F480340
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 776 | 383 | 1552 | 553 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0003182|Ga0501070_0003182_7114_8934 |
| Length | 606 |
| Sequence | MQRHDESPLRKGDALRINDQPRRRKGDIVPANHSTPQEYPFVKWLMIPALALTLSVSACADNKSSDTAADAEPAKTYAPTFDAARLSGEVKTLSSDAFEGRGPATAGETKTIDYLVAQMQAAGLEPGGDLVDGKRGWTQDVPLARFQISGAPAIELDVAGKPQKLTQGEEIALRAAQDGSKRVDIEHAPLVFVGYGVTAPERNWDDFKGMDLRGKIAVALVNDPDYETGKGDFGGKAMTYYGRWTYKYEEAARRGALGLLIVHETKPASYGWPTVRNSNTNAQFDIVRDDPAAAHPKVEGWIQRDLAVSLFKRAGLDFEALKKQAQTRDFKPVVLKGETFSAHYDVAVDEITSHNVVGRVTGSKYPDETIIYSAHWDHLGIGAPDDNGDRIYNGAVDNATGTAALIEMGRAFAHAPKPERSVVFLAVTAEEKGLLGSEYYASHPLYPLAKTVANINTDALSPGGVARDFSISGSARLGLLDDLIAIAKRHDLSFTPDSHPEAGYFFRSDHFSFAKRGVPALSFGSGEDLLDGGKQAGEAQGREYGIKHYHQPSDEWQASWTFAGMAHDLPVLYDLGAQLANSREWPTWSGDSEFRAARDKSADERS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 107 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 126 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 226 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 227 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 228 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 229 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 230 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 231 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 234 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 238 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 239 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 275 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 276 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 277 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 282 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 299 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 302 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 303 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 304 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 308 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 312 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 316 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 318 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 319 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 320 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 322 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 323 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 324 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 325 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 329 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 334 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 335 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 336 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 337 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 338 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 339 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 340 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 341 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 342 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 343 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 344 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 345 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 346 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 347 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 348 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 349 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 350 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 351 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 352 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 353 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 354 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 355 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 356 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 357 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 358 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 359 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 360 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 361 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 362 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 363 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 364 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 365 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 366 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 367 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 368 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 369 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 370 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 371 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 372 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 373 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 374 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 375 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 376 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 377 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 378 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 379 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 380 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 381 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 382 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 383 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.04 |
| Metatranscriptomes | 0.39 |
| Isolates | 6.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.62 |
| Nodule | 0.26 |
| Rhizoplane | 2.06 |
| Rhizosphere | 71.13 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501070_0003182 | 3300049586 | Bacteria | 14276 |
| 2 | JGI24741J21665_1005862 | 3300001915 | Bacteria | 2517 |
| 3 | JGI24740J21852_10004662 | 3300001979 | Bacteria | 5879 |
| 4 | JGI24739J22299_10002751 | 3300001989 | Bacteria | 6764 |
| 5 | JGI24737J22298_10006712 | 3300001990 | Bacteria | 3916 |
| 6 | JGI25152J39213_1010079 | 3300002773 | Bacteria | 2188 |
| 7 | JGI25150J39212_1000176 | 3300002774 | Bacteria | 35986 |
| 8 | JGI25150J39212_1000722 | 3300002774 | Bacteria | 11801 |
| 9 | JGI25150J39212_1007488 | 3300002774 | Bacteria | 2188 |
| 10 | JGI25159J45721_1006579 | 3300002987 | Bacteria | 3460 |
| 11 | JGI25159J45721_1010915 | 3300002987 | Bacteria | 2268 |
| 12 | JGI25151J46595_10000519 | 3300003187 | Bacteria | 35984 |
| 13 | JGI25151J46595_10018311 | 3300003187 | Bacteria | 3013 |
| 14 | JGI25151J46595_10029181 | 3300003187 | Bacteria | 2188 |
| 15 | JGI25153J46596_10000203 | 3300003215 | Bacteria | 54460 |
| 16 | JGI25153J46596_10013628 | 3300003215 | Bacteria | 3425 |
| 17 | JGI25153J46596_10024286 | 3300003215 | Bacteria | 2188 |
| 18 | JGI25160J50197_1015002 | 3300003354 | Bacteria | 2563 |
| 19 | JGI25160J50197_1017180 | 3300003354 | Bacteria | 2302 |
| 20 | JGI25161J50226_1005878 | 3300003374 | Bacteria | 2302 |
| 21 | Ga0006562J51391_1001894 | 3300003578 | Bacteria | 30450 |
| 22 | Ga0006562J51391_1022678 | 3300003578 | Bacteria | 6740 |
| 23 | Ga0055535_1000552 | 3300003761 | Bacteria | 32082 |
| 24 | Ga0055542_1000003 | 3300003762 | Bacteria | 582721 |
| 25 | Ga0055526_1000005 | 3300003771 | Bacteria | 344542 |
| 26 | Ga0055526_1016151 | 3300003771 | Bacteria | 2942 |
| 27 | Ga0055526_1020907 | 3300003771 | Bacteria | 2302 |
| 28 | Ga0055537_1000042 | 3300003773 | Bacteria | 91406 |
| 29 | Ga0055537_1008902 | 3300003773 | Bacteria | 2265 |
| 30 | Ga0055524_1000005 | 3300003775 | Bacteria | 344542 |
| 31 | Ga0055524_1000243 | 3300003775 | Bacteria | 56992 |
| 32 | Ga0055524_1007494 | 3300003775 | Bacteria | 4623 |
| 33 | Ga0055524_1019644 | 3300003775 | Bacteria | 2302 |
| 34 | Ga0055536_1001196 | 3300003781 | Bacteria | 16129 |
| 35 | Ga0055536_1008097 | 3300003781 | Bacteria | 4582 |
| 36 | Ga0055534_1000002 | 3300003784 | Bacteria | 390762 |
| 37 | Ga0055534_1008571 | 3300003784 | Bacteria | 2302 |
| 38 | Ga0055528_1000002 | 3300003790 | Bacteria | 368879 |
| 39 | Ga0055528_1019315 | 3300003790 | Bacteria | 2265 |
| 40 | Ga0055530_10003657 | 3300003791 | Bacteria | 8609 |
| 41 | Ga0055530_10004621 | 3300003791 | Bacteria | 7007 |
| 42 | Ga0055531_10001271 | 3300003794 | Bacteria | 19060 |
| 43 | Ga0055531_10009971 | 3300003794 | Bacteria | 4790 |
| 44 | Ga0055531_10027053 | 3300003794 | Bacteria | 2025 |
| 45 | Ga0058692_1000143 | 3300003856 | Bacteria | 45126 |
| 46 | Ga0055543_1003064 | 3300004625 | Bacteria | 5137 |
| 47 | Ga0055543_1008839 | 3300004625 | Bacteria | 2203 |
| 48 | Ga0065165_1002495 | 3300005262 | Bacteria | 15406 |
| 49 | Ga0065165_1010740 | 3300005262 | Bacteria | 3913 |
| 50 | Ga0065165_1013547 | 3300005262 | Bacteria | 3234 |
| 51 | Ga0065165_1022550 | 3300005262 | Bacteria | 2155 |
| 52 | Ga0065712_10000357 | 3300005290 | Bacteria | 13537 |
| 53 | Ga0065715_10091439 | 3300005293 | Bacteria | 5794 |
| 54 | Ga0070658_10000002 | 3300005327 | Bacteria | 637290 |
| 55 | Ga0070658_10007660 | 3300005327 | Bacteria | 8704 |
| 56 | Ga0070658_10053628 | 3300005327 | Bacteria | 3273 |
| 57 | Ga0070658_10108373 | 3300005327 | Bacteria | 2299 |
| 58 | Ga0070676_10018733 | 3300005328 | Bacteria | 3841 |
| 59 | Ga0070683_100007667 | 3300005329 | Bacteria | 9132 |
| 60 | Ga0070683_100043585 | 3300005329 | Bacteria | 4135 |
| 61 | Ga0070690_100040290 | 3300005330 | Bacteria | 2954 |
| 62 | Ga0070670_100000203 | 3300005331 | Bacteria | 55342 |
| 63 | Ga0068869_100055519 | 3300005334 | Bacteria | 2887 |
| 64 | Ga0070666_10054233 | 3300005335 | Bacteria | 2704 |
| 65 | Ga0070680_100001134 | 3300005336 | Bacteria | 19121 |
| 66 | Ga0070680_100001426 | 3300005336 | Bacteria | 17294 |
| 67 | Ga0070682_100008205 | 3300005337 | Bacteria | 5888 |
| 68 | Ga0068868_100023986 | 3300005338 | Bacteria | 4623 |
| 69 | Ga0070660_100000381 | 3300005339 | Bacteria | 29499 |
| 70 | Ga0070660_100001066 | 3300005339 | Bacteria | 18437 |
| 71 | Ga0070660_100069370 | 3300005339 | Bacteria | 2749 |
| 72 | Ga0070660_100116868 | 3300005339 | Bacteria | 2127 |
| 73 | Ga0070689_100003285 | 3300005340 | Bacteria | 10737 |
| 74 | Ga0070689_100042076 | 3300005340 | Bacteria | 3508 |
| 75 | Ga0070691_10001916 | 3300005341 | Bacteria | 9128 |
| 76 | Ga0070687_100004457 | 3300005343 | Bacteria | 5587 |
| 77 | Ga0070661_100003980 | 3300005344 | Bacteria | 10166 |
| 78 | Ga0070661_100022213 | 3300005344 | Bacteria | 4541 |
| 79 | Ga0070661_100060137 | 3300005344 | Bacteria | 2788 |
| 80 | Ga0070668_100001658 | 3300005347 | Bacteria | 16155 |
| 81 | Ga0070668_100008875 | 3300005347 | Bacteria | 7465 |
| 82 | Ga0070668_100010445 | 3300005347 | Bacteria | 6899 |
| 83 | Ga0070668_100021536 | 3300005347 | Bacteria | 4870 |
| 84 | Ga0070669_100013888 | 3300005353 | Bacteria | 5727 |
| 85 | Ga0070669_100021860 | 3300005353 | Bacteria | 4574 |
| 86 | Ga0070675_100002343 | 3300005354 | Bacteria | 14076 |
| 87 | Ga0070671_100072638 | 3300005355 | Bacteria | 2873 |
| 88 | Ga0070674_100078252 | 3300005356 | Bacteria | 2356 |
| 89 | Ga0070673_100040315 | 3300005364 | Bacteria | 3582 |
| 90 | Ga0070673_100059383 | 3300005364 | Bacteria | 3027 |
| 91 | Ga0070673_100106777 | 3300005364 | Bacteria | 2315 |
| 92 | Ga0070688_100014385 | 3300005365 | Bacteria | 4482 |
| 93 | Ga0070659_100007515 | 3300005366 | Bacteria | 7918 |
| 94 | Ga0070659_100055632 | 3300005366 | Bacteria | 3119 |
| 95 | Ga0070659_100107312 | 3300005366 | Bacteria | 2251 |
| 96 | Ga0070659_100144953 | 3300005366 | Bacteria | 1934 |
| 97 | Ga0070667_100000848 | 3300005367 | Bacteria | 28390 |
| 98 | Ga0070667_100011178 | 3300005367 | Bacteria | 7426 |
| 99 | Ga0070667_100018002 | 3300005367 | Bacteria | 5855 |
| 100 | Ga0070667_100028888 | 3300005367 | Bacteria | 4617 |
| 101 | Ga0070667_100029817 | 3300005367 | Bacteria | 4548 |
| 102 | Ga0070667_100074031 | 3300005367 | Bacteria | 2905 |
| 103 | Ga0070663_100001534 | 3300005455 | Bacteria | 12711 |
| 104 | Ga0070663_100004672 | 3300005455 | Bacteria | 8075 |
| 105 | Ga0070663_100016847 | 3300005455 | Bacteria | 4755 |
| 106 | Ga0070663_100020512 | 3300005455 | Bacteria | 4378 |
| 107 | Ga0070678_100028410 | 3300005456 | Bacteria | 3814 |
| 108 | Ga0070678_100083528 | 3300005456 | Bacteria | 2428 |
| 109 | Ga0070662_100008925 | 3300005457 | Bacteria | 6534 |
| 110 | Ga0070662_100018814 | 3300005457 | Bacteria | 4679 |
| 111 | Ga0070662_100046714 | 3300005457 | Bacteria | 3111 |
| 112 | Ga0070662_100054701 | 3300005457 | Bacteria | 2893 |
| 113 | Ga0070662_100095381 | 3300005457 | Bacteria | 2242 |
| 114 | Ga0070681_10000915 | 3300005458 | Bacteria | 24938 |
| 115 | Ga0070681_10002608 | 3300005458 | Bacteria | 16544 |
| 116 | Ga0070681_10017444 | 3300005458 | Bacteria | 7176 |
| 117 | Ga0070681_10022121 | 3300005458 | Bacteria | 6381 |
| 118 | Ga0070681_10223578 | 3300005458 | Bacteria | 1797 |
| 119 | Ga0068867_100011529 | 3300005459 | Bacteria | 6241 |
| 120 | Ga0070685_10022976 | 3300005466 | Bacteria | 3408 |
| 121 | Ga0070699_100037887 | 3300005518 | Bacteria | 4174 |
| 122 | Ga0070679_100000150 | 3300005530 | Bacteria | 56196 |
| 123 | Ga0070679_100002356 | 3300005530 | Bacteria | 17116 |
| 124 | Ga0070684_100006790 | 3300005535 | Bacteria | 8875 |
| 125 | Ga0068853_100003225 | 3300005539 | Bacteria | 12471 |
| 126 | Ga0068853_100021486 | 3300005539 | Bacteria | 5383 |
| 127 | Ga0068853_100023574 | 3300005539 | Bacteria | 5153 |
| 128 | Ga0068853_100039004 | 3300005539 | Bacteria | 4049 |
| 129 | Ga0070672_100003386 | 3300005543 | Bacteria | 10335 |
| 130 | Ga0070672_100003719 | 3300005543 | Bacteria | 9924 |
| 131 | Ga0070672_100091034 | 3300005543 | Bacteria | 2461 |
| 132 | Ga0070696_100002140 | 3300005546 | Bacteria | 12993 |
| 133 | Ga0070696_100015715 | 3300005546 | Bacteria | 5087 |
| 134 | Ga0070696_100020593 | 3300005546 | Bacteria | 4468 |
| 135 | Ga0070696_100096424 | 3300005546 | Bacteria | 2113 |
| 136 | Ga0070693_100023576 | 3300005547 | Bacteria | 3291 |
| 137 | Ga0070665_100000108 | 3300005548 | Bacteria | 155204 |
| 138 | Ga0070665_100008714 | 3300005548 | Bacteria | 10264 |
| 139 | Ga0070665_100014764 | 3300005548 | Bacteria | 7840 |
| 140 | Ga0070665_100041220 | 3300005548 | Bacteria | 4640 |
| 141 | Ga0070665_100049723 | 3300005548 | Bacteria | 4206 |
| 142 | Ga0070665_100053376 | 3300005548 | Bacteria | 4054 |
| 143 | Ga0070665_100153791 | 3300005548 | Bacteria | 2302 |
| 144 | Ga0068855_100004282 | 3300005563 | Bacteria | 17432 |
| 145 | Ga0068855_100016141 | 3300005563 | Bacteria | 8980 |
| 146 | Ga0068855_100040970 | 3300005563 | Bacteria | 5492 |
| 147 | Ga0068855_100073910 | 3300005563 | Bacteria | 3960 |
| 148 | Ga0070664_100000093 | 3300005564 | Bacteria | 57415 |
| 149 | Ga0070664_100031702 | 3300005564 | Bacteria | 4419 |
| 150 | Ga0070664_100049864 | 3300005564 | Bacteria | 3541 |
| 151 | Ga0070664_100082310 | 3300005564 | Bacteria | 2776 |
| 152 | Ga0070664_100088978 | 3300005564 | Bacteria | 2670 |
| 153 | Ga0068857_100000180 | 3300005577 | Bacteria | 40331 |
| 154 | Ga0068857_100007385 | 3300005577 | Bacteria | 9464 |
| 155 | Ga0068857_100037792 | 3300005577 | Bacteria | 4277 |
| 156 | Ga0068854_100002304 | 3300005578 | Bacteria | 11763 |
| 157 | Ga0068854_100003859 | 3300005578 | Bacteria | 9395 |
| 158 | Ga0068854_100006695 | 3300005578 | Bacteria | 7345 |
| 159 | Ga0068854_100010449 | 3300005578 | Bacteria | 6020 |
| 160 | Ga0068856_100042942 | 3300005614 | Bacteria | 4449 |
| 161 | Ga0068852_100078409 | 3300005616 | Bacteria | 2922 |
| 162 | Ga0068852_100116098 | 3300005616 | Bacteria | 2441 |
| 163 | Ga0068852_100128721 | 3300005616 | Bacteria | 2329 |
| 164 | Ga0068859_100004108 | 3300005617 | Bacteria | 14849 |
| 165 | Ga0068864_100000078 | 3300005618 | Bacteria | 103622 |
| 166 | Ga0068861_100067243 | 3300005719 | Bacteria | 2765 |
| 167 | Ga0068851_10019700 | 3300005834 | Bacteria | 3261 |
| 168 | Ga0068851_10021255 | 3300005834 | Bacteria | 3151 |
| 169 | Ga0068870_10010469 | 3300005840 | Bacteria | 4266 |
| 170 | Ga0068863_100000019 | 3300005841 | Bacteria | 205585 |
| 171 | Ga0068863_100001062 | 3300005841 | Bacteria | 27480 |
| 172 | Ga0068863_100014482 | 3300005841 | Bacteria | 7594 |
| 173 | Ga0068858_100000832 | 3300005842 | Bacteria | 32118 |
| 174 | Ga0068858_100183903 | 3300005842 | Bacteria | 1974 |
| 175 | Ga0068860_100051125 | 3300005843 | Bacteria | 3932 |
| 176 | Ga0068862_100000844 | 3300005844 | Bacteria | 30147 |
| 177 | Ga0068862_100082384 | 3300005844 | Bacteria | 2792 |
| 178 | Ga0081540_1023946 | 3300005983 | Bacteria | 3555 |
| 179 | Ga0081539_10004451 | 3300005985 | Bacteria | 15469 |
| 180 | Ga0075367_10088788 | 3300006178 | Bacteria | 1879 |
| 181 | Ga0075369_10013722 | 3300006186 | Bacteria | 3223 |
| 182 | Ga0075366_10009173 | 3300006195 | Bacteria | 5516 |
| 183 | Ga0097621_100109868 | 3300006237 | Bacteria | 2329 |
| 184 | Ga0097621_100111656 | 3300006237 | Bacteria | 2310 |
| 185 | Ga0068871_100026443 | 3300006358 | Bacteria | 4528 |
| 186 | Ga0075431_100020241 | 3300006847 | Bacteria | 6797 |
| 187 | Ga0075433_10058341 | 3300006852 | Bacteria | 3376 |
| 188 | Ga0075433_10104124 | 3300006852 | Bacteria | 2514 |
| 189 | Ga0075434_100002845 | 3300006871 | Bacteria | 15342 |
| 190 | Ga0075434_100002906 | 3300006871 | Bacteria | 15211 |
| 191 | Ga0075436_100028303 | 3300006914 | Bacteria | 3855 |
| 192 | Ga0097620_100004108 | 3300006931 | Bacteria | 14849 |
| 193 | Ga0079104_1006894 | 3300006946 | Bacteria | 4204 |
| 194 | Ga0105251_10000074 | 3300009011 | Bacteria | 95770 |
| 195 | Ga0105240_10000941 | 3300009093 | Bacteria | 51739 |
| 196 | Ga0105240_10001400 | 3300009093 | Bacteria | 41411 |
| 197 | Ga0105240_10011719 | 3300009093 | Bacteria | 12182 |
| 198 | Ga0105240_10211115 | 3300009093 | Bacteria | 2269 |
| 199 | Ga0111539_10150332 | 3300009094 | Bacteria | 2726 |
| 200 | Ga0105247_10037821 | 3300009101 | Bacteria | 2944 |
| 201 | Ga0105243_10000732 | 3300009148 | Bacteria | 31470 |
| 202 | Ga0105243_10059132 | 3300009148 | Bacteria | 3058 |
| 203 | Ga0105242_10000382 | 3300009176 | Bacteria | 35202 |
| 204 | Ga0105242_10002152 | 3300009176 | Bacteria | 15554 |
| 205 | Ga0105248_10000317 | 3300009177 | Bacteria | 57281 |
| 206 | Ga0105248_10001415 | 3300009177 | Bacteria | 26820 |
| 207 | Ga0105248_10008933 | 3300009177 | Bacteria | 11019 |
| 208 | Ga0105248_10009400 | 3300009177 | Bacteria | 10763 |
| 209 | Ga0105248_10010064 | 3300009177 | Bacteria | 10416 |
| 210 | Ga0105248_10062240 | 3300009177 | Bacteria | 4191 |
| 211 | Ga0105248_10117134 | 3300009177 | Bacteria | 3004 |
| 212 | Ga0105248_10168388 | 3300009177 | Bacteria | 2469 |
| 213 | Ga0105237_10000214 | 3300009545 | Bacteria | 82061 |
| 214 | Ga0105237_10003030 | 3300009545 | Bacteria | 20266 |
| 215 | Ga0105237_10009465 | 3300009545 | Bacteria | 10436 |
| 216 | Ga0105238_10004212 | 3300009551 | Bacteria | 14284 |
| 217 | Ga0105238_10015966 | 3300009551 | Bacteria | 7598 |
| 218 | Ga0105238_10026059 | 3300009551 | Bacteria | 5959 |
| 219 | Ga0105249_10101887 | 3300009553 | Bacteria | 2701 |
| 220 | Ga0105239_10000390 | 3300010375 | Bacteria | 64410 |
| 221 | Ga0105239_10003689 | 3300010375 | Bacteria | 18664 |
| 222 | Ga0105239_10009141 | 3300010375 | Bacteria | 11209 |
| 223 | Ga0105239_10050557 | 3300010375 | Bacteria | 4559 |
| 224 | Ga0105239_10054999 | 3300010375 | Bacteria | 4365 |
| 225 | Ga0105239_10064857 | 3300010375 | Bacteria | 4010 |
| 226 | Ga0157314_1000074 | 3300012500 | Bacteria | 10533 |
| 227 | Ga0157347_1000018 | 3300012502 | Bacteria | 6171 |
| 228 | Ga0157373_10004665 | 3300013100 | Bacteria | 10314 |
| 229 | Ga0157371_10000372 | 3300013102 | Bacteria | 56552 |
| 230 | Ga0157371_10029539 | 3300013102 | Bacteria | 3962 |
| 231 | Ga0157371_10100455 | 3300013102 | Bacteria | 2052 |
| 232 | Ga0157370_10000586 | 3300013104 | Bacteria | 45426 |
| 233 | Ga0157370_10002097 | 3300013104 | Bacteria | 24354 |
| 234 | Ga0157370_10011830 | 3300013104 | Bacteria | 9105 |
| 235 | Ga0157370_10019302 | 3300013104 | Bacteria | 6842 |
| 236 | Ga0157370_10058393 | 3300013104 | Bacteria | 3667 |
| 237 | Ga0157369_10000172 | 3300013105 | Bacteria | 90979 |
| 238 | Ga0157378_10020708 | 3300013297 | Bacteria | 5784 |
| 239 | Ga0163162_10005268 | 3300013306 | Bacteria | 12475 |
| 240 | Ga0157372_10001271 | 3300013307 | Bacteria | 27286 |
| 241 | Ga0157372_10022113 | 3300013307 | Bacteria | 6878 |
| 242 | Ga0157372_10047647 | 3300013307 | Bacteria | 4763 |
| 243 | Ga0157375_10000835 | 3300013308 | Bacteria | 26923 |
| 244 | Ga0157375_10010204 | 3300013308 | Bacteria | 8266 |
| 245 | Ga0157375_10022691 | 3300013308 | Bacteria | 5779 |
| 246 | Ga0157375_10057661 | 3300013308 | Bacteria | 3839 |
| 247 | Ga0157375_10097116 | 3300013308 | Bacteria | 3020 |
| 248 | Ga0157375_10124887 | 3300013308 | Bacteria | 2687 |
| 249 | Ga0163163_10000588 | 3300014325 | Bacteria | 32034 |
| 250 | Ga0157380_10091717 | 3300014326 | Bacteria | 2509 |
| 251 | Ga0157379_10004364 | 3300014968 | Bacteria | 12098 |
| 252 | Ga0157379_10069439 | 3300014968 | Bacteria | 3151 |
| 253 | Ga0157376_10001051 | 3300014969 | Bacteria | 18102 |
| 254 | Ga0182007_10000025 | 3300015262 | Bacteria | 172058 |
| 255 | Ga0182005_1000063 | 3300015265 | Bacteria | 97663 |
| 256 | Ga0182005_1002028 | 3300015265 | Bacteria | 7602 |
| 257 | Ga0183360_10002 | 3300015689 | Bacteria | 953821 |
| 258 | Ga0163161_10002498 | 3300017792 | Bacteria | 13119 |
| 259 | Ga0163161_10003580 | 3300017792 | Bacteria | 10884 |
| 260 | Ga0163161_10090228 | 3300017792 | Bacteria | 2268 |
| 261 | Ga0206354_10853913 | 3300020081 | Bacteria | 7774 |
| 262 | Ga0213875_10002677 | 3300021388 | Bacteria | 10515 |
| 263 | Ga0213875_10008468 | 3300021388 | Bacteria | 5270 |
| 264 | Ga0209436_102753 | 3300025208 | Bacteria | 5033 |
| 265 | Ga0209672_100220 | 3300025228 | Bacteria | 44241 |
| 266 | Ga0209672_101566 | 3300025228 | Bacteria | 7792 |
| 267 | Ga0209147_101094 | 3300025229 | Bacteria | 11326 |
| 268 | Ga0209258_100015 | 3300025242 | Bacteria | 706310 |
| 269 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 270 | Ga0207425_1000063 | 3300025245 | Bacteria | 134014 |
| 271 | Ga0207425_1000155 | 3300025245 | Bacteria | 58218 |
| 272 | Ga0207425_1000532 | 3300025245 | Bacteria | 23050 |
| 273 | Ga0209148_1000028 | 3300025254 | Bacteria | 582773 |
| 274 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 275 | Ga0209129_1000160 | 3300025258 | Bacteria | 102457 |
| 276 | Ga0209129_1000243 | 3300025258 | Bacteria | 58221 |
| 277 | Ga0209129_1001346 | 3300025258 | Bacteria | 13879 |
| 278 | Ga0209129_1008628 | 3300025258 | Bacteria | 2808 |
| 279 | Ga0209129_1011158 | 3300025258 | Bacteria | 2169 |
| 280 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 281 | Ga0209565_1002457 | 3300025263 | Bacteria | 6665 |
| 282 | Ga0209565_1003157 | 3300025263 | Bacteria | 5492 |
| 283 | Ga0209565_1006813 | 3300025263 | Bacteria | 3159 |
| 284 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 285 | Ga0209673_1003706 | 3300025273 | Bacteria | 8757 |
| 286 | Ga0209673_1010664 | 3300025273 | Bacteria | 3852 |
| 287 | Ga0209673_1015001 | 3300025273 | Bacteria | 2968 |
| 288 | Ga0209130_1000738 | 3300025284 | Bacteria | 28711 |
| 289 | Ga0209130_1001341 | 3300025284 | Bacteria | 16656 |
| 290 | Ga0209130_1008137 | 3300025284 | Bacteria | 3133 |
| 291 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 292 | Ga0209675_1001553 | 3300025291 | Bacteria | 13041 |
| 293 | Ga0209675_1010590 | 3300025291 | Bacteria | 3135 |
| 294 | Ga0209676_1000074 | 3300025292 | Bacteria | 305770 |
| 295 | Ga0209676_1000177 | 3300025292 | Bacteria | 151589 |
| 296 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 297 | Ga0209025_1001271 | 3300025294 | Bacteria | 34705 |
| 298 | Ga0209025_1005652 | 3300025294 | Bacteria | 10074 |
| 299 | Ga0209025_1015645 | 3300025294 | Bacteria | 4553 |
| 300 | Ga0209025_1016339 | 3300025294 | Bacteria | 4391 |
| 301 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 302 | Ga0209564_1000346 | 3300025295 | Bacteria | 87680 |
| 303 | Ga0209564_1003007 | 3300025295 | Bacteria | 12080 |
| 304 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 305 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 306 | Ga0209758_1000039 | 3300025297 | Bacteria | 428951 |
| 307 | Ga0209758_1000288 | 3300025297 | Bacteria | 99096 |
| 308 | Ga0209758_1000577 | 3300025297 | Bacteria | 57284 |
| 309 | Ga0209758_1028707 | 3300025297 | Bacteria | 2345 |
| 310 | Ga0209758_1030851 | 3300025297 | Bacteria | 2210 |
| 311 | Ga0209050_1000015 | 3300025298 | Bacteria | 759102 |
| 312 | Ga0209050_1000837 | 3300025298 | Bacteria | 42462 |
| 313 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 314 | Ga0209256_1000079 | 3300025299 | Bacteria | 225382 |
| 315 | Ga0209256_1000264 | 3300025299 | Bacteria | 92750 |
| 316 | Ga0209256_1003261 | 3300025299 | Bacteria | 11654 |
| 317 | Ga0207426_1000108 | 3300025302 | Bacteria | 242257 |
| 318 | Ga0207426_1000130 | 3300025302 | Bacteria | 210271 |
| 319 | Ga0207426_1017278 | 3300025302 | Bacteria | 2567 |
| 320 | Ga0209051_1000010 | 3300025303 | Bacteria | 641298 |
| 321 | Ga0209257_1000026 | 3300025304 | Bacteria | 723225 |
| 322 | Ga0209257_1000253 | 3300025304 | Bacteria | 123508 |
| 323 | Ga0209257_1010254 | 3300025304 | Bacteria | 4790 |
| 324 | Ga0207656_10005343 | 3300025321 | Bacteria | 4534 |
| 325 | Ga0207655_1030340 | 3300025728 | Bacteria | 2515 |
| 326 | Ga0207713_1000206 | 3300025735 | Bacteria | 80103 |
| 327 | Ga0207682_10028626 | 3300025893 | Bacteria | 2225 |
| 328 | Ga0207688_10004545 | 3300025901 | Bacteria | 7555 |
| 329 | Ga0207647_10003584 | 3300025904 | Bacteria | 11639 |
| 330 | Ga0207647_10003912 | 3300025904 | Bacteria | 11125 |
| 331 | Ga0207643_10014623 | 3300025908 | Bacteria | 4266 |
| 332 | Ga0207705_10000005 | 3300025909 | Bacteria | 673478 |
| 333 | Ga0207705_10000029 | 3300025909 | Bacteria | 239897 |
| 334 | Ga0207705_10000196 | 3300025909 | Bacteria | 61246 |
| 335 | Ga0207705_10000849 | 3300025909 | Bacteria | 25053 |
| 336 | Ga0207705_10012438 | 3300025909 | Bacteria | 6148 |
| 337 | Ga0207705_10042014 | 3300025909 | Bacteria | 3281 |
| 338 | Ga0207707_10000049 | 3300025912 | Bacteria | 117480 |
| 339 | Ga0207707_10000524 | 3300025912 | Bacteria | 39305 |
| 340 | Ga0207707_10005763 | 3300025912 | Bacteria | 10830 |
| 341 | Ga0207707_10010918 | 3300025912 | Bacteria | 7899 |
| 342 | Ga0207707_10013235 | 3300025912 | Bacteria | 7187 |
| 343 | Ga0207695_10001428 | 3300025913 | Bacteria | 40198 |
| 344 | Ga0207695_10003902 | 3300025913 | Bacteria | 20634 |
| 345 | Ga0207695_10005285 | 3300025913 | Bacteria | 17212 |
| 346 | Ga0207695_10023694 | 3300025913 | Bacteria | 6927 |
| 347 | Ga0207695_10034168 | 3300025913 | Bacteria | 5534 |
| 348 | Ga0207695_10057260 | 3300025913 | Bacteria | 4050 |
| 349 | Ga0207695_10117055 | 3300025913 | Bacteria | 2638 |
| 350 | Ga0207671_10000057 | 3300025914 | Bacteria | 183729 |
| 351 | Ga0207671_10000614 | 3300025914 | Bacteria | 47019 |
| 352 | Ga0207660_10000738 | 3300025917 | Bacteria | 21706 |
| 353 | Ga0207660_10000824 | 3300025917 | Bacteria | 20462 |
| 354 | Ga0207660_10002809 | 3300025917 | Bacteria | 11416 |
| 355 | Ga0207662_10010713 | 3300025918 | Bacteria | 5066 |
| 356 | Ga0207657_10000366 | 3300025919 | Bacteria | 47556 |
| 357 | Ga0207657_10001980 | 3300025919 | Bacteria | 22107 |
| 358 | Ga0207657_10010520 | 3300025919 | Bacteria | 9225 |
| 359 | Ga0207657_10011898 | 3300025919 | Bacteria | 8612 |
| 360 | Ga0207657_10017023 | 3300025919 | Bacteria | 6993 |
| 361 | Ga0207657_10089972 | 3300025919 | Bacteria | 2562 |
| 362 | Ga0207649_10001327 | 3300025920 | Bacteria | 14714 |
| 363 | Ga0207649_10019921 | 3300025920 | Bacteria | 3841 |
| 364 | Ga0207652_10000014 | 3300025921 | Bacteria | 196569 |
| 365 | Ga0207652_10002050 | 3300025921 | Bacteria | 17343 |
| 366 | Ga0207652_10007253 | 3300025921 | Bacteria | 8932 |
| 367 | Ga0207681_10008514 | 3300025923 | Bacteria | 6265 |
| 368 | Ga0207681_10026462 | 3300025923 | Bacteria | 3742 |
| 369 | Ga0207694_10000389 | 3300025924 | Bacteria | 40956 |
| 370 | Ga0207694_10092007 | 3300025924 | Bacteria | 2394 |
| 371 | Ga0207650_10003825 | 3300025925 | Bacteria | 10294 |
| 372 | Ga0207650_10010658 | 3300025925 | Bacteria | 6313 |
| 373 | Ga0207650_10026087 | 3300025925 | Bacteria | 4166 |
| 374 | Ga0207650_10062203 | 3300025925 | Bacteria | 2789 |
| 375 | Ga0207659_10000922 | 3300025926 | Bacteria | 17511 |
| 376 | Ga0207644_10000863 | 3300025931 | Bacteria | 19167 |
| 377 | Ga0207644_10014665 | 3300025931 | Bacteria | 5250 |
| 378 | Ga0207644_10079406 | 3300025931 | Bacteria | 2421 |
| 379 | Ga0207644_10126707 | 3300025931 | Bacteria | 1950 |
| 380 | Ga0207690_10004132 | 3300025932 | Bacteria | 8576 |
| 381 | Ga0207690_10005618 | 3300025932 | Bacteria | 7410 |
| 382 | Ga0207690_10059620 | 3300025932 | Bacteria | 2586 |
| 383 | Ga0207706_10009357 | 3300025933 | Bacteria | 8996 |
| 384 | Ga0207706_10013061 | 3300025933 | Bacteria | 7557 |
| 385 | Ga0207706_10028226 | 3300025933 | Bacteria | 5013 |
| 386 | Ga0207706_10031994 | 3300025933 | Bacteria | 4686 |
| 387 | Ga0207706_10079758 | 3300025933 | Bacteria | 2878 |
| 388 | Ga0207706_10092126 | 3300025933 | Bacteria | 2665 |
| 389 | Ga0207706_10138186 | 3300025933 | Bacteria | 2144 |
| 390 | Ga0207686_10018261 | 3300025934 | Bacteria | 3969 |
| 391 | Ga0207709_10002739 | 3300025935 | Bacteria | 10871 |
| 392 | Ga0207709_10006002 | 3300025935 | Bacteria | 6846 |
| 393 | Ga0207691_10003686 | 3300025940 | Bacteria | 14861 |
| 394 | Ga0207691_10003724 | 3300025940 | Bacteria | 14795 |
| 395 | Ga0207691_10005219 | 3300025940 | Bacteria | 12537 |
| 396 | Ga0207691_10010329 | 3300025940 | Bacteria | 8955 |
| 397 | Ga0207691_10050073 | 3300025940 | Bacteria | 3825 |
| 398 | Ga0207711_10000042 | 3300025941 | Bacteria | 158782 |
| 399 | Ga0207711_10001192 | 3300025941 | Bacteria | 24642 |
| 400 | Ga0207711_10005184 | 3300025941 | Bacteria | 11040 |
| 401 | Ga0207711_10024256 | 3300025941 | Bacteria | 5078 |
| 402 | Ga0207711_10080795 | 3300025941 | Bacteria | 2840 |
| 403 | Ga0207689_10046569 | 3300025942 | Bacteria | 3584 |
| 404 | Ga0207679_10022572 | 3300025945 | Bacteria | 4288 |
| 405 | Ga0207667_10000075 | 3300025949 | Bacteria | 169836 |
| 406 | Ga0207667_10000139 | 3300025949 | Bacteria | 109949 |
| 407 | Ga0207667_10000247 | 3300025949 | Bacteria | 76307 |
| 408 | Ga0207667_10002560 | 3300025949 | Bacteria | 22615 |
| 409 | Ga0207667_10005407 | 3300025949 | Bacteria | 15575 |
| 410 | Ga0207667_10019569 | 3300025949 | Bacteria | 7552 |
| 411 | Ga0207651_10010407 | 3300025960 | Bacteria | 5156 |
| 412 | Ga0207651_10015296 | 3300025960 | Bacteria | 4455 |
| 413 | Ga0207712_10000774 | 3300025961 | Bacteria | 23834 |
| 414 | Ga0207712_10036576 | 3300025961 | Bacteria | 3345 |
| 415 | Ga0207668_10001836 | 3300025972 | Bacteria | 12384 |
| 416 | Ga0207668_10021703 | 3300025972 | Bacteria | 4098 |
| 417 | Ga0207668_10032494 | 3300025972 | Bacteria | 3449 |
| 418 | Ga0207668_10062228 | 3300025972 | Bacteria | 2627 |
| 419 | Ga0207640_10000072 | 3300025981 | Bacteria | 80118 |
| 420 | Ga0207640_10002140 | 3300025981 | Bacteria | 10613 |
| 421 | Ga0207658_10000129 | 3300025986 | Bacteria | 81988 |
| 422 | Ga0207658_10015261 | 3300025986 | Bacteria | 5270 |
| 423 | Ga0207658_10033655 | 3300025986 | Bacteria | 3657 |
| 424 | Ga0207658_10059774 | 3300025986 | Bacteria | 2841 |
| 425 | Ga0207658_10072704 | 3300025986 | Bacteria | 2608 |
| 426 | Ga0207677_10013281 | 3300026023 | Bacteria | 4766 |
| 427 | Ga0207703_10000562 | 3300026035 | Bacteria | 38153 |
| 428 | Ga0207703_10001651 | 3300026035 | Bacteria | 20064 |
| 429 | Ga0207703_10001950 | 3300026035 | Bacteria | 18229 |
| 430 | Ga0207703_10142838 | 3300026035 | Bacteria | 2079 |
| 431 | Ga0207639_10000690 | 3300026041 | Bacteria | 23246 |
| 432 | Ga0207639_10000761 | 3300026041 | Bacteria | 21962 |
| 433 | Ga0207639_10003326 | 3300026041 | Bacteria | 10822 |
| 434 | Ga0207639_10014100 | 3300026041 | Bacteria | 5612 |
| 435 | Ga0207639_10030370 | 3300026041 | Bacteria | 3962 |
| 436 | Ga0207639_10033443 | 3300026041 | Bacteria | 3794 |
| 437 | Ga0207639_10046819 | 3300026041 | Bacteria | 3265 |
| 438 | Ga0207678_10000915 | 3300026067 | Bacteria | 27002 |
| 439 | Ga0207678_10003168 | 3300026067 | Bacteria | 14872 |
| 440 | Ga0207678_10007726 | 3300026067 | Bacteria | 9500 |
| 441 | Ga0207678_10008551 | 3300026067 | Bacteria | 9017 |
| 442 | Ga0207678_10008759 | 3300026067 | Bacteria | 8903 |
| 443 | Ga0207678_10009736 | 3300026067 | Bacteria | 8450 |
| 444 | Ga0207678_10014318 | 3300026067 | Bacteria | 6973 |
| 445 | Ga0207678_10038194 | 3300026067 | Bacteria | 4173 |
| 446 | Ga0207678_10040977 | 3300026067 | Bacteria | 4015 |
| 447 | Ga0207702_10020699 | 3300026078 | Bacteria | 5442 |
| 448 | Ga0207702_10050438 | 3300026078 | Bacteria | 3514 |
| 449 | Ga0207641_10000005 | 3300026088 | Bacteria | 470841 |
| 450 | Ga0207641_10000444 | 3300026088 | Bacteria | 47425 |
| 451 | Ga0207641_10055895 | 3300026088 | Bacteria | 3352 |
| 452 | Ga0207648_10004770 | 3300026089 | Bacteria | 13848 |
| 453 | Ga0207648_10007362 | 3300026089 | Bacteria | 10838 |
| 454 | Ga0207648_10010683 | 3300026089 | Bacteria | 8678 |
| 455 | Ga0207676_10000130 | 3300026095 | Bacteria | 66147 |
| 456 | Ga0207676_10000740 | 3300026095 | Bacteria | 25562 |
| 457 | Ga0207676_10047631 | 3300026095 | Bacteria | 3323 |
| 458 | Ga0207674_10000371 | 3300026116 | Bacteria | 58464 |
| 459 | Ga0207674_10000895 | 3300026116 | Bacteria | 38947 |
| 460 | Ga0207674_10003700 | 3300026116 | Bacteria | 18670 |
| 461 | Ga0207674_10004005 | 3300026116 | Bacteria | 17891 |
| 462 | Ga0207674_10010501 | 3300026116 | Bacteria | 10481 |
| 463 | Ga0207674_10014423 | 3300026116 | Bacteria | 8730 |
| 464 | Ga0207674_10028341 | 3300026116 | Bacteria | 5912 |
| 465 | Ga0207674_10097984 | 3300026116 | Bacteria | 2916 |
| 466 | Ga0207675_100079459 | 3300026118 | Bacteria | 3074 |
| 467 | Ga0207683_10012138 | 3300026121 | Bacteria | 7356 |
| 468 | Ga0207683_10147012 | 3300026121 | Bacteria | 2126 |
| 469 | Ga0207698_10012712 | 3300026142 | Bacteria | 5522 |
| 470 | Ga0209371_1000048 | 3300027312 | Bacteria | 281705 |
| 471 | Ga0209998_10000544 | 3300027717 | Bacteria | 10177 |
| 472 | Ga0209974_10005851 | 3300027876 | Bacteria | 4312 |
| 473 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 474 | Ga0268266_10058815 | 3300028379 | Bacteria | 3310 |
| 475 | Ga0268265_10000478 | 3300028380 | Bacteria | 42016 |
| 476 | Ga0268265_10005151 | 3300028380 | Bacteria | 8954 |
| 477 | Ga0268265_10005187 | 3300028380 | Bacteria | 8927 |
| 478 | Ga0268265_10033487 | 3300028380 | Bacteria | 3736 |
| 479 | Ga0268265_10055897 | 3300028380 | Bacteria | 3000 |
| 480 | Ga0268265_10071851 | 3300028380 | Bacteria | 2697 |
| 481 | Ga0268264_10004535 | 3300028381 | Bacteria | 11838 |
| 482 | Ga0268264_10015987 | 3300028381 | Bacteria | 6148 |
| 483 | Ga0268264_10034303 | 3300028381 | Bacteria | 4173 |
| 484 | Ga0268264_10035202 | 3300028381 | Bacteria | 4122 |
| 485 | Ga0268264_10049864 | 3300028381 | Bacteria | 3484 |
| 486 | Ga0307515_10132353 | 3300028794 | Bacteria | 2737 |
| 487 | Ga0268256_1000049 | 3300030500 | Bacteria | 307229 |
| 488 | Ga0265332_10010267 | 3300031238 | Bacteria | 4168 |
| 489 | Ga0265327_10018116 | 3300031251 | Bacteria | 4380 |
| 490 | Ga0307408_100000462 | 3300031548 | Bacteria | 35587 |
| 491 | Ga0307408_100108699 | 3300031548 | Bacteria | 2126 |
| 492 | Ga0307405_10004388 | 3300031731 | Bacteria | 6662 |
| 493 | Ga0307405_10008078 | 3300031731 | Bacteria | 5311 |
| 494 | Ga0307405_10008990 | 3300031731 | Bacteria | 5100 |
| 495 | Ga0307413_10000510 | 3300031824 | Bacteria | 12804 |
| 496 | Ga0307413_10002495 | 3300031824 | Bacteria | 7501 |
| 497 | Ga0307413_10024198 | 3300031824 | Bacteria | 3307 |
| 498 | Ga0307413_10058263 | 3300031824 | Bacteria | 2367 |
| 499 | Ga0307410_10001464 | 3300031852 | Bacteria | 10671 |
| 500 | Ga0307410_10002763 | 3300031852 | Bacteria | 8580 |
| 501 | Ga0307410_10015868 | 3300031852 | Bacteria | 4477 |
| 502 | Ga0307410_10024283 | 3300031852 | Bacteria | 3785 |
| 503 | Ga0307410_10070532 | 3300031852 | Bacteria | 2421 |
| 504 | Ga0307410_10071278 | 3300031852 | Bacteria | 2409 |
| 505 | Ga0307406_10009693 | 3300031901 | Bacteria | 5415 |
| 506 | Ga0307406_10014720 | 3300031901 | Bacteria | 4506 |
| 507 | Ga0307406_10022466 | 3300031901 | Bacteria | 3743 |
| 508 | Ga0307407_10022510 | 3300031903 | Bacteria | 3271 |
| 509 | Ga0307412_10002004 | 3300031911 | Bacteria | 11292 |
| 510 | Ga0307412_10013564 | 3300031911 | Bacteria | 4782 |
| 511 | Ga0307412_10024666 | 3300031911 | Bacteria | 3714 |
| 512 | Ga0307412_10098041 | 3300031911 | Bacteria | 2066 |
| 513 | Ga0307409_100000754 | 3300031995 | Bacteria | 14606 |
| 514 | Ga0307409_100013543 | 3300031995 | Bacteria | 5255 |
| 515 | Ga0307409_100018441 | 3300031995 | Bacteria | 4693 |
| 516 | Ga0307409_100020069 | 3300031995 | Bacteria | 4545 |
| 517 | Ga0307409_100036398 | 3300031995 | Bacteria | 3617 |
| 518 | Ga0307416_100015686 | 3300032002 | Bacteria | 5241 |
| 519 | Ga0307416_100021152 | 3300032002 | Bacteria | 4663 |
| 520 | Ga0307416_100022048 | 3300032002 | Bacteria | 4587 |
| 521 | Ga0307416_100032175 | 3300032002 | Bacteria | 3959 |
| 522 | Ga0307416_100041909 | 3300032002 | Bacteria | 3569 |
| 523 | Ga0307416_100060889 | 3300032002 | Bacteria | 3077 |
| 524 | Ga0307416_100130868 | 3300032002 | Bacteria | 2258 |
| 525 | Ga0307414_10003324 | 3300032004 | Bacteria | 8582 |
| 526 | Ga0307414_10006918 | 3300032004 | Bacteria | 6353 |
| 527 | Ga0307414_10094021 | 3300032004 | Bacteria | 2236 |
| 528 | Ga0307411_10001415 | 3300032005 | Bacteria | 9767 |
| 529 | Ga0307411_10047603 | 3300032005 | Bacteria | 2773 |
| 530 | Ga0307411_10058834 | 3300032005 | Bacteria | 2545 |
| 531 | Ga0307411_10078997 | 3300032005 | Bacteria | 2257 |
| 532 | Ga0307415_100006829 | 3300032126 | Bacteria | 6192 |
| 533 | Ga0307415_100014221 | 3300032126 | Bacteria | 4670 |
| 534 | Ga0307415_100047237 | 3300032126 | Bacteria | 2897 |
| 535 | Ga0307415_100049359 | 3300032126 | Bacteria | 2845 |
| 536 | Ga0307507_10080766 | 3300033179 | Bacteria | 2865 |
| 537 | Ga0373943_0025424 | 3300035170 | Bacteria | 2767 |
| 538 | Ga0395899_0007347 | 3300037312 | Bacteria | 8521 |
| 539 | Ga0395899_0012121 | 3300037312 | Bacteria | 6601 |
| 540 | Ga0395899_0046053 | 3300037312 | Bacteria | 3249 |
| 541 | Ga0395899_0052209 | 3300037312 | Bacteria | 3031 |
| 542 | Ga0395900_0021165 | 3300037418 | Bacteria | 6647 |
| 543 | Ga0395900_0098541 | 3300037418 | Bacteria | 3003 |
| 544 | Ga0395898_0050322 | 3300037466 | Bacteria | 4078 |
| 545 | Ga0395898_0060432 | 3300037466 | Bacteria | 3683 |
| 546 | Ga0436364_0152495 | 3300037853 | Bacteria | 7015 |
| 547 | Ga0436364_0612163 | 3300037853 | Bacteria | 25384 |
| 548 | Ga0395901_0002260 | 3300038443 | Bacteria | 19658 |
| 549 | Ga0395901_0007279 | 3300038443 | Bacteria | 11168 |
| 550 | Ga0395901_0026730 | 3300038443 | Bacteria | 5925 |
| 551 | Ga0395901_0094401 | 3300038443 | Bacteria | 3133 |
| 552 | Ga0395901_0109496 | 3300038443 | Bacteria | 2900 |
| 553 | Ga0237819_00083 | 3300038705 | Bacteria | 34456 |
| 554 | Ga0436363_0082884 | 3300039450 | Bacteria | 3186 |
| 555 | Ga0439439_0007991 | 3300041406 | Bacteria | 2487 |
| 556 | Ga0439447_004314 | 3300041407 | Bacteria | 4925 |
| 557 | Ga0439433_0003763 | 3300041999 | Bacteria | 3260 |
| 558 | Ga0439449_0005388 | 3300042007 | Bacteria | 4903 |
| 559 | Ga0439449_0016059 | 3300042007 | Bacteria | 2815 |
| 560 | Ga0450912_000740 | 3300042116 | Bacteria | 1757 |
| 561 | Ga0450905_001664 | 3300042142 | Bacteria | 2836 |
| 562 | Ga0450889_000099 | 3300042144 | Bacteria | 8306 |
| 563 | Ga0439464_0000736 | 3300042439 | Bacteria | 7119 |
| 564 | Ga0451577_0001431 | 3300042876 | Bacteria | 31788 |
| 565 | Ga0466972_0009675 | 3300044658 | Bacteria | 4837 |
| 566 | Ga0466972_0038923 | 3300044658 | Bacteria | 2322 |
| 567 | Ga0466982_0000005 | 3300044672 | Bacteria | 364340 |
| 568 | Ga0453683_0004013 | 3300044673 | Bacteria | 10620 |
| 569 | Ga0466966_0002290 | 3300044684 | Bacteria | 12475 |
| 570 | Ga0466963_0027502 | 3300044694 | Bacteria | 3643 |
| 571 | Ga0453684_0000104 | 3300044712 | Bacteria | 365431 |
| 572 | Ga0466971_0019335 | 3300044719 | Bacteria | 3024 |
| 573 | Ga0466968_0029618 | 3300044735 | Bacteria | 2264 |
| 574 | Ga0466970_0004188 | 3300044765 | Bacteria | 7094 |
| 575 | Ga0466959_0034410 | 3300045049 | Bacteria | 3747 |
| 576 | Ga0451576_0000024 | 3300045051 | Bacteria | 470499 |
| 577 | Ga0451576_0007494 | 3300045051 | Bacteria | 13021 |
| 578 | Ga0495590_0001372 | 3300046457 | Bacteria | 10587 |
| 579 | Ga0495638_0000206 | 3300046460 | Bacteria | 83841 |
| 580 | Ga0495638_0000601 | 3300046460 | Bacteria | 40489 |
| 581 | Ga0495638_0000718 | 3300046460 | Bacteria | 35732 |
| 582 | Ga0495638_0004955 | 3300046460 | Bacteria | 9998 |
| 583 | Ga0495638_0013378 | 3300046460 | Bacteria | 5587 |
| 584 | Ga0495650_0000206 | 3300046471 | Bacteria | 127713 |
| 585 | Ga0495616_0000172 | 3300046513 | Bacteria | 54960 |
| 586 | Ga0495616_0000301 | 3300046513 | Bacteria | 39844 |
| 587 | Ga0495631_0000050 | 3300046518 | Bacteria | 71875 |
| 588 | Ga0495631_0001386 | 3300046518 | Bacteria | 14723 |
| 589 | Ga0495637_0006734 | 3300046520 | Bacteria | 5751 |
| 590 | Ga0495637_0012745 | 3300046520 | Bacteria | 4012 |
| 591 | Ga0495648_0000067 | 3300046524 | Bacteria | 140250 |
| 592 | Ga0495663_0000603 | 3300046525 | Bacteria | 12535 |
| 593 | Ga0495622_0000044 | 3300046557 | Bacteria | 115528 |
| 594 | Ga0495633_0006549 | 3300046558 | Bacteria | 6882 |
| 595 | Ga0495668_0000364 | 3300046616 | Bacteria | 59836 |
| 596 | Ga0495625_0013179 | 3300046660 | Bacteria | 6659 |
| 597 | Ga0495670_0052015 | 3300046691 | Bacteria | 2050 |
| 598 | Ga0495671_0012049 | 3300046692 | Bacteria | 4729 |
| 599 | Ga0495649_0000930 | 3300046694 | Bacteria | 23188 |
| 600 | Ga0495581_0021648 | 3300047315 | Bacteria | 3725 |
| 601 | Ga0495676_0028418 | 3300047321 | Bacteria | 4775 |
| 602 | Ga0495673_0000549 | 3300047469 | Bacteria | 38306 |
| 603 | Ga0495686_0000023 | 3300047472 | Bacteria | 400457 |
| 604 | Ga0495686_0010453 | 3300047472 | Bacteria | 6601 |
| 605 | Ga0495686_0025056 | 3300047472 | Bacteria | 3913 |
| 606 | Ga0495626_0021808 | 3300048091 | Bacteria | 3171 |
| 607 | Ga0496101_0048381 | 3300048904 | Bacteria | 3056 |
| 608 | Ga0496104_0000038 | 3300048907 | Bacteria | 178150 |
| 609 | Ga0496104_0037457 | 3300048907 | Bacteria | 4536 |
| 610 | Ga0496105_0000038 | 3300048908 | Bacteria | 118666 |
| 611 | Ga0496105_0013613 | 3300048908 | Bacteria | 6459 |
| 612 | Ga0496108_0029449 | 3300048911 | Bacteria | 4547 |
| 613 | Ga0496110_0000948 | 3300048913 | Bacteria | 20317 |
| 614 | Ga0496111_0011178 | 3300048914 | Bacteria | 6041 |
| 615 | Ga0496111_0013573 | 3300048914 | Bacteria | 5547 |
| 616 | Ga0496112_0034335 | 3300048915 | Bacteria | 4936 |
| 617 | Ga0496113_0012663 | 3300048916 | Bacteria | 5677 |
| 618 | Ga0496114_0009311 | 3300048917 | Bacteria | 7795 |
| 619 | Ga0496115_0002382 | 3300048918 | Bacteria | 13482 |
| 620 | Ga0496115_0021889 | 3300048918 | Bacteria | 4943 |
| 621 | Ga0496116_0044648 | 3300048919 | Bacteria | 3008 |
| 622 | Ga0496117_0000483 | 3300048920 | Bacteria | 66226 |
| 623 | Ga0496117_0003418 | 3300048920 | Bacteria | 18468 |
| 624 | Ga0496117_0027503 | 3300048920 | Bacteria | 4431 |
| 625 | Ga0496117_0035931 | 3300048920 | Bacteria | 3714 |
| 626 | Ga0496118_0000520 | 3300048921 | Bacteria | 63206 |
| 627 | Ga0496118_0000926 | 3300048921 | Bacteria | 45829 |
| 628 | Ga0496118_0001750 | 3300048921 | Bacteria | 31523 |
| 629 | Ga0496118_0002749 | 3300048921 | Bacteria | 23099 |
| 630 | Ga0496118_0012543 | 3300048921 | Bacteria | 8122 |
| 631 | Ga0496118_0046124 | 3300048921 | Bacteria | 3394 |
| 632 | Ga0496119_0000165 | 3300048922 | Bacteria | 92447 |
| 633 | Ga0496119_0002323 | 3300048922 | Bacteria | 20945 |
| 634 | Ga0496119_0005152 | 3300048922 | Bacteria | 12652 |
| 635 | Ga0496119_0014423 | 3300048922 | Bacteria | 6187 |
| 636 | Ga0496120_0000054 | 3300048923 | Bacteria | 181170 |
| 637 | Ga0496120_0000200 | 3300048923 | Bacteria | 103100 |
| 638 | Ga0496120_0001064 | 3300048923 | Bacteria | 36264 |
| 639 | Ga0496120_0002498 | 3300048923 | Bacteria | 18457 |
| 640 | Ga0496121_0000364 | 3300048924 | Bacteria | 92919 |
| 641 | Ga0496121_0007588 | 3300048924 | Bacteria | 13061 |
| 642 | Ga0496121_0015077 | 3300048924 | Bacteria | 8133 |
| 643 | Ga0496121_0064656 | 3300048924 | Bacteria | 2981 |
| 644 | Ga0496121_0078524 | 3300048924 | Bacteria | 2623 |
| 645 | Ga0496122_0000671 | 3300048925 | Bacteria | 68810 |
| 646 | Ga0496122_0002256 | 3300048925 | Bacteria | 27891 |
| 647 | Ga0496122_0006807 | 3300048925 | Bacteria | 12980 |
| 648 | Ga0496123_0000489 | 3300048926 | Bacteria | 68892 |
| 649 | Ga0496123_0008369 | 3300048926 | Bacteria | 9513 |
| 650 | Ga0496123_0010473 | 3300048926 | Bacteria | 8192 |
| 651 | Ga0496124_0000345 | 3300048927 | Bacteria | 85004 |
| 652 | Ga0496124_0005789 | 3300048927 | Bacteria | 13748 |
| 653 | Ga0496125_0000750 | 3300048928 | Bacteria | 53532 |
| 654 | Ga0496125_0003859 | 3300048928 | Bacteria | 17767 |
| 655 | Ga0496125_0013426 | 3300048928 | Bacteria | 8052 |
| 656 | Ga0496126_0000206 | 3300048929 | Bacteria | 132028 |
| 657 | Ga0496126_0000546 | 3300048929 | Bacteria | 72601 |
| 658 | Ga0501032_0089521 | 3300049569 | Bacteria | 2043 |
| 659 | Ga0501033_0008867 | 3300049570 | Bacteria | 7768 |
| 660 | Ga0501034_0004271 | 3300049571 | Bacteria | 15941 |
| 661 | Ga0501036_0042889 | 3300049572 | Bacteria | 3830 |
| 662 | Ga0501037_0013659 | 3300049573 | Bacteria | 5983 |
| 663 | Ga0501037_0083405 | 3300049573 | Bacteria | 2315 |
| 664 | Ga0501043_0090753 | 3300049579 | Bacteria | 2402 |
| 665 | Ga0501043_0116103 | 3300049579 | Bacteria | 2101 |
| 666 | Ga0501046_0018913 | 3300049580 | Bacteria | 5721 |
| 667 | Ga0501047_0003771 | 3300049581 | Bacteria | 14266 |
| 668 | Ga0501047_0036233 | 3300049581 | Bacteria | 4767 |
| 669 | Ga0501047_0046602 | 3300049581 | Bacteria | 4189 |
| 670 | Ga0501047_0083596 | 3300049581 | Bacteria | 3068 |
| 671 | Ga0501048_0069771 | 3300049582 | Bacteria | 2482 |
| 672 | Ga0501069_0043029 | 3300049585 | Bacteria | 2499 |
| 673 | Ga0501069_0043961 | 3300049585 | Bacteria | 2472 |
| 674 | Ga0501070_0015429 | 3300049586 | Bacteria | 6426 |
| 675 | Ga0501070_0018521 | 3300049586 | Bacteria | 5841 |
| 676 | Ga0501070_0024174 | 3300049586 | Bacteria | 5095 |
| 677 | Ga0501073_0008538 | 3300049589 | Bacteria | 7595 |
| 678 | Ga0501074_0005391 | 3300049590 | Bacteria | 9204 |
| 679 | Ga0501077_0027870 | 3300049593 | Bacteria | 3588 |
| 680 | Ga0501216_000726 | 3300049660 | Bacteria | 4079 |
| 681 | Ga0501224_000663 | 3300049664 | Bacteria | 4278 |
| 682 | Ga0501235_000096 | 3300049669 | Bacteria | 13888 |
| 683 | Ga0501257_001050 | 3300049686 | Bacteria | 5576 |
| 684 | Ga0501259_001080 | 3300049688 | Bacteria | 4553 |
| 685 | Ga0501221_001782 | 3300049704 | Bacteria | 3593 |
| 686 | Ga0501225_0008487 | 3300049705 | Bacteria | 2946 |
| 687 | Ga0501234_000510 | 3300049707 | Bacteria | 5955 |
| 688 | Ga0501080_0019485 | 3300049742 | Bacteria | 6283 |
| 689 | Ga0501080_0043854 | 3300049742 | Bacteria | 4165 |
| 690 | Ga0501080_0099775 | 3300049742 | Bacteria | 2694 |
| 691 | Ga0501266_001456 | 3300049763 | Bacteria | 3017 |
| 692 | Ga0501268_000561 | 3300049765 | Bacteria | 4108 |
| 693 | Ga0501035_0074178 | 3300049822 | Bacteria | 3010 |
| 694 | Ga0501044_0007417 | 3300049823 | Bacteria | 12064 |
| 695 | Ga0501044_0036767 | 3300049823 | Bacteria | 5121 |
| 696 | Ga0501044_0070035 | 3300049823 | Bacteria | 3569 |
| 697 | Ga0501044_0118210 | 3300049823 | Bacteria | 2654 |
| 698 | nmdc:mga0k408_43360_c1 | 3300050493 | Bacteria | 2592 |
| 699 | nmdc:mga07m45_21539_c1 | 3300050496 | Bacteria | 3511 |
| 700 | nmdc:mga0n895_2035_c1 | 3300050512 | Bacteria | 15557 |
| 701 | nmdc:mga0a205_17506_c1 | 3300050515 | Bacteria | 6721 |
| 702 | nmdc:mga0a205_44533_c2 | 3300050515 | Bacteria | 3376 |
| 703 | Ga0500643_006841 | 3300053087 | Bacteria | 4698 |
| 704 | Ga0500643_009148 | 3300053087 | Bacteria | 3811 |
| 705 | Ga0500644_0000166 | 3300053088 | Bacteria | 41856 |
| 706 | Ga0500644_0033251 | 3300053088 | Bacteria | 1654 |
| 707 | Ga0500651_0000162 | 3300053093 | Bacteria | 43090 |
| 708 | Ga0500562_005788 | 3300053108 | Bacteria | 3112 |
| 709 | Ga0500569_004372 | 3300053109 | Bacteria | 2965 |
| 710 | Ga0500571_000042 | 3300053110 | Bacteria | 39585 |
| 711 | Ga0500593_001127 | 3300053117 | Bacteria | 9623 |
| 712 | Ga0500597_001835 | 3300053120 | Bacteria | 5623 |
| 713 | Ga0500607_002840 | 3300053121 | Bacteria | 13383 |
| 714 | Ga0500655_005137 | 3300053133 | Bacteria | 2359 |
| 715 | Ga0500658_0000483 | 3300053134 | Bacteria | 17057 |
| 716 | Ga0500658_0006589 | 3300053134 | Bacteria | 4307 |
| 717 | Ga0500559_0006208 | 3300053136 | Bacteria | 5410 |
| 718 | Ga0500559_0013482 | 3300053136 | Bacteria | 3462 |
| 719 | Ga0500564_000316 | 3300053138 | Bacteria | 13593 |
| 720 | Ga0500564_024076 | 3300053138 | Bacteria | 2793 |
| 721 | Ga0500568_0003294 | 3300053139 | Bacteria | 9108 |
| 722 | Ga0500627_0000732 | 3300053158 | Bacteria | 8739 |
| 723 | Ga0501084_0062312 | 3300054114 | Bacteria | 3122 |
| 724 | Ga0501082_0000954 | 3300060353 | Bacteria | 25550 |
| 725 | Ga0466962_0022672 | 3300061719 | Bacteria | 3018 |
| 726 | 2512641998 | 2512564014 | Bacteria | 4639632 |
| 727 | 2525556495 | 2524614729 | Bacteria | 3091755 |
| 728 | 2538833957 | 2537561836 | Bacteria | 3910579 |
| 729 | 2572255982 | 2571042365 | Bacteria | 3289345 |
| 730 | 2599670556 | 2599185226 | Bacteria | 8233575 |
| 731 | 2599679046 | 2599185227 | Bacteria | 8246414 |
| 732 | 2599691271 | 2599185229 | Bacteria | 8216126 |
| 733 | 2630649724 | 2627854209 | Bacteria | 3093011 |
| 734 | 2643816986 | 2643221559 | Bacteria | 4424915 |
| 735 | 2643831351 | 2643221562 | Bacteria | 4048635 |
| 736 | 2643881266 | 2643221573 | Bacteria | 4784121 |
| 737 | 2643896772 | 2643221577 | Bacteria | 3710843 |
| 738 | 2643939407 | 2643221586 | Bacteria | 4446529 |
| 739 | 2644078088 | 2643221612 | Bacteria | 4361984 |
| 740 | 2644478977 | 2643221685 | Bacteria | 3673288 |
| 741 | 2644530248 | 2643221695 | Bacteria | 3441323 |
| 742 | 2644662040 | 2643221720 | Bacteria | 4694283 |
| 743 | 2644696390 | 2643221727 | Bacteria | 4415595 |
| 744 | 2644700177 | 2643221728 | Bacteria | 4797149 |
| 745 | 2687583419 | 2687453130 | Bacteria | 4227172 |
| 746 | 2739732294 | 2739367700 | Bacteria | 4747630 |
| 747 | 2739793734 | 2739367756 | Bacteria | 4553612 |
| 748 | 2748018752 | 2747842501 | Bacteria | 5293829 |
| 749 | 2819597928 | 2818991446 | Bacteria | 7757362 |
| 750 | 2819662352 | 2818991457 | Bacteria | 5323295 |
| 751 | 2831268907 | 2831265667 | Bacteria | 7184833 |
| 752 | 2838058345 | 2838054893 | Bacteria | 7451788 |
| 753 | 2848299555 | 2848297114 | Bacteria | 3608511 |
| 754 | 2849576406 | 2849573788 | Bacteria | 5421256 |
| 755 | 2852687943 | 2852684882 | Bacteria | 5463342 |
| 756 | 2884962344 | 2884960567 | Bacteria | 5437054 |
| 757 | 2885428668 | 2885427238 | Bacteria | 2291351 |
| 758 | 2895396497 | 2895395659 | Bacteria | 3983269 |
| 759 | 2896186312 | 2896184354 | Bacteria | 3258548 |
| 760 | 2896253668 | 2896253425 | Bacteria | 3418029 |
| 761 | 2899929348 | 2899924645 | Bacteria | 7487985 |
| 762 | 2928040209 | 2928037797 | Bacteria | 7273642 |
| 763 | 2928047042 | 2928044640 | Bacteria | 7271509 |
| 764 | 2928057753 | 2928051484 | Bacteria | 7773759 |
| 765 | 2928067864 | 2928064002 | Bacteria | 7419480 |
| 766 | 2928072428 | 2928070936 | Bacteria | 8062541 |
| 767 | 2928085626 | 2928084124 | Bacteria | 7159212 |
| 768 | 2929199363 | 2929195423 | Bacteria | 5325372 |
| 769 | 2939625337 | 2939622612 | Bacteria | 4698046 |
| 770 | 2941477580 | 2941475908 | Bacteria | 4145589 |
| 771 | 2941493218 | 2941489479 | Bacteria | 6313767 |
| 772 | 2945915052 | 2945909444 | Bacteria | 7065066 |
| 773 | 2945989545 | 2945984333 | Bacteria | 7358892 |
| 774 | 8021623988 | 8021622325 | Bacteria | 4844743 |
| 775 | 8021626686 | 8021626552 | Bacteria | 4665214 |
| 776 | 8021648272 | 8021648035 | Bacteria | 4772378 |
| 777 | Ga0501070_0003182 | |||
| 778 | JGI24741J21665_1005862 | |||
| 779 | JGI24740J21852_10004662 | |||
| 780 | JGI24739J22299_10002751 | |||
| 781 | JGI24737J22298_10006712 | |||
| 782 | JGI25152J39213_1010079 | |||
| 783 | JGI25150J39212_1000176 | |||
| 784 | JGI25150J39212_1000722 | |||
| 785 | JGI25150J39212_1007488 | |||
| 786 | JGI25159J45721_1006579 | |||
| 787 | JGI25159J45721_1010915 | |||
| 788 | JGI25151J46595_10000519 | |||
| 789 | JGI25151J46595_10018311 | |||
| 790 | JGI25151J46595_10029181 | |||
| 791 | JGI25153J46596_10000203 | |||
| 792 | JGI25153J46596_10013628 | |||
| 793 | JGI25153J46596_10024286 | |||
| 794 | JGI25160J50197_1015002 | |||
| 795 | JGI25160J50197_1017180 | |||
| 796 | JGI25161J50226_1005878 | |||
| 797 | Ga0006562J51391_1001894 | |||
| 798 | Ga0006562J51391_1022678 | |||
| 799 | Ga0055535_1000552 | |||
| 800 | Ga0055542_1000003 | |||
| 801 | Ga0055526_1000005 | |||
| 802 | Ga0055526_1016151 | |||
| 803 | Ga0055526_1020907 | |||
| 804 | Ga0055537_1000042 | |||
| 805 | Ga0055537_1008902 | |||
| 806 | Ga0055524_1000005 | |||
| 807 | Ga0055524_1000243 | |||
| 808 | Ga0055524_1007494 | |||
| 809 | Ga0055524_1019644 | |||
| 810 | Ga0055536_1001196 | |||
| 811 | Ga0055536_1008097 | |||
| 812 | Ga0055534_1000002 | |||
| 813 | Ga0055534_1008571 | |||
| 814 | Ga0055528_1000002 | |||
| 815 | Ga0055528_1019315 | |||
| 816 | Ga0055530_10003657 | |||
| 817 | Ga0055530_10004621 | |||
| 818 | Ga0055531_10001271 | |||
| 819 | Ga0055531_10009971 | |||
| 820 | Ga0055531_10027053 | |||
| 821 | Ga0058692_1000143 | |||
| 822 | Ga0055543_1003064 | |||
| 823 | Ga0055543_1008839 | |||
| 824 | Ga0065165_1002495 | |||
| 825 | Ga0065165_1010740 | |||
| 826 | Ga0065165_1013547 | |||
| 827 | Ga0065165_1022550 | |||
| 828 | Ga0065712_10000357 | |||
| 829 | Ga0065715_10091439 | |||
| 830 | Ga0070658_10000002 | |||
| 831 | Ga0070658_10007660 | |||
| 832 | Ga0070658_10053628 | |||
| 833 | Ga0070658_10108373 | |||
| 834 | Ga0070676_10018733 | |||
| 835 | Ga0070683_100007667 | |||
| 836 | Ga0070683_100043585 | |||
| 837 | Ga0070690_100040290 | |||
| 838 | Ga0070670_100000203 | |||
| 839 | Ga0068869_100055519 | |||
| 840 | Ga0070666_10054233 | |||
| 841 | Ga0070680_100001134 | |||
| 842 | Ga0070680_100001426 | |||
| 843 | Ga0070682_100008205 | |||
| 844 | Ga0068868_100023986 | |||
| 845 | Ga0070660_100000381 | |||
| 846 | Ga0070660_100001066 | |||
| 847 | Ga0070660_100069370 | |||
| 848 | Ga0070660_100116868 | |||
| 849 | Ga0070689_100003285 | |||
| 850 | Ga0070689_100042076 | |||
| 851 | Ga0070691_10001916 | |||
| 852 | Ga0070687_100004457 | |||
| 853 | Ga0070661_100003980 | |||
| 854 | Ga0070661_100022213 | |||
| 855 | Ga0070661_100060137 | |||
| 856 | Ga0070668_100001658 | |||
| 857 | Ga0070668_100008875 | |||
| 858 | Ga0070668_100010445 | |||
| 859 | Ga0070668_100021536 | |||
| 860 | Ga0070669_100013888 | |||
| 861 | Ga0070669_100021860 | |||
| 862 | Ga0070675_100002343 | |||
| 863 | Ga0070671_100072638 | |||
| 864 | Ga0070674_100078252 | |||
| 865 | Ga0070673_100040315 | |||
| 866 | Ga0070673_100059383 | |||
| 867 | Ga0070673_100106777 | |||
| 868 | Ga0070688_100014385 | |||
| 869 | Ga0070659_100007515 | |||
| 870 | Ga0070659_100055632 | |||
| 871 | Ga0070659_100107312 | |||
| 872 | Ga0070659_100144953 | |||
| 873 | Ga0070667_100000848 | |||
| 874 | Ga0070667_100011178 | |||
| 875 | Ga0070667_100018002 | |||
| 876 | Ga0070667_100028888 | |||
| 877 | Ga0070667_100029817 | |||
| 878 | Ga0070667_100074031 | |||
| 879 | Ga0070663_100001534 | |||
| 880 | Ga0070663_100004672 | |||
| 881 | Ga0070663_100016847 | |||
| 882 | Ga0070663_100020512 | |||
| 883 | Ga0070678_100028410 | |||
| 884 | Ga0070678_100083528 | |||
| 885 | Ga0070662_100008925 | |||
| 886 | Ga0070662_100018814 | |||
| 887 | Ga0070662_100046714 | |||
| 888 | Ga0070662_100054701 | |||
| 889 | Ga0070662_100095381 | |||
| 890 | Ga0070681_10000915 | |||
| 891 | Ga0070681_10002608 | |||
| 892 | Ga0070681_10017444 | |||
| 893 | Ga0070681_10022121 | |||
| 894 | Ga0070681_10223578 | |||
| 895 | Ga0068867_100011529 | |||
| 896 | Ga0070685_10022976 | |||
| 897 | Ga0070699_100037887 | |||
| 898 | Ga0070679_100000150 | |||
| 899 | Ga0070679_100002356 | |||
| 900 | Ga0070684_100006790 | |||
| 901 | Ga0068853_100003225 | |||
| 902 | Ga0068853_100021486 | |||
| 903 | Ga0068853_100023574 | |||
| 904 | Ga0068853_100039004 | |||
| 905 | Ga0070672_100003386 | |||
| 906 | Ga0070672_100003719 | |||
| 907 | Ga0070672_100091034 | |||
| 908 | Ga0070696_100002140 | |||
| 909 | Ga0070696_100015715 | |||
| 910 | Ga0070696_100020593 | |||
| 911 | Ga0070696_100096424 | |||
| 912 | Ga0070693_100023576 | |||
| 913 | Ga0070665_100000108 | |||
| 914 | Ga0070665_100008714 | |||
| 915 | Ga0070665_100014764 | |||
| 916 | Ga0070665_100041220 | |||
| 917 | Ga0070665_100049723 | |||
| 918 | Ga0070665_100053376 | |||
| 919 | Ga0070665_100153791 | |||
| 920 | Ga0068855_100004282 | |||
| 921 | Ga0068855_100016141 | |||
| 922 | Ga0068855_100040970 | |||
| 923 | Ga0068855_100073910 | |||
| 924 | Ga0070664_100000093 | |||
| 925 | Ga0070664_100031702 | |||
| 926 | Ga0070664_100049864 | |||
| 927 | Ga0070664_100082310 | |||
| 928 | Ga0070664_100088978 | |||
| 929 | Ga0068857_100000180 | |||
| 930 | Ga0068857_100007385 | |||
| 931 | Ga0068857_100037792 | |||
| 932 | Ga0068854_100002304 | |||
| 933 | Ga0068854_100003859 | |||
| 934 | Ga0068854_100006695 | |||
| 935 | Ga0068854_100010449 | |||
| 936 | Ga0068856_100042942 | |||
| 937 | Ga0068852_100078409 | |||
| 938 | Ga0068852_100116098 | |||
| 939 | Ga0068852_100128721 | |||
| 940 | Ga0068859_100004108 | |||
| 941 | Ga0068864_100000078 | |||
| 942 | Ga0068861_100067243 | |||
| 943 | Ga0068851_10019700 | |||
| 944 | Ga0068851_10021255 | |||
| 945 | Ga0068870_10010469 | |||
| 946 | Ga0068863_100000019 | |||
| 947 | Ga0068863_100001062 | |||
| 948 | Ga0068863_100014482 | |||
| 949 | Ga0068858_100000832 | |||
| 950 | Ga0068858_100183903 | |||
| 951 | Ga0068860_100051125 | |||
| 952 | Ga0068862_100000844 | |||
| 953 | Ga0068862_100082384 | |||
| 954 | Ga0081540_1023946 | |||
| 955 | Ga0081539_10004451 | |||
| 956 | Ga0075367_10088788 | |||
| 957 | Ga0075369_10013722 | |||
| 958 | Ga0075366_10009173 | |||
| 959 | Ga0097621_100109868 | |||
| 960 | Ga0097621_100111656 | |||
| 961 | Ga0068871_100026443 | |||
| 962 | Ga0075431_100020241 | |||
| 963 | Ga0075433_10058341 | |||
| 964 | Ga0075433_10104124 | |||
| 965 | Ga0075434_100002845 | |||
| 966 | Ga0075434_100002906 | |||
| 967 | Ga0075436_100028303 | |||
| 968 | Ga0097620_100004108 | |||
| 969 | Ga0079104_1006894 | |||
| 970 | Ga0105251_10000074 | |||
| 971 | Ga0105240_10000941 | |||
| 972 | Ga0105240_10001400 | |||
| 973 | Ga0105240_10011719 | |||
| 974 | Ga0105240_10211115 | |||
| 975 | Ga0111539_10150332 | |||
| 976 | Ga0105247_10037821 | |||
| 977 | Ga0105243_10000732 | |||
| 978 | Ga0105243_10059132 | |||
| 979 | Ga0105242_10000382 | |||
| 980 | Ga0105242_10002152 | |||
| 981 | Ga0105248_10000317 | |||
| 982 | Ga0105248_10001415 | |||
| 983 | Ga0105248_10008933 | |||
| 984 | Ga0105248_10009400 | |||
| 985 | Ga0105248_10010064 | |||
| 986 | Ga0105248_10062240 | |||
| 987 | Ga0105248_10117134 | |||
| 988 | Ga0105248_10168388 | |||
| 989 | Ga0105237_10000214 | |||
| 990 | Ga0105237_10003030 | |||
| 991 | Ga0105237_10009465 | |||
| 992 | Ga0105238_10004212 | |||
| 993 | Ga0105238_10015966 | |||
| 994 | Ga0105238_10026059 | |||
| 995 | Ga0105249_10101887 | |||
| 996 | Ga0105239_10000390 | |||
| 997 | Ga0105239_10003689 | |||
| 998 | Ga0105239_10009141 | |||
| 999 | Ga0105239_10050557 | |||
| 1000 | Ga0105239_10054999 | |||
| 1001 | Ga0105239_10064857 | |||
| 1002 | Ga0157314_1000074 | |||
| 1003 | Ga0157347_1000018 | |||
| 1004 | Ga0157373_10004665 | |||
| 1005 | Ga0157371_10000372 | |||
| 1006 | Ga0157371_10029539 | |||
| 1007 | Ga0157371_10100455 | |||
| 1008 | Ga0157370_10000586 | |||
| 1009 | Ga0157370_10002097 | |||
| 1010 | Ga0157370_10011830 | |||
| 1011 | Ga0157370_10019302 | |||
| 1012 | Ga0157370_10058393 | |||
| 1013 | Ga0157369_10000172 | |||
| 1014 | Ga0157378_10020708 | |||
| 1015 | Ga0163162_10005268 | |||
| 1016 | Ga0157372_10001271 | |||
| 1017 | Ga0157372_10022113 | |||
| 1018 | Ga0157372_10047647 | |||
| 1019 | Ga0157375_10000835 | |||
| 1020 | Ga0157375_10010204 | |||
| 1021 | Ga0157375_10022691 | |||
| 1022 | Ga0157375_10057661 | |||
| 1023 | Ga0157375_10097116 | |||
| 1024 | Ga0157375_10124887 | |||
| 1025 | Ga0163163_10000588 | |||
| 1026 | Ga0157380_10091717 | |||
| 1027 | Ga0157379_10004364 | |||
| 1028 | Ga0157379_10069439 | |||
| 1029 | Ga0157376_10001051 | |||
| 1030 | Ga0182007_10000025 | |||
| 1031 | Ga0182005_1000063 | |||
| 1032 | Ga0182005_1002028 | |||
| 1033 | Ga0183360_10002 | |||
| 1034 | Ga0163161_10002498 | |||
| 1035 | Ga0163161_10003580 | |||
| 1036 | Ga0163161_10090228 | |||
| 1037 | Ga0206354_10853913 | |||
| 1038 | Ga0213875_10002677 | |||
| 1039 | Ga0213875_10008468 | |||
| 1040 | Ga0209436_102753 | |||
| 1041 | Ga0209672_100220 | |||
| 1042 | Ga0209672_101566 | |||
| 1043 | Ga0209147_101094 | |||
| 1044 | Ga0209258_100015 | |||
| 1045 | Ga0207425_1000021 | |||
| 1046 | Ga0207425_1000063 | |||
| 1047 | Ga0207425_1000155 | |||
| 1048 | Ga0207425_1000532 | |||
| 1049 | Ga0209148_1000028 | |||
| 1050 | Ga0209129_1000020 | |||
| 1051 | Ga0209129_1000160 | |||
| 1052 | Ga0209129_1000243 | |||
| 1053 | Ga0209129_1001346 | |||
| 1054 | Ga0209129_1008628 | |||
| 1055 | Ga0209129_1011158 | |||
| 1056 | Ga0209565_1000001 | |||
| 1057 | Ga0209565_1002457 | |||
| 1058 | Ga0209565_1003157 | |||
| 1059 | Ga0209565_1006813 | |||
| 1060 | Ga0209673_1000001 | |||
| 1061 | Ga0209673_1003706 | |||
| 1062 | Ga0209673_1010664 | |||
| 1063 | Ga0209673_1015001 | |||
| 1064 | Ga0209130_1000738 | |||
| 1065 | Ga0209130_1001341 | |||
| 1066 | Ga0209130_1008137 | |||
| 1067 | Ga0209675_1000001 | |||
| 1068 | Ga0209675_1001553 | |||
| 1069 | Ga0209675_1010590 | |||
| 1070 | Ga0209676_1000074 | |||
| 1071 | Ga0209676_1000177 | |||
| 1072 | Ga0209025_1000002 | |||
| 1073 | Ga0209025_1001271 | |||
| 1074 | Ga0209025_1005652 | |||
| 1075 | Ga0209025_1015645 | |||
| 1076 | Ga0209025_1016339 | |||
| 1077 | Ga0209564_1000001 | |||
| 1078 | Ga0209564_1000346 | |||
| 1079 | Ga0209564_1003007 | |||
| 1080 | Ga0209758_1000003 | |||
| 1081 | Ga0209758_1000013 | |||
| 1082 | Ga0209758_1000039 | |||
| 1083 | Ga0209758_1000288 | |||
| 1084 | Ga0209758_1000577 | |||
| 1085 | Ga0209758_1028707 | |||
| 1086 | Ga0209758_1030851 | |||
| 1087 | Ga0209050_1000015 | |||
| 1088 | Ga0209050_1000837 | |||
| 1089 | Ga0209256_1000006 | |||
| 1090 | Ga0209256_1000079 | |||
| 1091 | Ga0209256_1000264 | |||
| 1092 | Ga0209256_1003261 | |||
| 1093 | Ga0207426_1000108 | |||
| 1094 | Ga0207426_1000130 | |||
| 1095 | Ga0207426_1017278 | |||
| 1096 | Ga0209051_1000010 | |||
| 1097 | Ga0209257_1000026 | |||
| 1098 | Ga0209257_1000253 | |||
| 1099 | Ga0209257_1010254 | |||
| 1100 | Ga0207656_10005343 | |||
| 1101 | Ga0207655_1030340 | |||
| 1102 | Ga0207713_1000206 | |||
| 1103 | Ga0207682_10028626 | |||
| 1104 | Ga0207688_10004545 | |||
| 1105 | Ga0207647_10003584 | |||
| 1106 | Ga0207647_10003912 | |||
| 1107 | Ga0207643_10014623 | |||
| 1108 | Ga0207705_10000005 | |||
| 1109 | Ga0207705_10000029 | |||
| 1110 | Ga0207705_10000196 | |||
| 1111 | Ga0207705_10000849 | |||
| 1112 | Ga0207705_10012438 | |||
| 1113 | Ga0207705_10042014 | |||
| 1114 | Ga0207707_10000049 | |||
| 1115 | Ga0207707_10000524 | |||
| 1116 | Ga0207707_10005763 | |||
| 1117 | Ga0207707_10010918 | |||
| 1118 | Ga0207707_10013235 | |||
| 1119 | Ga0207695_10001428 | |||
| 1120 | Ga0207695_10003902 | |||
| 1121 | Ga0207695_10005285 | |||
| 1122 | Ga0207695_10023694 | |||
| 1123 | Ga0207695_10034168 | |||
| 1124 | Ga0207695_10057260 | |||
| 1125 | Ga0207695_10117055 | |||
| 1126 | Ga0207671_10000057 | |||
| 1127 | Ga0207671_10000614 | |||
| 1128 | Ga0207660_10000738 | |||
| 1129 | Ga0207660_10000824 | |||
| 1130 | Ga0207660_10002809 | |||
| 1131 | Ga0207662_10010713 | |||
| 1132 | Ga0207657_10000366 | |||
| 1133 | Ga0207657_10001980 | |||
| 1134 | Ga0207657_10010520 | |||
| 1135 | Ga0207657_10011898 | |||
| 1136 | Ga0207657_10017023 | |||
| 1137 | Ga0207657_10089972 | |||
| 1138 | Ga0207649_10001327 | |||
| 1139 | Ga0207649_10019921 | |||
| 1140 | Ga0207652_10000014 | |||
| 1141 | Ga0207652_10002050 | |||
| 1142 | Ga0207652_10007253 | |||
| 1143 | Ga0207681_10008514 | |||
| 1144 | Ga0207681_10026462 | |||
| 1145 | Ga0207694_10000389 | |||
| 1146 | Ga0207694_10092007 | |||
| 1147 | Ga0207650_10003825 | |||
| 1148 | Ga0207650_10010658 | |||
| 1149 | Ga0207650_10026087 | |||
| 1150 | Ga0207650_10062203 | |||
| 1151 | Ga0207659_10000922 | |||
| 1152 | Ga0207644_10000863 | |||
| 1153 | Ga0207644_10014665 | |||
| 1154 | Ga0207644_10079406 | |||
| 1155 | Ga0207644_10126707 | |||
| 1156 | Ga0207690_10004132 | |||
| 1157 | Ga0207690_10005618 | |||
| 1158 | Ga0207690_10059620 | |||
| 1159 | Ga0207706_10009357 | |||
| 1160 | Ga0207706_10013061 | |||
| 1161 | Ga0207706_10028226 | |||
| 1162 | Ga0207706_10031994 | |||
| 1163 | Ga0207706_10079758 | |||
| 1164 | Ga0207706_10092126 | |||
| 1165 | Ga0207706_10138186 | |||
| 1166 | Ga0207686_10018261 | |||
| 1167 | Ga0207709_10002739 | |||
| 1168 | Ga0207709_10006002 | |||
| 1169 | Ga0207691_10003686 | |||
| 1170 | Ga0207691_10003724 | |||
| 1171 | Ga0207691_10005219 | |||
| 1172 | Ga0207691_10010329 | |||
| 1173 | Ga0207691_10050073 | |||
| 1174 | Ga0207711_10000042 | |||
| 1175 | Ga0207711_10001192 | |||
| 1176 | Ga0207711_10005184 | |||
| 1177 | Ga0207711_10024256 | |||
| 1178 | Ga0207711_10080795 | |||
| 1179 | Ga0207689_10046569 | |||
| 1180 | Ga0207679_10022572 | |||
| 1181 | Ga0207667_10000075 | |||
| 1182 | Ga0207667_10000139 | |||
| 1183 | Ga0207667_10000247 | |||
| 1184 | Ga0207667_10002560 | |||
| 1185 | Ga0207667_10005407 | |||
| 1186 | Ga0207667_10019569 | |||
| 1187 | Ga0207651_10010407 | |||
| 1188 | Ga0207651_10015296 | |||
| 1189 | Ga0207712_10000774 | |||
| 1190 | Ga0207712_10036576 | |||
| 1191 | Ga0207668_10001836 | |||
| 1192 | Ga0207668_10021703 | |||
| 1193 | Ga0207668_10032494 | |||
| 1194 | Ga0207668_10062228 | |||
| 1195 | Ga0207640_10000072 | |||
| 1196 | Ga0207640_10002140 | |||
| 1197 | Ga0207658_10000129 | |||
| 1198 | Ga0207658_10015261 | |||
| 1199 | Ga0207658_10033655 | |||
| 1200 | Ga0207658_10059774 | |||
| 1201 | Ga0207658_10072704 | |||
| 1202 | Ga0207677_10013281 | |||
| 1203 | Ga0207703_10000562 | |||
| 1204 | Ga0207703_10001651 | |||
| 1205 | Ga0207703_10001950 | |||
| 1206 | Ga0207703_10142838 | |||
| 1207 | Ga0207639_10000690 | |||
| 1208 | Ga0207639_10000761 | |||
| 1209 | Ga0207639_10003326 | |||
| 1210 | Ga0207639_10014100 | |||
| 1211 | Ga0207639_10030370 | |||
| 1212 | Ga0207639_10033443 | |||
| 1213 | Ga0207639_10046819 | |||
| 1214 | Ga0207678_10000915 | |||
| 1215 | Ga0207678_10003168 | |||
| 1216 | Ga0207678_10007726 | |||
| 1217 | Ga0207678_10008551 | |||
| 1218 | Ga0207678_10008759 | |||
| 1219 | Ga0207678_10009736 | |||
| 1220 | Ga0207678_10014318 | |||
| 1221 | Ga0207678_10038194 | |||
| 1222 | Ga0207678_10040977 | |||
| 1223 | Ga0207702_10020699 | |||
| 1224 | Ga0207702_10050438 | |||
| 1225 | Ga0207641_10000005 | |||
| 1226 | Ga0207641_10000444 | |||
| 1227 | Ga0207641_10055895 | |||
| 1228 | Ga0207648_10004770 | |||
| 1229 | Ga0207648_10007362 | |||
| 1230 | Ga0207648_10010683 | |||
| 1231 | Ga0207676_10000130 | |||
| 1232 | Ga0207676_10000740 | |||
| 1233 | Ga0207676_10047631 | |||
| 1234 | Ga0207674_10000371 | |||
| 1235 | Ga0207674_10000895 | |||
| 1236 | Ga0207674_10003700 | |||
| 1237 | Ga0207674_10004005 | |||
| 1238 | Ga0207674_10010501 | |||
| 1239 | Ga0207674_10014423 | |||
| 1240 | Ga0207674_10028341 | |||
| 1241 | Ga0207674_10097984 | |||
| 1242 | Ga0207675_100079459 | |||
| 1243 | Ga0207683_10012138 | |||
| 1244 | Ga0207683_10147012 | |||
| 1245 | Ga0207698_10012712 | |||
| 1246 | Ga0209371_1000048 | |||
| 1247 | Ga0209998_10000544 | |||
| 1248 | Ga0209974_10005851 | |||
| 1249 | Ga0268266_10000001 | |||
| 1250 | Ga0268266_10058815 | |||
| 1251 | Ga0268265_10000478 | |||
| 1252 | Ga0268265_10005151 | |||
| 1253 | Ga0268265_10005187 | |||
| 1254 | Ga0268265_10033487 | |||
| 1255 | Ga0268265_10055897 | |||
| 1256 | Ga0268265_10071851 | |||
| 1257 | Ga0268264_10004535 | |||
| 1258 | Ga0268264_10015987 | |||
| 1259 | Ga0268264_10034303 | |||
| 1260 | Ga0268264_10035202 | |||
| 1261 | Ga0268264_10049864 | |||
| 1262 | Ga0307515_10132353 | |||
| 1263 | Ga0268256_1000049 | |||
| 1264 | Ga0265332_10010267 | |||
| 1265 | Ga0265327_10018116 | |||
| 1266 | Ga0307408_100000462 | |||
| 1267 | Ga0307408_100108699 | |||
| 1268 | Ga0307405_10004388 | |||
| 1269 | Ga0307405_10008078 | |||
| 1270 | Ga0307405_10008990 | |||
| 1271 | Ga0307413_10000510 | |||
| 1272 | Ga0307413_10002495 | |||
| 1273 | Ga0307413_10024198 | |||
| 1274 | Ga0307413_10058263 | |||
| 1275 | Ga0307410_10001464 | |||
| 1276 | Ga0307410_10002763 | |||
| 1277 | Ga0307410_10015868 | |||
| 1278 | Ga0307410_10024283 | |||
| 1279 | Ga0307410_10070532 | |||
| 1280 | Ga0307410_10071278 | |||
| 1281 | Ga0307406_10009693 | |||
| 1282 | Ga0307406_10014720 | |||
| 1283 | Ga0307406_10022466 | |||
| 1284 | Ga0307407_10022510 | |||
| 1285 | Ga0307412_10002004 | |||
| 1286 | Ga0307412_10013564 | |||
| 1287 | Ga0307412_10024666 | |||
| 1288 | Ga0307412_10098041 | |||
| 1289 | Ga0307409_100000754 | |||
| 1290 | Ga0307409_100013543 | |||
| 1291 | Ga0307409_100018441 | |||
| 1292 | Ga0307409_100020069 | |||
| 1293 | Ga0307409_100036398 | |||
| 1294 | Ga0307416_100015686 | |||
| 1295 | Ga0307416_100021152 | |||
| 1296 | Ga0307416_100022048 | |||
| 1297 | Ga0307416_100032175 | |||
| 1298 | Ga0307416_100041909 | |||
| 1299 | Ga0307416_100060889 | |||
| 1300 | Ga0307416_100130868 | |||
| 1301 | Ga0307414_10003324 | |||
| 1302 | Ga0307414_10006918 | |||
| 1303 | Ga0307414_10094021 | |||
| 1304 | Ga0307411_10001415 | |||
| 1305 | Ga0307411_10047603 | |||
| 1306 | Ga0307411_10058834 | |||
| 1307 | Ga0307411_10078997 | |||
| 1308 | Ga0307415_100006829 | |||
| 1309 | Ga0307415_100014221 | |||
| 1310 | Ga0307415_100047237 | |||
| 1311 | Ga0307415_100049359 | |||
| 1312 | Ga0307507_10080766 | |||
| 1313 | Ga0373943_0025424 | |||
| 1314 | Ga0395899_0007347 | |||
| 1315 | Ga0395899_0012121 | |||
| 1316 | Ga0395899_0046053 | |||
| 1317 | Ga0395899_0052209 | |||
| 1318 | Ga0395900_0021165 | |||
| 1319 | Ga0395900_0098541 | |||
| 1320 | Ga0395898_0050322 | |||
| 1321 | Ga0395898_0060432 | |||
| 1322 | Ga0436364_0152495 | |||
| 1323 | Ga0436364_0612163 | |||
| 1324 | Ga0395901_0002260 | |||
| 1325 | Ga0395901_0007279 | |||
| 1326 | Ga0395901_0026730 | |||
| 1327 | Ga0395901_0094401 | |||
| 1328 | Ga0395901_0109496 | |||
| 1329 | Ga0237819_00083 | |||
| 1330 | Ga0436363_0082884 | |||
| 1331 | Ga0439439_0007991 | |||
| 1332 | Ga0439447_004314 | |||
| 1333 | Ga0439433_0003763 | |||
| 1334 | Ga0439449_0005388 | |||
| 1335 | Ga0439449_0016059 | |||
| 1336 | Ga0450912_000740 | |||
| 1337 | Ga0450905_001664 | |||
| 1338 | Ga0450889_000099 | |||
| 1339 | Ga0439464_0000736 | |||
| 1340 | Ga0451577_0001431 | |||
| 1341 | Ga0466972_0009675 | |||
| 1342 | Ga0466972_0038923 | |||
| 1343 | Ga0466982_0000005 | |||
| 1344 | Ga0453683_0004013 | |||
| 1345 | Ga0466966_0002290 | |||
| 1346 | Ga0466963_0027502 | |||
| 1347 | Ga0453684_0000104 | |||
| 1348 | Ga0466971_0019335 | |||
| 1349 | Ga0466968_0029618 | |||
| 1350 | Ga0466970_0004188 | |||
| 1351 | Ga0466959_0034410 | |||
| 1352 | Ga0451576_0000024 | |||
| 1353 | Ga0451576_0007494 | |||
| 1354 | Ga0495590_0001372 | |||
| 1355 | Ga0495638_0000206 | |||
| 1356 | Ga0495638_0000601 | |||
| 1357 | Ga0495638_0000718 | |||
| 1358 | Ga0495638_0004955 | |||
| 1359 | Ga0495638_0013378 | |||
| 1360 | Ga0495650_0000206 | |||
| 1361 | Ga0495616_0000172 | |||
| 1362 | Ga0495616_0000301 | |||
| 1363 | Ga0495631_0000050 | |||
| 1364 | Ga0495631_0001386 | |||
| 1365 | Ga0495637_0006734 | |||
| 1366 | Ga0495637_0012745 | |||
| 1367 | Ga0495648_0000067 | |||
| 1368 | Ga0495663_0000603 | |||
| 1369 | Ga0495622_0000044 | |||
| 1370 | Ga0495633_0006549 | |||
| 1371 | Ga0495668_0000364 | |||
| 1372 | Ga0495625_0013179 | |||
| 1373 | Ga0495670_0052015 | |||
| 1374 | Ga0495671_0012049 | |||
| 1375 | Ga0495649_0000930 | |||
| 1376 | Ga0495581_0021648 | |||
| 1377 | Ga0495676_0028418 | |||
| 1378 | Ga0495673_0000549 | |||
| 1379 | Ga0495686_0000023 | |||
| 1380 | Ga0495686_0010453 | |||
| 1381 | Ga0495686_0025056 | |||
| 1382 | Ga0495626_0021808 | |||
| 1383 | Ga0496101_0048381 | |||
| 1384 | Ga0496104_0000038 | |||
| 1385 | Ga0496104_0037457 | |||
| 1386 | Ga0496105_0000038 | |||
| 1387 | Ga0496105_0013613 | |||
| 1388 | Ga0496108_0029449 | |||
| 1389 | Ga0496110_0000948 | |||
| 1390 | Ga0496111_0011178 | |||
| 1391 | Ga0496111_0013573 | |||
| 1392 | Ga0496112_0034335 | |||
| 1393 | Ga0496113_0012663 | |||
| 1394 | Ga0496114_0009311 | |||
| 1395 | Ga0496115_0002382 | |||
| 1396 | Ga0496115_0021889 | |||
| 1397 | Ga0496116_0044648 | |||
| 1398 | Ga0496117_0000483 | |||
| 1399 | Ga0496117_0003418 | |||
| 1400 | Ga0496117_0027503 | |||
| 1401 | Ga0496117_0035931 | |||
| 1402 | Ga0496118_0000520 | |||
| 1403 | Ga0496118_0000926 | |||
| 1404 | Ga0496118_0001750 | |||
| 1405 | Ga0496118_0002749 | |||
| 1406 | Ga0496118_0012543 | |||
| 1407 | Ga0496118_0046124 | |||
| 1408 | Ga0496119_0000165 | |||
| 1409 | Ga0496119_0002323 | |||
| 1410 | Ga0496119_0005152 | |||
| 1411 | Ga0496119_0014423 | |||
| 1412 | Ga0496120_0000054 | |||
| 1413 | Ga0496120_0000200 | |||
| 1414 | Ga0496120_0001064 | |||
| 1415 | Ga0496120_0002498 | |||
| 1416 | Ga0496121_0000364 | |||
| 1417 | Ga0496121_0007588 | |||
| 1418 | Ga0496121_0015077 | |||
| 1419 | Ga0496121_0064656 | |||
| 1420 | Ga0496121_0078524 | |||
| 1421 | Ga0496122_0000671 | |||
| 1422 | Ga0496122_0002256 | |||
| 1423 | Ga0496122_0006807 | |||
| 1424 | Ga0496123_0000489 | |||
| 1425 | Ga0496123_0008369 | |||
| 1426 | Ga0496123_0010473 | |||
| 1427 | Ga0496124_0000345 | |||
| 1428 | Ga0496124_0005789 | |||
| 1429 | Ga0496125_0000750 | |||
| 1430 | Ga0496125_0003859 | |||
| 1431 | Ga0496125_0013426 | |||
| 1432 | Ga0496126_0000206 | |||
| 1433 | Ga0496126_0000546 | |||
| 1434 | Ga0501032_0089521 | |||
| 1435 | Ga0501033_0008867 | |||
| 1436 | Ga0501034_0004271 | |||
| 1437 | Ga0501036_0042889 | |||
| 1438 | Ga0501037_0013659 | |||
| 1439 | Ga0501037_0083405 | |||
| 1440 | Ga0501043_0090753 | |||
| 1441 | Ga0501043_0116103 | |||
| 1442 | Ga0501046_0018913 | |||
| 1443 | Ga0501047_0003771 | |||
| 1444 | Ga0501047_0036233 | |||
| 1445 | Ga0501047_0046602 | |||
| 1446 | Ga0501047_0083596 | |||
| 1447 | Ga0501048_0069771 | |||
| 1448 | Ga0501069_0043029 | |||
| 1449 | Ga0501069_0043961 | |||
| 1450 | Ga0501070_0015429 | |||
| 1451 | Ga0501070_0018521 | |||
| 1452 | Ga0501070_0024174 | |||
| 1453 | Ga0501073_0008538 | |||
| 1454 | Ga0501074_0005391 | |||
| 1455 | Ga0501077_0027870 | |||
| 1456 | Ga0501216_000726 | |||
| 1457 | Ga0501224_000663 | |||
| 1458 | Ga0501235_000096 | |||
| 1459 | Ga0501257_001050 | |||
| 1460 | Ga0501259_001080 | |||
| 1461 | Ga0501221_001782 | |||
| 1462 | Ga0501225_0008487 | |||
| 1463 | Ga0501234_000510 | |||
| 1464 | Ga0501080_0019485 | |||
| 1465 | Ga0501080_0043854 | |||
| 1466 | Ga0501080_0099775 | |||
| 1467 | Ga0501266_001456 | |||
| 1468 | Ga0501268_000561 | |||
| 1469 | Ga0501035_0074178 | |||
| 1470 | Ga0501044_0007417 | |||
| 1471 | Ga0501044_0036767 | |||
| 1472 | Ga0501044_0070035 | |||
| 1473 | Ga0501044_0118210 | |||
| 1474 | nmdc:mga0k408_43360_c1 | |||
| 1475 | nmdc:mga07m45_21539_c1 | |||
| 1476 | nmdc:mga0n895_2035_c1 | |||
| 1477 | nmdc:mga0a205_17506_c1 | |||
| 1478 | nmdc:mga0a205_44533_c2 | |||
| 1479 | Ga0500643_006841 | |||
| 1480 | Ga0500643_009148 | |||
| 1481 | Ga0500644_0000166 | |||
| 1482 | Ga0500644_0033251 | |||
| 1483 | Ga0500651_0000162 | |||
| 1484 | Ga0500562_005788 | |||
| 1485 | Ga0500569_004372 | |||
| 1486 | Ga0500571_000042 | |||
| 1487 | Ga0500593_001127 | |||
| 1488 | Ga0500597_001835 | |||
| 1489 | Ga0500607_002840 | |||
| 1490 | Ga0500655_005137 | |||
| 1491 | Ga0500658_0000483 | |||
| 1492 | Ga0500658_0006589 | |||
| 1493 | Ga0500559_0006208 | |||
| 1494 | Ga0500559_0013482 | |||
| 1495 | Ga0500564_000316 | |||
| 1496 | Ga0500564_024076 | |||
| 1497 | Ga0500568_0003294 | |||
| 1498 | Ga0500627_0000732 | |||
| 1499 | Ga0501084_0062312 | |||
| 1500 | Ga0501082_0000954 | |||
| 1501 | Ga0466962_0022672 | |||
| 1502 | 2512641998 | |||
| 1503 | 2525556495 | |||
| 1504 | 2538833957 | |||
| 1505 | 2572255982 | |||
| 1506 | 2599670556 | |||
| 1507 | 2599679046 | |||
| 1508 | 2599691271 | |||
| 1509 | 2630649724 | |||
| 1510 | 2643816986 | |||
| 1511 | 2643831351 | |||
| 1512 | 2643881266 | |||
| 1513 | 2643896772 | |||
| 1514 | 2643939407 | |||
| 1515 | 2644078088 | |||
| 1516 | 2644478977 | |||
| 1517 | 2644530248 | |||
| 1518 | 2644662040 | |||
| 1519 | 2644696390 | |||
| 1520 | 2644700177 | |||
| 1521 | 2687583419 | |||
| 1522 | 2739732294 | |||
| 1523 | 2739793734 | |||
| 1524 | 2748018752 | |||
| 1525 | 2819597928 | |||
| 1526 | 2819662352 | |||
| 1527 | 2831268907 | |||
| 1528 | 2838058345 | |||
| 1529 | 2848299555 | |||
| 1530 | 2849576406 | |||
| 1531 | 2852687943 | |||
| 1532 | 2884962344 | |||
| 1533 | 2885428668 | |||
| 1534 | 2895396497 | |||
| 1535 | 2896186312 | |||
| 1536 | 2896253668 | |||
| 1537 | 2899929348 | |||
| 1538 | 2928040209 | |||
| 1539 | 2928047042 | |||
| 1540 | 2928057753 | |||
| 1541 | 2928067864 | |||
| 1542 | 2928072428 | |||
| 1543 | 2928085626 | |||
| 1544 | 2929199363 | |||
| 1545 | 2939625337 | |||
| 1546 | 2941477580 | |||
| 1547 | 2941493218 | |||
| 1548 | 2945915052 | |||
| 1549 | 2945989545 | |||
| 1550 | 8021623988 | |||
| 1551 | 8021626686 | |||
| 1552 | 8021648272 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2anp-assembly1.cif.gz_A | functional glutamate 151 to histidine mutant of the aminopeptidase from aeromonas proteolytica. | 0.7797 | 348 | 579 |
| 1tkf-assembly1.cif.gz_A | streptomyces griseus aminopeptidase complexed with d-tryptophan | 0.7774 | 347 | 576 |
| 1tkj-assembly1.cif.gz_A | streptomyces griseus aminopeptidase complexed with d-methionine | 0.7713 | 347 | 576 |
| 1amp-assembly1.cif.gz_A | crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family | 0.7654 | 339 | 579 |
| 1tf8-assembly1.cif.gz_A | streptomyces griseus aminopeptidase complexed with l-tryptophan | 0.7652 | 347 | 576 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37302_266_505_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.7795 | 342 | 579 | 3.40.630.10 |
| 5ib9A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.7758 | 342 | 586 | 3.40.630.10 |
| 1xjoA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.7643 | 347 | 576 | 3.40.630.10 |
| 1cp6A00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.7622 | 348 | 579 | 3.40.630.10 |
| af_O94479_48_334_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.76 | 342 | 580 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5SBD9-F1-model_v4 | Peptidase M20 | 0.9953 | 160 | 351 |
|
| AF-A0A259JBB5-F1-model_v4 | deleted | 0.9878 | 367 | 601 |
|
| AF-A0A520Y513-F1-model_v4 | M20/M25/M40 family metallo-hydrolase | 0.9873 | 382 | 600 |
GO:0006508
GO:0008235 |
| AF-A0A356SA33-F1-model_v4 | Peptidase M28 | 0.9806 | 391 | 601 |
GO:0006508
GO:0008235 |
| AF-A0A519NYV3-F1-model_v4 | deleted | 0.9798 | 370 | 595 |
|