F480339

General Info

Members Datasets Scaffolds Average Seq Length
776 376 1552 105

Family's Representative Sequence

Representative Sequence 3300049162|Ga0501307_037620|Ga0501307_037620_23_409
Length 128
Sequence VRAVPPDTIQTISIGFSPDAVSLAPELIEVCPLSELPPGATRIVEWEDLEIGVFNCGGELFAIEDRCSHDDGPLAEGEFDGPRCTVECPRHGSLFDLRTGKPLTLPAYEPVDTFPVVVQDNVIKLEVD

Samples

Sample ID Description Type Environment
1 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
98 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
189 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
279 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
282 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
314 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
319 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
320 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
321 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
322 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
339 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
353 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
354 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
357 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
358 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
363 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
367 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
368 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
376 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 3.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 9.02
Rhizosphere 87.76
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501307_037620 3300049162 Bacteria 693
2 JGI24739J22299_10093945 3300001989 Bacteria 910
3 JGI24743J22301_10007681 3300001991 Bacteria 1876
4 JGI24743J22301_10028830 3300001991 Bacteria 1088
5 JGI24738J21930_10114927 3300002075 Bacteria 582
6 JGI24742J22300_10085312 3300002244 Bacteria 600
7 JGI25407J50210_10024633 3300003373 Bacteria 1561
8 JGI25407J50210_10142449 3300003373 Unclassified 590
9 JGI25407J50210_10149462 3300003373 Unclassified 575
10 JGI25405J52794_10078973 3300003911 Bacteria 723
11 Ga0058861_10015679 3300004800 Bacteria 510
12 Ga0058860_10022178 3300004801 Bacteria 1930
13 Ga0058862_12796079 3300004803 Bacteria 2279
14 Ga0070658_10509494 3300005327 Bacteria 1040
15 Ga0070683_100001391 3300005329 Bacteria 18566
16 Ga0070683_100160734 3300005329 Bacteria 2131
17 Ga0070683_100277723 3300005329 Bacteria 1594
18 Ga0070683_101259864 3300005329 Bacteria 711
19 Ga0070690_100487690 3300005330 Bacteria 920
20 Ga0070670_100851964 3300005331 Bacteria 825
21 Ga0070666_10267151 3300005335 Bacteria 1214
22 Ga0070680_100002155 3300005336 Bacteria 14548
23 Ga0070682_100194279 3300005337 Bacteria 1427
24 Ga0068868_101780568 3300005338 Bacteria 582
25 Ga0070660_100132584 3300005339 Bacteria 1995
26 Ga0070691_10811091 3300005341 Bacteria 571
27 Ga0070661_100009618 3300005344 Bacteria 6698
28 Ga0070661_100113817 3300005344 Bacteria 2022
29 Ga0070661_100708749 3300005344 Bacteria 820
30 Ga0070692_10006351 3300005345 Bacteria 5131
31 Ga0070692_10034413 3300005345 Bacteria 2559
32 Ga0070692_10111093 3300005345 Bacteria 1516
33 Ga0070668_100374902 3300005347 Bacteria 1210
34 Ga0070668_100599148 3300005347 Bacteria 964
35 Ga0070669_100757485 3300005353 Bacteria 823
36 Ga0070675_100292452 3300005354 Bacteria 1434
37 Ga0070671_100126851 3300005355 Bacteria 2149
38 Ga0070674_100030178 3300005356 Bacteria 3579
39 Ga0070674_101650944 3300005356 Bacteria 579
40 Ga0070688_100022393 3300005365 Bacteria 3702
41 Ga0070688_100448755 3300005365 Bacteria 964
42 Ga0070659_100000003 3300005366 Bacteria 309142
43 Ga0070659_100002960 3300005366 Bacteria 12107
44 Ga0070659_100623342 3300005366 Bacteria 928
45 Ga0070714_100000026 3300005435 Bacteria 145396
46 Ga0070713_100164386 3300005436 Bacteria 1983
47 Ga0070710_10000001 3300005437 Bacteria 552187
48 Ga0070701_10580426 3300005438 Bacteria 740
49 Ga0070711_100049544 3300005439 Bacteria 2877
50 Ga0070711_101093763 3300005439 Bacteria 687
51 Ga0070705_100007754 3300005440 Bacteria 5299
52 Ga0070705_101097133 3300005440 Bacteria 651
53 Ga0070708_100076880 3300005445 Bacteria 3016
54 Ga0070663_101182103 3300005455 Unclassified 671
55 Ga0070678_100441113 3300005456 Bacteria 1139
56 Ga0070681_10001231 3300005458 Bacteria 22253
57 Ga0070681_11808768 3300005458 Bacteria 538
58 Ga0068867_100131151 3300005459 Bacteria 1948
59 Ga0068867_100226983 3300005459 Bacteria 1508
60 Ga0068867_100903934 3300005459 Bacteria 795
61 Ga0070685_11278549 3300005466 Bacteria 560
62 Ga0070679_100000711 3300005530 Bacteria 28612
63 Ga0070679_100190011 3300005530 Bacteria 2023
64 Ga0070679_100843447 3300005530 Bacteria 859
65 Ga0070679_101419085 3300005530 Bacteria 641
66 Ga0070684_100002080 3300005535 Bacteria 14744
67 Ga0070684_100464873 3300005535 Bacteria 1170
68 Ga0070684_102180986 3300005535 Bacteria 523
69 Ga0068853_100057219 3300005539 Bacteria 3364
70 Ga0068853_100634872 3300005539 Bacteria 1016
71 Ga0070672_100651940 3300005543 Bacteria 920
72 Ga0070686_100293390 3300005544 Bacteria 1204
73 Ga0070686_100397057 3300005544 Bacteria 1048
74 Ga0070696_100775325 3300005546 Bacteria 787
75 Ga0070693_100598684 3300005547 Bacteria 795
76 Ga0070693_101133736 3300005547 Bacteria 598
77 Ga0070665_101554606 3300005548 Bacteria 670
78 Ga0070665_102546748 3300005548 Bacteria 513
79 Ga0070704_100094727 3300005549 Bacteria 2234
80 Ga0070704_100270052 3300005549 Bacteria 1405
81 Ga0068855_100842613 3300005563 Bacteria 972
82 Ga0070664_100438260 3300005564 Bacteria 1198
83 Ga0068857_100045691 3300005577 Bacteria 3885
84 Ga0068857_100094378 3300005577 Bacteria 2679
85 Ga0068857_101740488 3300005577 Bacteria 610
86 Ga0068854_100070329 3300005578 Bacteria 2558
87 Ga0068854_100481831 3300005578 Bacteria 1042
88 Ga0068856_100005492 3300005614 Bacteria 12491
89 Ga0068856_100303168 3300005614 Bacteria 1615
90 Ga0068856_102134254 3300005614 Bacteria 570
91 Ga0068856_102477390 3300005614 Unclassified 526
92 Ga0070702_100043872 3300005615 Bacteria 2522
93 Ga0068852_100008293 3300005616 Bacteria 7647
94 Ga0068859_100019710 3300005617 Bacteria 6774
95 Ga0068864_100157803 3300005618 Bacteria 2060
96 Ga0068864_100269586 3300005618 Bacteria 1586
97 Ga0068866_10038257 3300005718 Bacteria 2361
98 Ga0068866_10248134 3300005718 Bacteria 1088
99 Ga0068861_100085351 3300005719 Bacteria 2479
100 Ga0068861_100358230 3300005719 Bacteria 1282
101 Ga0068861_100486757 3300005719 Bacteria 1112
102 Ga0068861_100501268 3300005719 Bacteria 1097
103 Ga0068861_101667520 3300005719 Bacteria 630
104 Ga0068851_10633696 3300005834 Bacteria 653
105 Ga0068863_101553356 3300005841 Bacteria 671
106 Ga0068858_100248751 3300005842 Bacteria 1688
107 Ga0068860_100073909 3300005843 Bacteria 3240
108 Ga0068862_100267738 3300005844 Bacteria 1562
109 Ga0068862_100803317 3300005844 Bacteria 919
110 Ga0068862_101644292 3300005844 Bacteria 650
111 Ga0081455_10003426 3300005937 Bacteria 18232
112 Ga0081455_10018753 3300005937 Bacteria 6568
113 Ga0081538_10000060 3300005981 Bacteria 101190
114 Ga0081538_10001456 3300005981 Bacteria 24329
115 Ga0081538_10003118 3300005981 Bacteria 15762
116 Ga0081538_10007478 3300005981 Bacteria 9439
117 Ga0081538_10012638 3300005981 Bacteria 6756
118 Ga0081538_10026825 3300005981 Bacteria 4015
119 Ga0081538_10077162 3300005981 Unclassified 1796
120 Ga0081540_1011982 3300005983 Bacteria 5748
121 Ga0081540_1053658 3300005983 Bacteria 1975
122 Ga0081539_10003543 3300005985 Bacteria 18978
123 Ga0081539_10021632 3300005985 Bacteria 4286
124 Ga0081539_10416807 3300005985 Bacteria 557
125 Ga0070717_10000005 3300006028 Bacteria 357819
126 Ga0070717_10072562 3300006028 Bacteria 2874
127 Ga0070717_11518555 3300006028 Unclassified 608
128 Ga0075363_100245997 3300006048 Bacteria 1029
129 Ga0075432_10023152 3300006058 Bacteria 2127
130 Ga0070712_100098134 3300006175 Bacteria 2161
131 Ga0068871_100222805 3300006358 Bacteria 1635
132 Ga0068871_100534090 3300006358 Bacteria 1061
133 Ga0075428_100065212 3300006844 Bacteria 3988
134 Ga0075434_100742443 3300006871 Bacteria 999
135 Ga0068865_100161922 3300006881 Bacteria 1708
136 Ga0068865_101170956 3300006881 Bacteria 679
137 Ga0075436_100787015 3300006914 Bacteria 708
138 Ga0097620_100019710 3300006931 Bacteria 6774
139 Ga0075435_100504870 3300007076 Bacteria 1046
140 Ga0075435_100600856 3300007076 Bacteria 954
141 Ga0075435_101340447 3300007076 Bacteria 627
142 Ga0105251_10127110 3300009011 Bacteria 1157
143 Ga0105250_10115845 3300009092 Bacteria 1100
144 Ga0105240_10047610 3300009093 Bacteria 5424
145 Ga0105240_10089991 3300009093 Bacteria 3752
146 Ga0105240_12009582 3300009093 Bacteria 601
147 Ga0111539_10001920 3300009094 Bacteria 27678
148 Ga0111539_10177432 3300009094 Bacteria 2489
149 Ga0111539_10742394 3300009094 Bacteria 1143
150 Ga0105245_10030959 3300009098 Bacteria 4733
151 Ga0105245_10064131 3300009098 Bacteria 3320
152 Ga0105245_10093070 3300009098 Bacteria 2777
153 Ga0105245_11709397 3300009098 Bacteria 682
154 Ga0105245_12949380 3300009098 Bacteria 527
155 Ga0105247_10163208 3300009101 Bacteria 1477
156 Ga0114129_10184171 3300009147 Bacteria 2839
157 Ga0105243_10355294 3300009148 Bacteria 1347
158 Ga0105243_11043819 3300009148 Bacteria 822
159 Ga0105241_10410461 3300009174 Bacteria 1190
160 Ga0105241_10617700 3300009174 Bacteria 981
161 Ga0105241_12586910 3300009174 Bacteria 509
162 Ga0105248_10061043 3300009177 Bacteria 4232
163 Ga0105248_11418233 3300009177 Bacteria 786
164 Ga0105237_10020971 3300009545 Bacteria 6726
165 Ga0105237_10448615 3300009545 Bacteria 1296
166 Ga0105237_10721370 3300009545 Bacteria 1003
167 Ga0105237_11853824 3300009545 Bacteria 611
168 Ga0105238_10007502 3300009551 Bacteria 10927
169 Ga0105238_10990884 3300009551 Bacteria 861
170 Ga0105238_11367063 3300009551 Unclassified 735
171 Ga0105249_10313127 3300009553 Bacteria 1579
172 Ga0105249_10466702 3300009553 Bacteria 1303
173 Ga0105249_10833790 3300009553 Bacteria 987
174 Ga0105249_11864879 3300009553 Bacteria 674
175 Ga0105239_10173716 3300010375 Bacteria 2410
176 Ga0105239_10288488 3300010375 Bacteria 1848
177 Ga0105239_10436186 3300010375 Bacteria 1485
178 Ga0105239_11178760 3300010375 Bacteria 882
179 Ga0105239_11435062 3300010375 Bacteria 797
180 Ga0105246_10094083 3300011119 Bacteria 2166
181 Ga0105246_10384148 3300011119 Bacteria 1161
182 Ga0157340_1006251 3300012473 Unclassified 742
183 Ga0157341_1006507 3300012494 Bacteria 906
184 Ga0157373_10201443 3300013100 Bacteria 1403
185 Ga0157373_10458380 3300013100 Bacteria 918
186 Ga0157371_10101045 3300013102 Bacteria 2046
187 Ga0157371_10106013 3300013102 Bacteria 1994
188 Ga0157371_10620037 3300013102 Bacteria 806
189 Ga0157371_10955152 3300013102 Bacteria 652
190 Ga0157370_10001322 3300013104 Bacteria 30835
191 Ga0157369_10010275 3300013105 Bacteria 10678
192 Ga0157369_11089071 3300013105 Bacteria 817
193 Ga0157369_11258517 3300013105 Unclassified 755
194 Ga0157374_11663914 3300013296 Bacteria 663
195 Ga0157374_12398491 3300013296 Bacteria 555
196 Ga0157378_13218796 3300013297 Bacteria 507
197 Ga0163162_10033082 3300013306 Bacteria 5136
198 Ga0163162_10442988 3300013306 Bacteria 1431
199 Ga0157372_10015106 3300013307 Bacteria 8266
200 Ga0157372_11583187 3300013307 Bacteria 754
201 Ga0157375_10195121 3300013308 Bacteria 2180
202 Ga0157375_10222955 3300013308 Bacteria 2044
203 Ga0163163_10292840 3300014325 Bacteria 1680
204 Ga0157377_10140953 3300014745 Bacteria 1481
205 Ga0157379_10571393 3300014968 Bacteria 1053
206 Ga0157376_10017908 3300014969 Bacteria 5417
207 Ga0157376_10223168 3300014969 Bacteria 1746
208 Ga0157376_10873551 3300014969 Bacteria 916
209 Ga0157376_11679039 3300014969 Bacteria 670
210 Ga0182006_1314951 3300015261 Bacteria 514
211 Ga0197907_10390394 3300020069 Bacteria 1072
212 Ga0206356_10295715 3300020070 Bacteria 672
213 Ga0206356_11825767 3300020070 Bacteria 2114
214 Ga0206355_1215879 3300020076 Bacteria 1987
215 Ga0206355_1368129 3300020076 Bacteria 655
216 Ga0206350_10813493 3300020080 Bacteria 918
217 Ga0206350_11003310 3300020080 Bacteria 834
218 Ga0206350_11499007 3300020080 Bacteria 856
219 Ga0206354_10583163 3300020081 Bacteria 1851
220 Ga0206353_10423714 3300020082 Bacteria 1162
221 Ga0206353_10566531 3300020082 Bacteria 1033
222 Ga0154015_1104569 3300020610 Bacteria 1520
223 Ga0213873_10024775 3300021358 Bacteria 1443
224 Ga0213876_10032460 3300021384 Bacteria 2754
225 Ga0213875_10149008 3300021388 Bacteria 1096
226 Ga0213875_10510091 3300021388 Bacteria 578
227 Ga0224712_10004592 3300022467 Bacteria 3742
228 Ga0224712_10175947 3300022467 Bacteria 962
229 Ga0224712_10359270 3300022467 Bacteria 689
230 Ga0207697_10141384 3300025315 Bacteria 1044
231 Ga0207692_10000007 3300025898 Bacteria 233250
232 Ga0207642_10242650 3300025899 Bacteria 1018
233 Ga0207642_10320328 3300025899 Bacteria 905
234 Ga0207642_10511452 3300025899 Bacteria 737
235 Ga0207710_10018517 3300025900 Bacteria 2963
236 Ga0207710_10105347 3300025900 Bacteria 1334
237 Ga0207688_10038917 3300025901 Bacteria 2641
238 Ga0207688_10054087 3300025901 Bacteria 2252
239 Ga0207680_11006986 3300025903 Bacteria 597
240 Ga0207699_10043099 3300025906 Bacteria 2620
241 Ga0207705_10197819 3300025909 Bacteria 1522
242 Ga0207705_10455847 3300025909 Bacteria 992
243 Ga0207654_10435743 3300025911 Bacteria 917
244 Ga0207707_10006815 3300025912 Bacteria 9968
245 Ga0207707_11351615 3300025912 Bacteria 570
246 Ga0207695_10072966 3300025913 Bacteria 3499
247 Ga0207671_10038515 3300025914 Bacteria 3543
248 Ga0207671_10404879 3300025914 Bacteria 1085
249 Ga0207693_10000201 3300025915 Bacteria 54465
250 Ga0207693_10118971 3300025915 Bacteria 2074
251 Ga0207663_10044796 3300025916 Bacteria 2718
252 Ga0207663_10797431 3300025916 Bacteria 752
253 Ga0207660_10017016 3300025917 Bacteria 4823
254 Ga0207660_11296194 3300025917 Bacteria 592
255 Ga0207662_10114108 3300025918 Bacteria 1688
256 Ga0207657_10025191 3300025919 Bacteria 5490
257 Ga0207657_10109176 3300025919 Bacteria 2287
258 Ga0207649_10116063 3300025920 Unclassified 1797
259 Ga0207649_10192411 3300025920 Bacteria 1436
260 Ga0207649_10733882 3300025920 Bacteria 768
261 Ga0207649_10773489 3300025920 Bacteria 748
262 Ga0207652_10003473 3300025921 Bacteria 12992
263 Ga0207652_10165312 3300025921 Bacteria 1984
264 Ga0207646_10750589 3300025922 Bacteria 871
265 Ga0207681_10055507 3300025923 Bacteria 2698
266 Ga0207694_10018784 3300025924 Bacteria 5225
267 Ga0207694_10692245 3300025924 Bacteria 859
268 Ga0207650_10555603 3300025925 Bacteria 963
269 Ga0207659_10117172 3300025926 Bacteria 2035
270 Ga0207687_10072616 3300025927 Bacteria 2462
271 Ga0207664_10000012 3300025929 Bacteria 278872
272 Ga0207664_10002150 3300025929 Bacteria 12949
273 Ga0207664_10430567 3300025929 Bacteria 1176
274 Ga0207664_10583689 3300025929 Bacteria 1003
275 Ga0207664_10676883 3300025929 Bacteria 928
276 Ga0207644_10090774 3300025931 Bacteria 2277
277 Ga0207644_10660392 3300025931 Bacteria 871
278 Ga0207690_10000021 3300025932 Bacteria 217710
279 Ga0207690_10017450 3300025932 Bacteria 4382
280 Ga0207690_11077473 3300025932 Bacteria 669
281 Ga0207706_10029799 3300025933 Bacteria 4870
282 Ga0207706_10393267 3300025933 Bacteria 1202
283 Ga0207709_10236488 3300025935 Bacteria 1326
284 Ga0207709_10607706 3300025935 Bacteria 866
285 Ga0207670_10199308 3300025936 Bacteria 1520
286 Ga0207670_10720729 3300025936 Bacteria 827
287 Ga0207669_10019550 3300025937 Bacteria 3530
288 Ga0207669_10123359 3300025937 Bacteria 1764
289 Ga0207669_10431345 3300025937 Bacteria 1040
290 Ga0207669_10500396 3300025937 Bacteria 972
291 Ga0207704_10185415 3300025938 Bacteria 1508
292 Ga0207704_10217236 3300025938 Bacteria 1412
293 Ga0207704_10977812 3300025938 Bacteria 715
294 Ga0207665_10665246 3300025939 Bacteria 817
295 Ga0207691_10614579 3300025940 Bacteria 919
296 Ga0207711_10040312 3300025941 Bacteria 3973
297 Ga0207711_10087014 3300025941 Bacteria 2741
298 Ga0207711_10213338 3300025941 Bacteria 1764
299 Ga0207661_10000200 3300025944 Bacteria 38832
300 Ga0207661_10085724 3300025944 Bacteria 2612
301 Ga0207661_10098148 3300025944 Bacteria 2454
302 Ga0207661_10271565 3300025944 Bacteria 1513
303 Ga0207661_10412539 3300025944 Bacteria 1226
304 Ga0207679_10356321 3300025945 Bacteria 1277
305 Ga0207679_11501117 3300025945 Bacteria 618
306 Ga0207667_10776164 3300025949 Bacteria 956
307 Ga0207667_11014549 3300025949 Bacteria 816
308 Ga0207712_10096368 3300025961 Bacteria 2189
309 Ga0207712_10582491 3300025961 Bacteria 966
310 Ga0207668_11240464 3300025972 Bacteria 670
311 Ga0207640_10102614 3300025981 Bacteria 2009
312 Ga0207640_11160496 3300025981 Bacteria 685
313 Ga0207677_10403762 3300026023 Bacteria 1159
314 Ga0207677_11188797 3300026023 Bacteria 698
315 Ga0207703_10125845 3300026035 Bacteria 2206
316 Ga0207639_10211586 3300026041 Bacteria 1669
317 Ga0207639_10538655 3300026041 Bacteria 1071
318 Ga0207639_10760855 3300026041 Bacteria 901
319 Ga0207639_11245228 3300026041 Bacteria 698
320 Ga0207678_10537742 3300026067 Bacteria 1021
321 Ga0207678_10615184 3300026067 Bacteria 953
322 Ga0207678_11600092 3300026067 Bacteria 574
323 Ga0207678_11909172 3300026067 Bacteria 518
324 Ga0207708_10102504 3300026075 Bacteria 2216
325 Ga0207708_10292490 3300026075 Bacteria 1323
326 Ga0207702_10009068 3300026078 Bacteria 8374
327 Ga0207702_10600955 3300026078 Bacteria 1079
328 Ga0207641_11137445 3300026088 Bacteria 780
329 Ga0207641_11389753 3300026088 Bacteria 703
330 Ga0207648_10048291 3300026089 Bacteria 3727
331 Ga0207648_10332296 3300026089 Bacteria 1367
332 Ga0207676_10037974 3300026095 Bacteria 3674
333 Ga0207676_11673484 3300026095 Bacteria 634
334 Ga0207674_10049789 3300026116 Bacteria 4283
335 Ga0207674_10443534 3300026116 Bacteria 1255
336 Ga0207674_10734460 3300026116 Bacteria 953
337 Ga0207674_11612089 3300026116 Bacteria 618
338 Ga0207675_100095118 3300026118 Bacteria 2802
339 Ga0207675_100131602 3300026118 Bacteria 2373
340 Ga0207675_100178402 3300026118 Bacteria 2033
341 Ga0207675_100637467 3300026118 Bacteria 1071
342 Ga0207683_10750810 3300026121 Bacteria 905
343 Ga0207698_10003965 3300026142 Bacteria 8972
344 Ga0207698_10107024 3300026142 Bacteria 2334
345 Ga0207698_10198603 3300026142 Bacteria 1794
346 Ga0209998_10070703 3300027717 Bacteria 834
347 Ga0207428_10044712 3300027907 Bacteria 3571
348 Ga0207428_10408349 3300027907 Bacteria 994
349 Ga0268265_10191028 3300028380 Bacteria 1768
350 Ga0268265_11424559 3300028380 Bacteria 695
351 Ga0268264_10068104 3300028381 Bacteria 3007
352 Ga0268264_10256269 3300028381 Bacteria 1628
353 Ga0265326_10000152 3300028558 Bacteria 36367
354 Ga0265319_1003386 3300028563 Bacteria 8338
355 Ga0265334_10000186 3300028573 Bacteria 36368
356 Ga0265336_10004830 3300028666 Bacteria 5050
357 Ga0265338_10012547 3300028800 Bacteria 9651
358 Ga0265324_10003134 3300029957 Bacteria 8033
359 Ga0265327_10057715 3300031251 Bacteria 1996
360 Ga0307408_100027174 3300031548 Bacteria 3941
361 Ga0307408_100330374 3300031548 Bacteria 1287
362 Ga0307408_100340316 3300031548 Bacteria 1270
363 Ga0265314_10300112 3300031711 Bacteria 901
364 Ga0307405_10071556 3300031731 Bacteria 2232
365 Ga0307405_11305148 3300031731 Bacteria 631
366 Ga0307413_10353104 3300031824 Bacteria 1135
367 Ga0307413_11001600 3300031824 Bacteria 716
368 Ga0307413_11244402 3300031824 Bacteria 649
369 Ga0307410_10693840 3300031852 Unclassified 857
370 Ga0307406_10072986 3300031901 Bacteria 2255
371 Ga0307406_10143168 3300031901 Bacteria 1695
372 Ga0307407_10290249 3300031903 Bacteria 1136
373 Ga0307412_10073458 3300031911 Bacteria 2340
374 Ga0307409_100197033 3300031995 Bacteria 1798
375 Ga0307416_100032277 3300032002 Bacteria 3954
376 Ga0307416_100204372 3300032002 Bacteria 1877
377 Ga0307416_100208617 3300032002 Bacteria 1861
378 Ga0307414_10177155 3300032004 Bacteria 1711
379 Ga0307414_11816501 3300032004 Bacteria 569
380 Ga0307415_100089354 3300032126 Bacteria 2225
381 Ga0307415_100186846 3300032126 Bacteria 1631
382 Ga0373923_0111367 3300035111 Bacteria 1216
383 Ga0373939_0156281 3300035114 Bacteria 834
384 Ga0373939_0253859 3300035114 Bacteria 685
385 Ga0373954_0240956 3300035118 Bacteria 890
386 Ga0373943_0199937 3300035170 Bacteria 1106
387 Ga0373946_0144408 3300035171 Bacteria 1106
388 Ga0373955_0099814 3300035172 Bacteria 1665
389 Ga0373961_0151867 3300035241 Bacteria 790
390 Ga0373961_0223182 3300035241 Bacteria 673
391 Ga0373924_0020719 3300035410 Bacteria 2559
392 Ga0373931_0071804 3300035691 Bacteria 1892
393 Ga0373931_0624281 3300035691 Bacteria 706
394 Ga0373931_1103681 3300035691 Bacteria 540
395 Ga0373935_0334642 3300035692 Bacteria 1077
396 Ga0373927_1186048 3300035695 Bacteria 504
397 Ga0373933_0258126 3300035724 Bacteria 1123
398 Ga0373947_0145703 3300035725 Bacteria 1522
399 Ga0373937_0245447 3300036401 Bacteria 1687
400 Ga0395899_0000773 3300037312 Bacteria 31614
401 Ga0395899_0031851 3300037312 Bacteria 3962
402 Ga0395900_0002750 3300037418 Bacteria 19208
403 Ga0395900_0078603 3300037418 Bacteria 3389
404 Ga0395898_0012477 3300037466 Bacteria 8785
405 Ga0395898_0029232 3300037466 Bacteria 5522
406 Ga0395898_0253306 3300037466 Bacteria 1679
407 Ga0395898_0462943 3300037466 Bacteria 1207
408 Ga0395898_1860748 3300037466 Bacteria 522
409 Ga0395905_0026171 3300037471 Bacteria 5501
410 Ga0395905_1135968 3300037471 Bacteria 685
411 Ga0395905_1616071 3300037471 Bacteria 553
412 Ga0436364_0127227 3300037853 Bacteria 1105
413 Ga0436364_0268526 3300037853 Bacteria 4395
414 Ga0436364_0390471 3300037853 Bacteria 2533
415 Ga0436364_0728382 3300037853 Bacteria 4728
416 Ga0436364_0842144 3300037853 Bacteria 23644
417 Ga0395901_0041365 3300038443 Bacteria 4775
418 Ga0395901_0118300 3300038443 Bacteria 2784
419 Ga0436365_0859395 3300039437 Bacteria 6622
420 Ga0436365_1296982 3300039437 Bacteria 7201
421 Ga0436361_0507712 3300039447 Bacteria 524
422 Ga0436363_0157437 3300039450 Bacteria 1417
423 Ga0436363_0187523 3300039450 Bacteria 19050
424 Ga0436363_0265144 3300039450 Bacteria 821
425 Ga0436363_0801684 3300039450 Bacteria 547
426 Ga0436363_1070677 3300039450 Bacteria 1300
427 Ga0436363_1197930 3300039450 Bacteria 625
428 Ga0436363_1543441 3300039450 Bacteria 1296
429 Ga0439466_0061990 3300041411 Unclassified 1203
430 Ga0451797_1179173 3300041453 Unclassified 552
431 Ga0451800_1519290 3300041459 Bacteria 534
432 Ga0451853_2976327 3300041512 Bacteria 978
433 Ga0451853_3790887 3300041512 Bacteria 570
434 Ga0439448_0182536 3300042005 Bacteria 734
435 Ga0439463_122189 3300042016 Bacteria 673
436 Ga0439458_0104970 3300042157 Bacteria 736
437 Ga0439434_0143069 3300042435 Unclassified 789
438 Ga0439464_0066833 3300042439 Bacteria 1059
439 Ga0466969_0479332 3300044656 Bacteria 567
440 Ga0466965_0251746 3300044683 Bacteria 948
441 Ga0466965_0284555 3300044683 Bacteria 894
442 Ga0466965_0368726 3300044683 Bacteria 789
443 Ga0466965_0530064 3300044683 Bacteria 663
444 Ga0466965_0558858 3300044683 Bacteria 647
445 Ga0466966_0055448 3300044684 Bacteria 2508
446 Ga0466966_0061585 3300044684 Bacteria 2367
447 Ga0466966_0143156 3300044684 Bacteria 1460
448 Ga0466966_0532308 3300044684 Bacteria 707
449 Ga0466961_0018931 3300044693 Bacteria 4430
450 Ga0466961_0144826 3300044693 Bacteria 1486
451 Ga0466961_0449668 3300044693 Bacteria 780
452 Ga0466963_0007389 3300044694 Bacteria 6546
453 Ga0466963_0025385 3300044694 Bacteria 3779
454 Ga0466963_0160544 3300044694 Bacteria 1564
455 Ga0466963_0928164 3300044694 Unclassified 613
456 Ga0466964_0119574 3300044706 Bacteria 1186
457 Ga0466964_0197420 3300044706 Bacteria 964
458 Ga0466971_0068898 3300044719 Bacteria 1605
459 Ga0466971_0305616 3300044719 Unclassified 764
460 Ga0466968_0313314 3300044735 Bacteria 757
461 Ga0466968_0349468 3300044735 Bacteria 718
462 Ga0466968_0362507 3300044735 Bacteria 706
463 Ga0466970_0003061 3300044765 Bacteria 8121
464 Ga0466970_0266626 3300044765 Bacteria 961
465 Ga0466970_0350511 3300044765 Bacteria 838
466 Ga0466970_0964020 3300044765 Bacteria 503
467 Ga0466957_0049700 3300044842 Bacteria 2550
468 Ga0466957_0195334 3300044842 Unclassified 1327
469 Ga0466957_0268827 3300044842 Bacteria 1138
470 Ga0466957_0478145 3300044842 Bacteria 861
471 Ga0466957_0524269 3300044842 Bacteria 823
472 Ga0466960_0217554 3300044901 Bacteria 1050
473 Ga0466960_0284638 3300044901 Bacteria 927
474 Ga0466960_0325442 3300044901 Bacteria 871
475 Ga0466960_0594280 3300044901 Bacteria 656
476 Ga0466960_0997924 3300044901 Bacteria 514
477 Ga0466959_0018570 3300045049 Bacteria 5106
478 Ga0466959_0053058 3300045049 Bacteria 2966
479 Ga0466959_0087752 3300045049 Bacteria 2237
480 Ga0466959_0118769 3300045049 Bacteria 1881
481 Ga0466959_0233247 3300045049 Bacteria 1273
482 Ga0466959_0316778 3300045049 Bacteria 1067
483 Ga0466959_0460259 3300045049 Bacteria 862
484 Ga0466959_0564764 3300045049 Bacteria 767
485 Ga0451576_0874152 3300045051 Bacteria 943
486 Ga0466958_0002441 3300045836 Bacteria 9324
487 Ga0466958_0028727 3300045836 Bacteria 3299
488 Ga0466958_0066852 3300045836 Bacteria 2195
489 Ga0466958_0098330 3300045836 Bacteria 1817
490 Ga0466958_0100622 3300045836 Bacteria 1797
491 Ga0466958_0151459 3300045836 Bacteria 1463
492 Ga0466958_0229887 3300045836 Bacteria 1184
493 Ga0466958_0290903 3300045836 Bacteria 1048
494 Ga0466958_0737783 3300045836 Bacteria 642
495 Ga0466967_0107036 3300045976 Bacteria 2564
496 Ga0466967_0379262 3300045976 Bacteria 1373
497 Ga0466967_0457156 3300045976 Bacteria 1248
498 Ga0466967_0510255 3300045976 Bacteria 1181
499 Ga0466967_0558978 3300045976 Bacteria 1127
500 Ga0466967_0692750 3300045976 Bacteria 1009
501 Ga0466967_0775273 3300045976 Bacteria 951
502 Ga0466967_0999179 3300045976 Bacteria 833
503 Ga0466967_1077752 3300045976 Bacteria 800
504 Ga0466967_2122204 3300045976 Bacteria 558
505 Ga0495617_126674 3300046452 Bacteria 821
506 Ga0495617_193310 3300046452 Bacteria 638
507 Ga0495592_0112161 3300046454 Bacteria 1928
508 Ga0495592_0238789 3300046454 Bacteria 1207
509 Ga0495592_0637392 3300046454 Bacteria 647
510 Ga0495603_0268104 3300046455 Bacteria 982
511 Ga0495590_0167434 3300046457 Bacteria 800
512 Ga0495629_0025630 3300046459 Bacteria 4190
513 Ga0495629_1087207 3300046459 Unclassified 517
514 Ga0495641_0292642 3300046461 Bacteria 734
515 Ga0495651_0007587 3300046462 Bacteria 8293
516 Ga0495651_0008354 3300046462 Bacteria 7935
517 Ga0495651_0117439 3300046462 Bacteria 1958
518 Ga0495653_0018934 3300046463 Bacteria 5587
519 Ga0495653_0170113 3300046463 Bacteria 1505
520 Ga0495653_0240306 3300046463 Bacteria 1207
521 Ga0495653_0427170 3300046463 Bacteria 837
522 Ga0495580_0729097 3300046472 Bacteria 647
523 Ga0495582_0126384 3300046473 Bacteria 1443
524 Ga0495582_0379102 3300046473 Bacteria 815
525 Ga0495582_0520523 3300046473 Bacteria 688
526 Ga0495605_0249273 3300046474 Bacteria 760
527 Ga0495605_0408967 3300046474 Bacteria 563
528 Ga0495639_0275159 3300046475 Bacteria 836
529 Ga0495662_0136084 3300046476 Bacteria 1208
530 Ga0495664_0034634 3300046477 Bacteria 2971
531 Ga0495664_0307902 3300046477 Bacteria 956
532 Ga0495584_0035807 3300046491 Bacteria 2508
533 Ga0495584_0099275 3300046491 Bacteria 1471
534 Ga0495585_0046174 3300046492 Bacteria 2430
535 Ga0495585_0541132 3300046492 Bacteria 551
536 Ga0495594_0228699 3300046499 Bacteria 1060
537 Ga0495596_0274130 3300046500 Unclassified 655
538 Ga0495608_0005979 3300046511 Bacteria 8652
539 Ga0495608_0008384 3300046511 Bacteria 7244
540 Ga0495608_0931284 3300046511 Bacteria 507
541 Ga0495616_0228472 3300046513 Bacteria 807
542 Ga0495618_0388308 3300046514 Bacteria 855
543 Ga0495618_0691764 3300046514 Bacteria 600
544 Ga0495620_0123248 3300046515 Bacteria 1020
545 Ga0495628_0195703 3300046516 Bacteria 1525
546 Ga0495628_0495864 3300046516 Bacteria 882
547 Ga0495628_0751312 3300046516 Bacteria 685
548 Ga0495628_0981929 3300046516 Unclassified 582
549 Ga0495630_0008329 3300046517 Bacteria 7442
550 Ga0495631_0062256 3300046518 Bacteria 1617
551 Ga0495631_0467478 3300046518 Bacteria 537
552 Ga0495632_0307776 3300046519 Unclassified 702
553 Ga0495637_0069614 3300046520 Bacteria 1423
554 Ga0495637_0109171 3300046520 Bacteria 1074
555 Ga0495644_0081314 3300046523 Bacteria 1221
556 Ga0495652_0052576 3300046529 Bacteria 3474
557 Ga0495652_0126928 3300046529 Bacteria 2025
558 Ga0495652_0171700 3300046529 Bacteria 1673
559 Ga0495652_0265009 3300046529 Bacteria 1266
560 Ga0495665_0585137 3300046531 Unclassified 559
561 Ga0495665_0702072 3300046531 Bacteria 501
562 Ga0495640_0023164 3300046533 Bacteria 4532
563 Ga0495640_0140161 3300046533 Bacteria 1559
564 Ga0495640_0495827 3300046533 Bacteria 743
565 Ga0495586_0060872 3300046535 Bacteria 2054
566 Ga0495587_0016394 3300046536 Bacteria 4610
567 Ga0495587_0100496 3300046536 Bacteria 1667
568 Ga0495621_0031714 3300046539 Unclassified 1815
569 Ga0495597_0109807 3300046542 Unclassified 1157
570 Ga0495645_0326839 3300046543 Bacteria 994
571 Ga0495645_0519431 3300046543 Bacteria 742
572 Ga0495645_0670012 3300046543 Bacteria 632
573 Ga0495645_0840164 3300046543 Bacteria 549
574 Ga0495667_0016146 3300046559 Bacteria 5045
575 Ga0495667_0024200 3300046559 Bacteria 4090
576 Ga0495667_0125608 3300046559 Bacteria 1655
577 Ga0495668_0097031 3300046616 Bacteria 1613
578 Ga0495634_0116920 3300046642 Bacteria 1710
579 Ga0495634_0239591 3300046642 Bacteria 1113
580 Ga0495634_0619012 3300046642 Bacteria 627
581 Ga0495611_0121053 3300046648 Bacteria 1220
582 Ga0495635_0043103 3300046663 Bacteria 3114
583 Ga0495635_0245949 3300046663 Bacteria 1206
584 Ga0495661_0272956 3300046665 Bacteria 855
585 Ga0495588_0208039 3300046674 Bacteria 1033
586 Ga0495657_0044016 3300046675 Bacteria 3040
587 Ga0495657_0053535 3300046675 Bacteria 2700
588 Ga0495657_0174204 3300046675 Bacteria 1323
589 Ga0495599_0261831 3300046678 Bacteria 1050
590 Ga0495599_0638460 3300046678 Unclassified 618
591 Ga0495623_0098930 3300046679 Bacteria 1780
592 Ga0495646_0075708 3300046680 Bacteria 1973
593 Ga0495646_0153265 3300046680 Bacteria 1280
594 Ga0495646_0457110 3300046680 Bacteria 659
595 Ga0495658_0189590 3300046683 Bacteria 1278
596 Ga0495669_0527873 3300046684 Bacteria 574
597 Ga0495613_0100582 3300046689 Bacteria 2088
598 Ga0495613_0337897 3300046689 Bacteria 1037
599 Ga0495613_0888670 3300046689 Bacteria 577
600 Ga0495624_0095465 3300046690 Bacteria 1833
601 Ga0495670_0167843 3300046691 Bacteria 1155
602 Ga0495670_0261334 3300046691 Bacteria 924
603 Ga0495670_0354676 3300046691 Bacteria 790
604 Ga0495671_0447131 3300046692 Bacteria 618
605 Ga0495589_0172267 3300046794 Bacteria 1029
606 Ga0495589_0232950 3300046794 Bacteria 863
607 Ga0495589_0482639 3300046794 Bacteria 566
608 Ga0495600_0170479 3300046809 Bacteria 1405
609 Ga0495600_0172172 3300046809 Bacteria 1397
610 Ga0495600_0219741 3300046809 Bacteria 1215
611 Ga0495600_0230611 3300046809 Bacteria 1182
612 Ga0495660_0414445 3300046810 Bacteria 588
613 Ga0495581_0126907 3300047315 Bacteria 1486
614 Ga0495604_0022398 3300047317 Bacteria 5045
615 Ga0495604_0029965 3300047317 Bacteria 4327
616 Ga0495604_0044393 3300047317 Bacteria 3473
617 Ga0495604_0506700 3300047317 Bacteria 782
618 Ga0495636_0285376 3300047318 Bacteria 770
619 Ga0495674_0020283 3300047319 Bacteria 6156
620 Ga0495674_0147289 3300047319 Bacteria 1976
621 Ga0495674_1011685 3300047319 Bacteria 636
622 Ga0495674_1179962 3300047319 Bacteria 579
623 Ga0495676_0052017 3300047321 Bacteria 3273
624 Ga0495680_0043435 3300047322 Bacteria 3558
625 Ga0495680_0043739 3300047322 Bacteria 3544
626 Ga0495680_0405959 3300047322 Bacteria 940
627 Ga0495680_0633853 3300047322 Unclassified 712
628 Ga0495683_0080536 3300047323 Bacteria 1589
629 Ga0495683_0293242 3300047323 Bacteria 701
630 Ga0495675_0543739 3300047444 Bacteria 663
631 Ga0495679_035516 3300047446 Bacteria 1579
632 Ga0495679_053683 3300047446 Bacteria 1203
633 Ga0495673_0334578 3300047469 Bacteria 537
634 Ga0495684_0009651 3300047471 Bacteria 7444
635 Ga0495593_0164398 3300047673 Bacteria 1120
636 Ga0495593_0266755 3300047673 Bacteria 857
637 Ga0495602_0044643 3300048088 Bacteria 4018
638 Ga0495602_0520738 3300048088 Bacteria 828
639 Ga0495614_0350207 3300048089 Bacteria 688
640 Ga0495614_0475180 3300048089 Bacteria 593
641 Ga0495615_0003961 3300048090 Bacteria 2537
642 Ga0495626_0095291 3300048091 Bacteria 1304
643 Ga0496100_0001644 3300048903 Bacteria 11067
644 Ga0496100_0004194 3300048903 Bacteria 7604
645 Ga0496100_0162055 3300048903 Bacteria 1604
646 Ga0496100_0169653 3300048903 Bacteria 1570
647 Ga0496100_0345197 3300048903 Bacteria 1123
648 Ga0496100_0998751 3300048903 Bacteria 658
649 Ga0496101_0003477 3300048904 Bacteria 9822
650 Ga0496101_0050372 3300048904 Bacteria 2997
651 Ga0496101_0238102 3300048904 Bacteria 1416
652 Ga0496101_0379643 3300048904 Bacteria 1112
653 Ga0496102_0012207 3300048905 Bacteria 7428
654 Ga0496102_0051311 3300048905 Bacteria 3758
655 Ga0496102_0359672 3300048905 Bacteria 1370
656 Ga0496102_0529062 3300048905 Bacteria 1101
657 Ga0496102_1067814 3300048905 Bacteria 727
658 Ga0496102_1348874 3300048905 Bacteria 632
659 Ga0496102_1551908 3300048905 Bacteria 581
660 Ga0496102_1664422 3300048905 Bacteria 556
661 Ga0496103_0171939 3300048906 Bacteria 1391
662 Ga0496103_0350881 3300048906 Bacteria 949
663 Ga0496103_0801770 3300048906 Bacteria 594
664 Ga0496103_0966676 3300048906 Bacteria 531
665 Ga0496104_0005028 3300048907 Bacteria 11533
666 Ga0496104_0035581 3300048907 Bacteria 4649
667 Ga0496104_0419959 3300048907 Bacteria 1249
668 Ga0496105_0034412 3300048908 Bacteria 4166
669 Ga0496105_0266085 3300048908 Bacteria 1385
670 Ga0496105_1139666 3300048908 Bacteria 577
671 Ga0496106_0058838 3300048909 Bacteria 2910
672 Ga0496106_0090507 3300048909 Bacteria 2361
673 Ga0496106_0180588 3300048909 Bacteria 1675
674 Ga0496106_0364265 3300048909 Bacteria 1161
675 Ga0496106_1214896 3300048909 Bacteria 587
676 Ga0496107_0002997 3300048910 Bacteria 11184
677 Ga0496107_0078687 3300048910 Bacteria 2403
678 Ga0496107_0278432 3300048910 Bacteria 1245
679 Ga0496107_1318254 3300048910 Bacteria 516
680 Ga0496108_0008618 3300048911 Bacteria 8272
681 Ga0496108_0010120 3300048911 Bacteria 7650
682 Ga0496108_0014807 3300048911 Bacteria 6363
683 Ga0496109_0002798 3300048912 Bacteria 14606
684 Ga0496109_0029236 3300048912 Bacteria 4935
685 Ga0496109_0029384 3300048912 Bacteria 4922
686 Ga0496109_0037780 3300048912 Bacteria 4363
687 Ga0496109_0051598 3300048912 Bacteria 3746
688 Ga0496110_0002114 3300048913 Bacteria 14832
689 Ga0496110_0064866 3300048913 Bacteria 3228
690 Ga0496110_0067941 3300048913 Bacteria 3154
691 Ga0496110_0068785 3300048913 Bacteria 3134
692 Ga0496110_0495826 3300048913 Bacteria 1112
693 Ga0496111_0000185 3300048914 Bacteria 28524
694 Ga0496111_0016300 3300048914 Bacteria 5117
695 Ga0496111_0090115 3300048914 Bacteria 2246
696 Ga0496112_0002966 3300048915 Bacteria 13842
697 Ga0496112_0089220 3300048915 Bacteria 3051
698 Ga0496112_0140076 3300048915 Bacteria 2388
699 Ga0496113_0007631 3300048916 Bacteria 6979
700 Ga0496113_0058902 3300048916 Bacteria 2891
701 Ga0496113_0177833 3300048916 Bacteria 1686
702 Ga0496113_0445372 3300048916 Bacteria 1040
703 Ga0496114_0080099 3300048917 Bacteria 2758
704 Ga0496114_0150748 3300048917 Bacteria 2017
705 Ga0496114_0733787 3300048917 Bacteria 864
706 Ga0496114_0854837 3300048917 Bacteria 790
707 Ga0496115_0006955 3300048918 Bacteria 8313
708 Ga0496115_0164026 3300048918 Bacteria 1837
709 Ga0496115_0788038 3300048918 Bacteria 741
710 Ga0496115_0819910 3300048918 Unclassified 723
711 Ga0496119_0457510 3300048922 Bacteria 600
712 Ga0496121_0001675 3300048924 Bacteria 36420
713 Ga0501321_054377 3300049537 Bacteria 592
714 Ga0501325_020662 3300049541 Bacteria 692
715 Ga0501325_030554 3300049541 Bacteria 615
716 Ga0501034_0163164 3300049571 Bacteria 2198
717 Ga0501036_0973367 3300049572 Bacteria 695
718 Ga0501039_0531314 3300049575 Bacteria 923
719 Ga0501039_1285142 3300049575 Bacteria 565
720 Ga0501042_0604235 3300049578 Bacteria 797
721 Ga0501042_1029865 3300049578 Bacteria 600
722 Ga0501048_1296343 3300049582 Bacteria 524
723 Ga0501069_0111446 3300049585 Bacteria 1558
724 Ga0501070_1008359 3300049586 Bacteria 645
725 Ga0501071_0061661 3300049587 Bacteria 2716
726 Ga0501072_0152576 3300049588 Bacteria 1842
727 Ga0501075_0543401 3300049591 Bacteria 887
728 Ga0501076_0236781 3300049592 Bacteria 1493
729 Ga0501227_195651 3300049665 Bacteria 572
730 Ga0501235_083424 3300049669 Bacteria 765
731 Ga0501261_121250 3300049690 Bacteria 518
732 Ga0501079_0822256 3300049741 Bacteria 731
733 Ga0501045_0163567 3300049824 Bacteria 1657
734 nmdc:mga03n38_420181_c1 3300050490 Bacteria 739
735 nmdc:mga05p37_1501513_c1 3300050507 Bacteria 671
736 nmdc:mga05p37_315898_c1 3300050507 Bacteria 1850
737 nmdc:mga09592_13708_c1 3300050508 Bacteria 6623
738 nmdc:mga08y16_1323388_c1 3300050511 Bacteria 686
739 nmdc:mga08y16_177861_c1 3300050511 Bacteria 2210
740 nmdc:mga08y16_1830642_c1 3300050511 Bacteria 559
741 nmdc:mga08y16_718241_c1 3300050511 Bacteria 998
742 nmdc:mga0n895_630336_c1 3300050512 Bacteria 1072
743 nmdc:mga0rr50_1350142_c1 3300050513 Bacteria 604
744 nmdc:mga0rr50_618157_c1 3300050513 Bacteria 924
745 nmdc:mga08x19_545451_c1 3300050514 Bacteria 820
746 Ga0495601_0034756 3300053077 Bacteria 3145
747 Ga0495601_0047884 3300053077 Bacteria 2692
748 Ga0495601_0203645 3300053077 Bacteria 1293
749 Ga0495601_0277422 3300053077 Unclassified 1093
750 Ga0495601_0551577 3300053077 Bacteria 741
751 Ga0495612_0065236 3300053078 Bacteria 1512
752 Ga0495612_0102814 3300053078 Bacteria 1218
753 Ga0495612_0152185 3300053078 Bacteria 1007
754 Ga0495612_0247166 3300053078 Bacteria 793
755 Ga0495612_0312152 3300053078 Bacteria 706
756 Ga0495655_0035537 3300053083 Bacteria 1240
757 Ga0495595_0013555 3300053084 Bacteria 3445
758 Ga0495595_0016498 3300053084 Bacteria 3161
759 Ga0495595_0187151 3300053084 Bacteria 1028
760 Ga0495619_0031879 3300053085 Bacteria 3416
761 Ga0495619_0034726 3300053085 Bacteria 3279
762 Ga0495619_0092314 3300053085 Bacteria 2051
763 Ga0495619_0275148 3300053085 Bacteria 1166
764 Ga0500616_0002848 3300053153 Bacteria 13898
765 Ga0501084_0094564 3300054114 Bacteria 2509
766 Ga0501084_0269052 3300054114 Bacteria 1439
767 Ga0587083_0256314 3300059505 Bacteria 523
768 Ga0587088_043605 3300059508 Bacteria 854
769 Ga0587067_192148 3300059640 Bacteria 538
770 Ga0501082_0837682 3300060353 Bacteria 805
771 Ga0501082_1417714 3300060353 Bacteria 607
772 Ga0466962_0048257 3300061719 Bacteria 2035
773 Ga0466962_0196828 3300061719 Bacteria 984
774 Ga0466962_0299013 3300061719 Bacteria 796
775 Ga0530510_0749925 3300061734 Bacteria 744
776 Ga0530510_1305524 3300061734 Bacteria 557
777 Ga0501307_037620
778 JGI24739J22299_10093945
779 JGI24743J22301_10007681
780 JGI24743J22301_10028830
781 JGI24738J21930_10114927
782 JGI24742J22300_10085312
783 JGI25407J50210_10024633
784 JGI25407J50210_10142449
785 JGI25407J50210_10149462
786 JGI25405J52794_10078973
787 Ga0058861_10015679
788 Ga0058860_10022178
789 Ga0058862_12796079
790 Ga0070658_10509494
791 Ga0070683_100001391
792 Ga0070683_100160734
793 Ga0070683_100277723
794 Ga0070683_101259864
795 Ga0070690_100487690
796 Ga0070670_100851964
797 Ga0070666_10267151
798 Ga0070680_100002155
799 Ga0070682_100194279
800 Ga0068868_101780568
801 Ga0070660_100132584
802 Ga0070691_10811091
803 Ga0070661_100009618
804 Ga0070661_100113817
805 Ga0070661_100708749
806 Ga0070692_10006351
807 Ga0070692_10034413
808 Ga0070692_10111093
809 Ga0070668_100374902
810 Ga0070668_100599148
811 Ga0070669_100757485
812 Ga0070675_100292452
813 Ga0070671_100126851
814 Ga0070674_100030178
815 Ga0070674_101650944
816 Ga0070688_100022393
817 Ga0070688_100448755
818 Ga0070659_100000003
819 Ga0070659_100002960
820 Ga0070659_100623342
821 Ga0070714_100000026
822 Ga0070713_100164386
823 Ga0070710_10000001
824 Ga0070701_10580426
825 Ga0070711_100049544
826 Ga0070711_101093763
827 Ga0070705_100007754
828 Ga0070705_101097133
829 Ga0070708_100076880
830 Ga0070663_101182103
831 Ga0070678_100441113
832 Ga0070681_10001231
833 Ga0070681_11808768
834 Ga0068867_100131151
835 Ga0068867_100226983
836 Ga0068867_100903934
837 Ga0070685_11278549
838 Ga0070679_100000711
839 Ga0070679_100190011
840 Ga0070679_100843447
841 Ga0070679_101419085
842 Ga0070684_100002080
843 Ga0070684_100464873
844 Ga0070684_102180986
845 Ga0068853_100057219
846 Ga0068853_100634872
847 Ga0070672_100651940
848 Ga0070686_100293390
849 Ga0070686_100397057
850 Ga0070696_100775325
851 Ga0070693_100598684
852 Ga0070693_101133736
853 Ga0070665_101554606
854 Ga0070665_102546748
855 Ga0070704_100094727
856 Ga0070704_100270052
857 Ga0068855_100842613
858 Ga0070664_100438260
859 Ga0068857_100045691
860 Ga0068857_100094378
861 Ga0068857_101740488
862 Ga0068854_100070329
863 Ga0068854_100481831
864 Ga0068856_100005492
865 Ga0068856_100303168
866 Ga0068856_102134254
867 Ga0068856_102477390
868 Ga0070702_100043872
869 Ga0068852_100008293
870 Ga0068859_100019710
871 Ga0068864_100157803
872 Ga0068864_100269586
873 Ga0068866_10038257
874 Ga0068866_10248134
875 Ga0068861_100085351
876 Ga0068861_100358230
877 Ga0068861_100486757
878 Ga0068861_100501268
879 Ga0068861_101667520
880 Ga0068851_10633696
881 Ga0068863_101553356
882 Ga0068858_100248751
883 Ga0068860_100073909
884 Ga0068862_100267738
885 Ga0068862_100803317
886 Ga0068862_101644292
887 Ga0081455_10003426
888 Ga0081455_10018753
889 Ga0081538_10000060
890 Ga0081538_10001456
891 Ga0081538_10003118
892 Ga0081538_10007478
893 Ga0081538_10012638
894 Ga0081538_10026825
895 Ga0081538_10077162
896 Ga0081540_1011982
897 Ga0081540_1053658
898 Ga0081539_10003543
899 Ga0081539_10021632
900 Ga0081539_10416807
901 Ga0070717_10000005
902 Ga0070717_10072562
903 Ga0070717_11518555
904 Ga0075363_100245997
905 Ga0075432_10023152
906 Ga0070712_100098134
907 Ga0068871_100222805
908 Ga0068871_100534090
909 Ga0075428_100065212
910 Ga0075434_100742443
911 Ga0068865_100161922
912 Ga0068865_101170956
913 Ga0075436_100787015
914 Ga0097620_100019710
915 Ga0075435_100504870
916 Ga0075435_100600856
917 Ga0075435_101340447
918 Ga0105251_10127110
919 Ga0105250_10115845
920 Ga0105240_10047610
921 Ga0105240_10089991
922 Ga0105240_12009582
923 Ga0111539_10001920
924 Ga0111539_10177432
925 Ga0111539_10742394
926 Ga0105245_10030959
927 Ga0105245_10064131
928 Ga0105245_10093070
929 Ga0105245_11709397
930 Ga0105245_12949380
931 Ga0105247_10163208
932 Ga0114129_10184171
933 Ga0105243_10355294
934 Ga0105243_11043819
935 Ga0105241_10410461
936 Ga0105241_10617700
937 Ga0105241_12586910
938 Ga0105248_10061043
939 Ga0105248_11418233
940 Ga0105237_10020971
941 Ga0105237_10448615
942 Ga0105237_10721370
943 Ga0105237_11853824
944 Ga0105238_10007502
945 Ga0105238_10990884
946 Ga0105238_11367063
947 Ga0105249_10313127
948 Ga0105249_10466702
949 Ga0105249_10833790
950 Ga0105249_11864879
951 Ga0105239_10173716
952 Ga0105239_10288488
953 Ga0105239_10436186
954 Ga0105239_11178760
955 Ga0105239_11435062
956 Ga0105246_10094083
957 Ga0105246_10384148
958 Ga0157340_1006251
959 Ga0157341_1006507
960 Ga0157373_10201443
961 Ga0157373_10458380
962 Ga0157371_10101045
963 Ga0157371_10106013
964 Ga0157371_10620037
965 Ga0157371_10955152
966 Ga0157370_10001322
967 Ga0157369_10010275
968 Ga0157369_11089071
969 Ga0157369_11258517
970 Ga0157374_11663914
971 Ga0157374_12398491
972 Ga0157378_13218796
973 Ga0163162_10033082
974 Ga0163162_10442988
975 Ga0157372_10015106
976 Ga0157372_11583187
977 Ga0157375_10195121
978 Ga0157375_10222955
979 Ga0163163_10292840
980 Ga0157377_10140953
981 Ga0157379_10571393
982 Ga0157376_10017908
983 Ga0157376_10223168
984 Ga0157376_10873551
985 Ga0157376_11679039
986 Ga0182006_1314951
987 Ga0197907_10390394
988 Ga0206356_10295715
989 Ga0206356_11825767
990 Ga0206355_1215879
991 Ga0206355_1368129
992 Ga0206350_10813493
993 Ga0206350_11003310
994 Ga0206350_11499007
995 Ga0206354_10583163
996 Ga0206353_10423714
997 Ga0206353_10566531
998 Ga0154015_1104569
999 Ga0213873_10024775
1000 Ga0213876_10032460
1001 Ga0213875_10149008
1002 Ga0213875_10510091
1003 Ga0224712_10004592
1004 Ga0224712_10175947
1005 Ga0224712_10359270
1006 Ga0207697_10141384
1007 Ga0207692_10000007
1008 Ga0207642_10242650
1009 Ga0207642_10320328
1010 Ga0207642_10511452
1011 Ga0207710_10018517
1012 Ga0207710_10105347
1013 Ga0207688_10038917
1014 Ga0207688_10054087
1015 Ga0207680_11006986
1016 Ga0207699_10043099
1017 Ga0207705_10197819
1018 Ga0207705_10455847
1019 Ga0207654_10435743
1020 Ga0207707_10006815
1021 Ga0207707_11351615
1022 Ga0207695_10072966
1023 Ga0207671_10038515
1024 Ga0207671_10404879
1025 Ga0207693_10000201
1026 Ga0207693_10118971
1027 Ga0207663_10044796
1028 Ga0207663_10797431
1029 Ga0207660_10017016
1030 Ga0207660_11296194
1031 Ga0207662_10114108
1032 Ga0207657_10025191
1033 Ga0207657_10109176
1034 Ga0207649_10116063
1035 Ga0207649_10192411
1036 Ga0207649_10733882
1037 Ga0207649_10773489
1038 Ga0207652_10003473
1039 Ga0207652_10165312
1040 Ga0207646_10750589
1041 Ga0207681_10055507
1042 Ga0207694_10018784
1043 Ga0207694_10692245
1044 Ga0207650_10555603
1045 Ga0207659_10117172
1046 Ga0207687_10072616
1047 Ga0207664_10000012
1048 Ga0207664_10002150
1049 Ga0207664_10430567
1050 Ga0207664_10583689
1051 Ga0207664_10676883
1052 Ga0207644_10090774
1053 Ga0207644_10660392
1054 Ga0207690_10000021
1055 Ga0207690_10017450
1056 Ga0207690_11077473
1057 Ga0207706_10029799
1058 Ga0207706_10393267
1059 Ga0207709_10236488
1060 Ga0207709_10607706
1061 Ga0207670_10199308
1062 Ga0207670_10720729
1063 Ga0207669_10019550
1064 Ga0207669_10123359
1065 Ga0207669_10431345
1066 Ga0207669_10500396
1067 Ga0207704_10185415
1068 Ga0207704_10217236
1069 Ga0207704_10977812
1070 Ga0207665_10665246
1071 Ga0207691_10614579
1072 Ga0207711_10040312
1073 Ga0207711_10087014
1074 Ga0207711_10213338
1075 Ga0207661_10000200
1076 Ga0207661_10085724
1077 Ga0207661_10098148
1078 Ga0207661_10271565
1079 Ga0207661_10412539
1080 Ga0207679_10356321
1081 Ga0207679_11501117
1082 Ga0207667_10776164
1083 Ga0207667_11014549
1084 Ga0207712_10096368
1085 Ga0207712_10582491
1086 Ga0207668_11240464
1087 Ga0207640_10102614
1088 Ga0207640_11160496
1089 Ga0207677_10403762
1090 Ga0207677_11188797
1091 Ga0207703_10125845
1092 Ga0207639_10211586
1093 Ga0207639_10538655
1094 Ga0207639_10760855
1095 Ga0207639_11245228
1096 Ga0207678_10537742
1097 Ga0207678_10615184
1098 Ga0207678_11600092
1099 Ga0207678_11909172
1100 Ga0207708_10102504
1101 Ga0207708_10292490
1102 Ga0207702_10009068
1103 Ga0207702_10600955
1104 Ga0207641_11137445
1105 Ga0207641_11389753
1106 Ga0207648_10048291
1107 Ga0207648_10332296
1108 Ga0207676_10037974
1109 Ga0207676_11673484
1110 Ga0207674_10049789
1111 Ga0207674_10443534
1112 Ga0207674_10734460
1113 Ga0207674_11612089
1114 Ga0207675_100095118
1115 Ga0207675_100131602
1116 Ga0207675_100178402
1117 Ga0207675_100637467
1118 Ga0207683_10750810
1119 Ga0207698_10003965
1120 Ga0207698_10107024
1121 Ga0207698_10198603
1122 Ga0209998_10070703
1123 Ga0207428_10044712
1124 Ga0207428_10408349
1125 Ga0268265_10191028
1126 Ga0268265_11424559
1127 Ga0268264_10068104
1128 Ga0268264_10256269
1129 Ga0265326_10000152
1130 Ga0265319_1003386
1131 Ga0265334_10000186
1132 Ga0265336_10004830
1133 Ga0265338_10012547
1134 Ga0265324_10003134
1135 Ga0265327_10057715
1136 Ga0307408_100027174
1137 Ga0307408_100330374
1138 Ga0307408_100340316
1139 Ga0265314_10300112
1140 Ga0307405_10071556
1141 Ga0307405_11305148
1142 Ga0307413_10353104
1143 Ga0307413_11001600
1144 Ga0307413_11244402
1145 Ga0307410_10693840
1146 Ga0307406_10072986
1147 Ga0307406_10143168
1148 Ga0307407_10290249
1149 Ga0307412_10073458
1150 Ga0307409_100197033
1151 Ga0307416_100032277
1152 Ga0307416_100204372
1153 Ga0307416_100208617
1154 Ga0307414_10177155
1155 Ga0307414_11816501
1156 Ga0307415_100089354
1157 Ga0307415_100186846
1158 Ga0373923_0111367
1159 Ga0373939_0156281
1160 Ga0373939_0253859
1161 Ga0373954_0240956
1162 Ga0373943_0199937
1163 Ga0373946_0144408
1164 Ga0373955_0099814
1165 Ga0373961_0151867
1166 Ga0373961_0223182
1167 Ga0373924_0020719
1168 Ga0373931_0071804
1169 Ga0373931_0624281
1170 Ga0373931_1103681
1171 Ga0373935_0334642
1172 Ga0373927_1186048
1173 Ga0373933_0258126
1174 Ga0373947_0145703
1175 Ga0373937_0245447
1176 Ga0395899_0000773
1177 Ga0395899_0031851
1178 Ga0395900_0002750
1179 Ga0395900_0078603
1180 Ga0395898_0012477
1181 Ga0395898_0029232
1182 Ga0395898_0253306
1183 Ga0395898_0462943
1184 Ga0395898_1860748
1185 Ga0395905_0026171
1186 Ga0395905_1135968
1187 Ga0395905_1616071
1188 Ga0436364_0127227
1189 Ga0436364_0268526
1190 Ga0436364_0390471
1191 Ga0436364_0728382
1192 Ga0436364_0842144
1193 Ga0395901_0041365
1194 Ga0395901_0118300
1195 Ga0436365_0859395
1196 Ga0436365_1296982
1197 Ga0436361_0507712
1198 Ga0436363_0157437
1199 Ga0436363_0187523
1200 Ga0436363_0265144
1201 Ga0436363_0801684
1202 Ga0436363_1070677
1203 Ga0436363_1197930
1204 Ga0436363_1543441
1205 Ga0439466_0061990
1206 Ga0451797_1179173
1207 Ga0451800_1519290
1208 Ga0451853_2976327
1209 Ga0451853_3790887
1210 Ga0439448_0182536
1211 Ga0439463_122189
1212 Ga0439458_0104970
1213 Ga0439434_0143069
1214 Ga0439464_0066833
1215 Ga0466969_0479332
1216 Ga0466965_0251746
1217 Ga0466965_0284555
1218 Ga0466965_0368726
1219 Ga0466965_0530064
1220 Ga0466965_0558858
1221 Ga0466966_0055448
1222 Ga0466966_0061585
1223 Ga0466966_0143156
1224 Ga0466966_0532308
1225 Ga0466961_0018931
1226 Ga0466961_0144826
1227 Ga0466961_0449668
1228 Ga0466963_0007389
1229 Ga0466963_0025385
1230 Ga0466963_0160544
1231 Ga0466963_0928164
1232 Ga0466964_0119574
1233 Ga0466964_0197420
1234 Ga0466971_0068898
1235 Ga0466971_0305616
1236 Ga0466968_0313314
1237 Ga0466968_0349468
1238 Ga0466968_0362507
1239 Ga0466970_0003061
1240 Ga0466970_0266626
1241 Ga0466970_0350511
1242 Ga0466970_0964020
1243 Ga0466957_0049700
1244 Ga0466957_0195334
1245 Ga0466957_0268827
1246 Ga0466957_0478145
1247 Ga0466957_0524269
1248 Ga0466960_0217554
1249 Ga0466960_0284638
1250 Ga0466960_0325442
1251 Ga0466960_0594280
1252 Ga0466960_0997924
1253 Ga0466959_0018570
1254 Ga0466959_0053058
1255 Ga0466959_0087752
1256 Ga0466959_0118769
1257 Ga0466959_0233247
1258 Ga0466959_0316778
1259 Ga0466959_0460259
1260 Ga0466959_0564764
1261 Ga0451576_0874152
1262 Ga0466958_0002441
1263 Ga0466958_0028727
1264 Ga0466958_0066852
1265 Ga0466958_0098330
1266 Ga0466958_0100622
1267 Ga0466958_0151459
1268 Ga0466958_0229887
1269 Ga0466958_0290903
1270 Ga0466958_0737783
1271 Ga0466967_0107036
1272 Ga0466967_0379262
1273 Ga0466967_0457156
1274 Ga0466967_0510255
1275 Ga0466967_0558978
1276 Ga0466967_0692750
1277 Ga0466967_0775273
1278 Ga0466967_0999179
1279 Ga0466967_1077752
1280 Ga0466967_2122204
1281 Ga0495617_126674
1282 Ga0495617_193310
1283 Ga0495592_0112161
1284 Ga0495592_0238789
1285 Ga0495592_0637392
1286 Ga0495603_0268104
1287 Ga0495590_0167434
1288 Ga0495629_0025630
1289 Ga0495629_1087207
1290 Ga0495641_0292642
1291 Ga0495651_0007587
1292 Ga0495651_0008354
1293 Ga0495651_0117439
1294 Ga0495653_0018934
1295 Ga0495653_0170113
1296 Ga0495653_0240306
1297 Ga0495653_0427170
1298 Ga0495580_0729097
1299 Ga0495582_0126384
1300 Ga0495582_0379102
1301 Ga0495582_0520523
1302 Ga0495605_0249273
1303 Ga0495605_0408967
1304 Ga0495639_0275159
1305 Ga0495662_0136084
1306 Ga0495664_0034634
1307 Ga0495664_0307902
1308 Ga0495584_0035807
1309 Ga0495584_0099275
1310 Ga0495585_0046174
1311 Ga0495585_0541132
1312 Ga0495594_0228699
1313 Ga0495596_0274130
1314 Ga0495608_0005979
1315 Ga0495608_0008384
1316 Ga0495608_0931284
1317 Ga0495616_0228472
1318 Ga0495618_0388308
1319 Ga0495618_0691764
1320 Ga0495620_0123248
1321 Ga0495628_0195703
1322 Ga0495628_0495864
1323 Ga0495628_0751312
1324 Ga0495628_0981929
1325 Ga0495630_0008329
1326 Ga0495631_0062256
1327 Ga0495631_0467478
1328 Ga0495632_0307776
1329 Ga0495637_0069614
1330 Ga0495637_0109171
1331 Ga0495644_0081314
1332 Ga0495652_0052576
1333 Ga0495652_0126928
1334 Ga0495652_0171700
1335 Ga0495652_0265009
1336 Ga0495665_0585137
1337 Ga0495665_0702072
1338 Ga0495640_0023164
1339 Ga0495640_0140161
1340 Ga0495640_0495827
1341 Ga0495586_0060872
1342 Ga0495587_0016394
1343 Ga0495587_0100496
1344 Ga0495621_0031714
1345 Ga0495597_0109807
1346 Ga0495645_0326839
1347 Ga0495645_0519431
1348 Ga0495645_0670012
1349 Ga0495645_0840164
1350 Ga0495667_0016146
1351 Ga0495667_0024200
1352 Ga0495667_0125608
1353 Ga0495668_0097031
1354 Ga0495634_0116920
1355 Ga0495634_0239591
1356 Ga0495634_0619012
1357 Ga0495611_0121053
1358 Ga0495635_0043103
1359 Ga0495635_0245949
1360 Ga0495661_0272956
1361 Ga0495588_0208039
1362 Ga0495657_0044016
1363 Ga0495657_0053535
1364 Ga0495657_0174204
1365 Ga0495599_0261831
1366 Ga0495599_0638460
1367 Ga0495623_0098930
1368 Ga0495646_0075708
1369 Ga0495646_0153265
1370 Ga0495646_0457110
1371 Ga0495658_0189590
1372 Ga0495669_0527873
1373 Ga0495613_0100582
1374 Ga0495613_0337897
1375 Ga0495613_0888670
1376 Ga0495624_0095465
1377 Ga0495670_0167843
1378 Ga0495670_0261334
1379 Ga0495670_0354676
1380 Ga0495671_0447131
1381 Ga0495589_0172267
1382 Ga0495589_0232950
1383 Ga0495589_0482639
1384 Ga0495600_0170479
1385 Ga0495600_0172172
1386 Ga0495600_0219741
1387 Ga0495600_0230611
1388 Ga0495660_0414445
1389 Ga0495581_0126907
1390 Ga0495604_0022398
1391 Ga0495604_0029965
1392 Ga0495604_0044393
1393 Ga0495604_0506700
1394 Ga0495636_0285376
1395 Ga0495674_0020283
1396 Ga0495674_0147289
1397 Ga0495674_1011685
1398 Ga0495674_1179962
1399 Ga0495676_0052017
1400 Ga0495680_0043435
1401 Ga0495680_0043739
1402 Ga0495680_0405959
1403 Ga0495680_0633853
1404 Ga0495683_0080536
1405 Ga0495683_0293242
1406 Ga0495675_0543739
1407 Ga0495679_035516
1408 Ga0495679_053683
1409 Ga0495673_0334578
1410 Ga0495684_0009651
1411 Ga0495593_0164398
1412 Ga0495593_0266755
1413 Ga0495602_0044643
1414 Ga0495602_0520738
1415 Ga0495614_0350207
1416 Ga0495614_0475180
1417 Ga0495615_0003961
1418 Ga0495626_0095291
1419 Ga0496100_0001644
1420 Ga0496100_0004194
1421 Ga0496100_0162055
1422 Ga0496100_0169653
1423 Ga0496100_0345197
1424 Ga0496100_0998751
1425 Ga0496101_0003477
1426 Ga0496101_0050372
1427 Ga0496101_0238102
1428 Ga0496101_0379643
1429 Ga0496102_0012207
1430 Ga0496102_0051311
1431 Ga0496102_0359672
1432 Ga0496102_0529062
1433 Ga0496102_1067814
1434 Ga0496102_1348874
1435 Ga0496102_1551908
1436 Ga0496102_1664422
1437 Ga0496103_0171939
1438 Ga0496103_0350881
1439 Ga0496103_0801770
1440 Ga0496103_0966676
1441 Ga0496104_0005028
1442 Ga0496104_0035581
1443 Ga0496104_0419959
1444 Ga0496105_0034412
1445 Ga0496105_0266085
1446 Ga0496105_1139666
1447 Ga0496106_0058838
1448 Ga0496106_0090507
1449 Ga0496106_0180588
1450 Ga0496106_0364265
1451 Ga0496106_1214896
1452 Ga0496107_0002997
1453 Ga0496107_0078687
1454 Ga0496107_0278432
1455 Ga0496107_1318254
1456 Ga0496108_0008618
1457 Ga0496108_0010120
1458 Ga0496108_0014807
1459 Ga0496109_0002798
1460 Ga0496109_0029236
1461 Ga0496109_0029384
1462 Ga0496109_0037780
1463 Ga0496109_0051598
1464 Ga0496110_0002114
1465 Ga0496110_0064866
1466 Ga0496110_0067941
1467 Ga0496110_0068785
1468 Ga0496110_0495826
1469 Ga0496111_0000185
1470 Ga0496111_0016300
1471 Ga0496111_0090115
1472 Ga0496112_0002966
1473 Ga0496112_0089220
1474 Ga0496112_0140076
1475 Ga0496113_0007631
1476 Ga0496113_0058902
1477 Ga0496113_0177833
1478 Ga0496113_0445372
1479 Ga0496114_0080099
1480 Ga0496114_0150748
1481 Ga0496114_0733787
1482 Ga0496114_0854837
1483 Ga0496115_0006955
1484 Ga0496115_0164026
1485 Ga0496115_0788038
1486 Ga0496115_0819910
1487 Ga0496119_0457510
1488 Ga0496121_0001675
1489 Ga0501321_054377
1490 Ga0501325_020662
1491 Ga0501325_030554
1492 Ga0501034_0163164
1493 Ga0501036_0973367
1494 Ga0501039_0531314
1495 Ga0501039_1285142
1496 Ga0501042_0604235
1497 Ga0501042_1029865
1498 Ga0501048_1296343
1499 Ga0501069_0111446
1500 Ga0501070_1008359
1501 Ga0501071_0061661
1502 Ga0501072_0152576
1503 Ga0501075_0543401
1504 Ga0501076_0236781
1505 Ga0501227_195651
1506 Ga0501235_083424
1507 Ga0501261_121250
1508 Ga0501079_0822256
1509 Ga0501045_0163567
1510 nmdc:mga03n38_420181_c1
1511 nmdc:mga05p37_1501513_c1
1512 nmdc:mga05p37_315898_c1
1513 nmdc:mga09592_13708_c1
1514 nmdc:mga08y16_1323388_c1
1515 nmdc:mga08y16_177861_c1
1516 nmdc:mga08y16_1830642_c1
1517 nmdc:mga08y16_718241_c1
1518 nmdc:mga0n895_630336_c1
1519 nmdc:mga0rr50_1350142_c1
1520 nmdc:mga0rr50_618157_c1
1521 nmdc:mga08x19_545451_c1
1522 Ga0495601_0034756
1523 Ga0495601_0047884
1524 Ga0495601_0203645
1525 Ga0495601_0277422
1526 Ga0495601_0551577
1527 Ga0495612_0065236
1528 Ga0495612_0102814
1529 Ga0495612_0152185
1530 Ga0495612_0247166
1531 Ga0495612_0312152
1532 Ga0495655_0035537
1533 Ga0495595_0013555
1534 Ga0495595_0016498
1535 Ga0495595_0187151
1536 Ga0495619_0031879
1537 Ga0495619_0034726
1538 Ga0495619_0092314
1539 Ga0495619_0275148
1540 Ga0500616_0002848
1541 Ga0501084_0094564
1542 Ga0501084_0269052
1543 Ga0587083_0256314
1544 Ga0587088_043605
1545 Ga0587067_192148
1546 Ga0501082_0837682
1547 Ga0501082_1417714
1548 Ga0466962_0048257
1549 Ga0466962_0196828
1550 Ga0466962_0299013
1551 Ga0530510_0749925
1552 Ga0530510_1305524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

26

115

0.94

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

26

126

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bui-assembly1.cif.gz_E complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9383 4 103
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9365 4 105
7bui-assembly1.cif.gz_D complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9297 5 102
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.9286 3 105
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9136 4 105
ID Description Score Start End Superfamily
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.946 4 105 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9434 3 105 2.102.10.10
4nbbE00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9375 4 105 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9365 4 105 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9332 3 103 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A7V9IYB9-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9945 3 105 GO:0046872
GO:0051537
AF-A0A7V9IHD8-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9917 3 104 GO:0046872
GO:0051537
AF-A0A7V8VK16-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9855 1 104 GO:0046872
GO:0051537
AF-A0A538HUX4-F1-model_v4 Rieske 2Fe-2S domain-containing protein 0.9825 1 104 GO:0046872
GO:0051537
AF-A0A7V9IHD8-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9821 3 104 GO:0046872
GO:0051537

Map