501037_0083405
1440 Ga0501043_0090753
1441 Ga0501043_0116103
1442 Ga0501046_0018913
1443 Ga0501047_0003771
1444 Ga0501047_0036233
1445 Ga0501047_0046602
1446 Ga0501047_0083596
1447 Ga0501048_0069771
1448 Ga0501069_0043029
1449 Ga0501069_0043961
1450 Ga0501070_0015429
1451 Ga0501070_0018521
1452 Ga0501070_0024174
1453 Ga0501073_0008538
1454 Ga0501074_0005391
1455 Ga0501077_0027870
1456 Ga0501216_000726
1457 Ga0501224_000663
1458 Ga0501235_000096
1459 Ga0501257_001050
1460 Ga0501259_001080
1461 Ga0501221_001782
1462 Ga0501225_0008487
1463 Ga0501234_000510
1464 Ga0501080_0019485
1465 Ga0501080_0043854
1466 Ga0501080_0099775
1467 Ga0501266_001456
1468 Ga0501268_000561
1469 Ga0501035_0074178
1470 Ga0501044_0007417
1471 Ga0501044_0036767
1472 Ga0501044_0070035
1473 Ga0501044_0118210
1474 nmdc:mga0k408_43360_c1
1475 nmdc:mga07m45_21539_c1
1476 nmdc:mga0n895_2035_c1
1477 nmdc:mga0a205_17506_c1
1478 nmdc:mga0a205_44533_c2
1479 Ga0500643_006841
1480 Ga0500643_009148
1481 Ga0500644_0000166
1482 Ga0500644_0033251
1483 Ga0500651_0000162
1484 Ga0500562_005788
1485 Ga0500569_004372
1486 Ga0500571_000042
1487 Ga0500593_001127
1488 Ga0500597_001835
1489 Ga0500607_002840
1490 Ga0500655_005137
1491 Ga0500658_0000483
1492 Ga0500658_0006589
1493 Ga0500559_0006208
1494 Ga0500559_0013482
1495 Ga0500564_000316
1496 Ga0500564_024076
1497 Ga0500568_0003294
1498 Ga0500627_0000732
1499 Ga0501084_0062312
1500 Ga0501082_0000954
1501 Ga0466962_0022672
1502 2512641998
1503 2525556495
1504 2538833957
1505 2572255982
1506 2599670556
1507 2599679046
1508 2599691271
1509 2630649724
1510 2643816986
1511 2643831351
1512 2643881266
1513 2643896772
1514 2643939407
1515 2644078088
1516 2644478977
1517 2644530248
1518 2644662040
1519 2644696390
1520 2644700177
1521 2687583419
1522 2739732294
1523 2739793734
1524 2748018752
1525 2819597928
1526 2819662352
1527 2831268907
1528 2838058345
1529 2848299555
1530 2849576406
1531 2852687943
1532 2884962344
1533 2885428668
1534 2895396497
1535 2896186312
1536 2896253668
1537 2899929348
1538 2928040209
1539 2928047042
1540 2928057753
1541 2928067864
1542 2928072428
1543 2928085626
1544 2929199363
1545 2939625337
1546 2941477580
1547 2941493218
1548 2945915052
1549 2945989545
1550 8021623988
1551 8021626686
1552 8021648272

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

355

571

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2anp-assembly1.cif.gz_A functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. 0.7797 348 579
1tkf-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with d-tryptophan 0.7774 347 576
1tkj-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with d-methionine 0.7713 347 576
1amp-assembly1.cif.gz_A crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family 0.7654 339 579
1tf8-assembly1.cif.gz_A streptomyces griseus aminopeptidase complexed with l-tryptophan 0.7652 347 576
ID Description Score Start End Superfamily
af_P37302_266_505_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7795 342 579 3.40.630.10
5ib9A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7758 342 586 3.40.630.10
1xjoA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7643 347 576 3.40.630.10
1cp6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7622 348 579 3.40.630.10
af_O94479_48_334_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.76 342 580 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7X5SBD9-F1-model_v4 Peptidase M20 0.9953 160 351
AF-A0A259JBB5-F1-model_v4 deleted 0.9878 367 601
AF-A0A520Y513-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9873 382 600 GO:0006508
GO:0008235
AF-A0A356SA33-F1-model_v4 Peptidase M28 0.9806 391 601 GO:0006508
GO:0008235
AF-A0A519NYV3-F1-model_v4 deleted 0.9798 370 595

Map