F480271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 775 | 321 | 741 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300041509|Ga0451843_1395193|Ga0451843_1395193_1071_1883 |
| Length | 263 |
| Sequence | MAASKAEAGNRTPLMAGNWKLTFDHQQAAHFVQKLAWTLEDAKHDFDAVEVALLPPFTDLRSVQTLVDGDKLQFRYGAQDLSEHDKGAYTGEVSGGMLAKLGCTYAVVGHSERRTVVNAKVKAAYRHGLTPILCVGEGLDVRKSQEHVPHCEQQIDRDLAGITAEQVASIVIAYEPVWAIGTGEVATPEDAQEVCAAIRTRLAGLYSPEIAGGVRILYGGSVKAANVAGIMAQPDVDGALVGGASTDPAEFASIARYRDHKTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 2 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 3 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 4 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 5 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 6 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 7 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 8 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 9 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 10 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 11 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 12 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 13 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 14 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 15 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 16 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 17 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 18 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 19 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 20 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 21 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 22 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 23 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 24 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 25 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 26 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 27 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 28 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 29 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 30 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 31 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 32 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 33 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 34 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 35 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 36 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 37 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 160 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 164 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 165 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 166 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 180 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 181 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 193 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 194 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 197 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 198 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 199 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 200 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 203 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 204 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 205 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 206 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 207 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 208 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 209 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 210 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 286 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 288 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 320 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 321 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.1 |
| Metatranscriptomes | 0.52 |
| Isolates | 4.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.68 |
| Nodule | 0.13 |
| Rhizoplane | 10.19 |
| Rhizosphere | 78.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000241 | 3300000549 | Bacteria | 10041 |
| 2 | JGI24735J21928_10025374 | 3300002067 | Bacteria | 1789 |
| 3 | JGI24738J21930_10004130 | 3300002075 | Bacteria | 3579 |
| 4 | JGI24744J21845_10003101 | 3300002077 | Bacteria | 3407 |
| 5 | Ga0007423J48922_100026 | 3300003285 | Bacteria | 6067 |
| 6 | Ga0007423J48922_100029 | 3300003285 | Bacteria | 3404 |
| 7 | JGI25407J50210_10020881 | 3300003373 | Bacteria | 1703 |
| 8 | Ga0070658_10108699 | 3300005327 | Bacteria | 2295 |
| 9 | Ga0070658_10180206 | 3300005327 | Bacteria | 1778 |
| 10 | Ga0070676_10099639 | 3300005328 | Bacteria | 1793 |
| 11 | Ga0070683_100028647 | 3300005329 | Bacteria | 5035 |
| 12 | Ga0070683_100198245 | 3300005329 | Bacteria | 1906 |
| 13 | Ga0070683_100507177 | 3300005329 | Bacteria | 1153 |
| 14 | Ga0068869_100087538 | 3300005334 | Bacteria | 2337 |
| 15 | Ga0070680_100083184 | 3300005336 | Bacteria | 2643 |
| 16 | Ga0070682_100055635 | 3300005337 | Bacteria | 2486 |
| 17 | Ga0070682_100091053 | 3300005337 | Bacteria | 1995 |
| 18 | Ga0070682_100383418 | 3300005337 | Bacteria | 1058 |
| 19 | Ga0068868_100202380 | 3300005338 | Bacteria | 1656 |
| 20 | Ga0070660_100394953 | 3300005339 | Bacteria | 1143 |
| 21 | Ga0070689_100373282 | 3300005340 | Bacteria | 1201 |
| 22 | Ga0070692_10002700 | 3300005345 | Bacteria | 6953 |
| 23 | Ga0070692_10014659 | 3300005345 | Bacteria | 3689 |
| 24 | Ga0070668_100060446 | 3300005347 | Bacteria | 2934 |
| 25 | Ga0070675_100103827 | 3300005354 | Bacteria | 2397 |
| 26 | Ga0070674_100056117 | 3300005356 | Bacteria | 2730 |
| 27 | Ga0070674_100112604 | 3300005356 | Bacteria | 2000 |
| 28 | Ga0070673_100275094 | 3300005364 | Bacteria | 1475 |
| 29 | Ga0070659_100013602 | 3300005366 | Bacteria | 6062 |
| 30 | Ga0070659_100023295 | 3300005366 | Bacteria | 4738 |
| 31 | Ga0070659_100062050 | 3300005366 | Bacteria | 2954 |
| 32 | Ga0070659_100251874 | 3300005366 | Bacteria | 1464 |
| 33 | Ga0070667_100050900 | 3300005367 | Bacteria | 3491 |
| 34 | Ga0070667_100219563 | 3300005367 | Bacteria | 1692 |
| 35 | Ga0070714_100013479 | 3300005435 | Bacteria | 6551 |
| 36 | Ga0070701_10027670 | 3300005438 | Bacteria | 2780 |
| 37 | Ga0070700_100048768 | 3300005441 | Bacteria | 2626 |
| 38 | Ga0070708_100316500 | 3300005445 | Bacteria | 1470 |
| 39 | Ga0070663_100117139 | 3300005455 | Bacteria | 2009 |
| 40 | Ga0070678_100290557 | 3300005456 | Bacteria | 1386 |
| 41 | Ga0068867_100003083 | 3300005459 | Bacteria | 11743 |
| 42 | Ga0068867_100055185 | 3300005459 | Bacteria | 2937 |
| 43 | Ga0068867_100400648 | 3300005459 | Bacteria | 1157 |
| 44 | Ga0070698_100008110 | 3300005471 | Bacteria | 11352 |
| 45 | Ga0070679_100043095 | 3300005530 | Bacteria | 4495 |
| 46 | Ga0070684_100001477 | 3300005535 | Bacteria | 16957 |
| 47 | Ga0070684_100134421 | 3300005535 | Bacteria | 2233 |
| 48 | Ga0070684_100364623 | 3300005535 | Bacteria | 1330 |
| 49 | Ga0070684_100467158 | 3300005535 | Bacteria | 1167 |
| 50 | Ga0068853_100116035 | 3300005539 | Bacteria | 2384 |
| 51 | Ga0068853_100192805 | 3300005539 | Bacteria | 1852 |
| 52 | Ga0068853_100539853 | 3300005539 | Bacteria | 1104 |
| 53 | Ga0070672_100009022 | 3300005543 | Bacteria | 6856 |
| 54 | Ga0070686_100136762 | 3300005544 | Bacteria | 1701 |
| 55 | Ga0070665_100202474 | 3300005548 | Bacteria | 1985 |
| 56 | Ga0068855_100075566 | 3300005563 | Bacteria | 3912 |
| 57 | Ga0070664_100046261 | 3300005564 | Bacteria | 3676 |
| 58 | Ga0068857_100513532 | 3300005577 | Bacteria | 1125 |
| 59 | Ga0068856_100013092 | 3300005614 | Bacteria | 8034 |
| 60 | Ga0068852_100166849 | 3300005616 | Bacteria | 2061 |
| 61 | Ga0068852_100348298 | 3300005616 | Bacteria | 1446 |
| 62 | Ga0068864_100091213 | 3300005618 | Bacteria | 2687 |
| 63 | Ga0068866_10149273 | 3300005718 | Bacteria | 1352 |
| 64 | Ga0068861_100005561 | 3300005719 | Bacteria | 8537 |
| 65 | Ga0068861_100035396 | 3300005719 | Bacteria | 3698 |
| 66 | Ga0068861_100113898 | 3300005719 | Bacteria | 2171 |
| 67 | Ga0068860_100000490 | 3300005843 | Bacteria | 48926 |
| 68 | Ga0081455_10000389 | 3300005937 | Bacteria | 58107 |
| 69 | Ga0081455_10000462 | 3300005937 | Bacteria | 53037 |
| 70 | Ga0081455_10002237 | 3300005937 | Bacteria | 23049 |
| 71 | Ga0081455_10007912 | 3300005937 | Bacteria | 11128 |
| 72 | Ga0081455_10035251 | 3300005937 | Bacteria | 4474 |
| 73 | Ga0081455_10039452 | 3300005937 | Bacteria | 4173 |
| 74 | Ga0081538_10000092 | 3300005981 | Bacteria | 87123 |
| 75 | Ga0081538_10000958 | 3300005981 | Bacteria | 30846 |
| 76 | Ga0081538_10030060 | 3300005981 | Bacteria | 3697 |
| 77 | Ga0081540_1029003 | 3300005983 | Bacteria | 3093 |
| 78 | Ga0075365_10000677 | 3300006038 | Bacteria | 13683 |
| 79 | Ga0075365_10016366 | 3300006038 | Bacteria | 4509 |
| 80 | Ga0075365_10018410 | 3300006038 | Bacteria | 4293 |
| 81 | Ga0075365_10023828 | 3300006038 | Bacteria | 3853 |
| 82 | Ga0075365_10063538 | 3300006038 | Bacteria | 2472 |
| 83 | Ga0075365_10102854 | 3300006038 | Bacteria | 1958 |
| 84 | Ga0075365_10127904 | 3300006038 | Bacteria | 1757 |
| 85 | Ga0075365_10134122 | 3300006038 | Bacteria | 1715 |
| 86 | Ga0075365_10301673 | 3300006038 | Bacteria | 1127 |
| 87 | Ga0075368_10000261 | 3300006042 | Bacteria | 15132 |
| 88 | Ga0075368_10010386 | 3300006042 | Bacteria | 3365 |
| 89 | Ga0075363_100003243 | 3300006048 | Bacteria | 6878 |
| 90 | Ga0075363_100030888 | 3300006048 | Bacteria | 2775 |
| 91 | Ga0075364_10052499 | 3300006051 | Bacteria | 2664 |
| 92 | Ga0075364_10078519 | 3300006051 | Bacteria | 2180 |
| 93 | Ga0075432_10000058 | 3300006058 | Bacteria | 21877 |
| 94 | Ga0075362_10001939 | 3300006177 | Bacteria | 6799 |
| 95 | Ga0075367_10021645 | 3300006178 | Bacteria | 3596 |
| 96 | Ga0075367_10063602 | 3300006178 | Bacteria | 2206 |
| 97 | Ga0075370_10020511 | 3300006353 | Bacteria | 3614 |
| 98 | Ga0075370_10080619 | 3300006353 | Bacteria | 1870 |
| 99 | Ga0075428_100001925 | 3300006844 | Bacteria | 22274 |
| 100 | Ga0075428_100005267 | 3300006844 | Bacteria | 14385 |
| 101 | Ga0075428_100006278 | 3300006844 | Bacteria | 13214 |
| 102 | Ga0075430_100008725 | 3300006846 | Bacteria | 8556 |
| 103 | Ga0075430_100022049 | 3300006846 | Bacteria | 5414 |
| 104 | Ga0075431_100007939 | 3300006847 | Bacteria | 10578 |
| 105 | Ga0075431_100038789 | 3300006847 | Bacteria | 4908 |
| 106 | Ga0075433_10000219 | 3300006852 | Bacteria | 32497 |
| 107 | Ga0075433_10000698 | 3300006852 | Bacteria | 22940 |
| 108 | Ga0075433_10140536 | 3300006852 | Bacteria | 2146 |
| 109 | Ga0075434_100062096 | 3300006871 | Bacteria | 3719 |
| 110 | Ga0075434_100086091 | 3300006871 | Bacteria | 3142 |
| 111 | Ga0075429_100003147 | 3300006880 | Bacteria | 14017 |
| 112 | Ga0075429_100140024 | 3300006880 | Bacteria | 2118 |
| 113 | Ga0068865_100021028 | 3300006881 | Bacteria | 4240 |
| 114 | Ga0068865_100030955 | 3300006881 | Bacteria | 3563 |
| 115 | Ga0068865_100129921 | 3300006881 | Bacteria | 1886 |
| 116 | Ga0068865_100184051 | 3300006881 | Bacteria | 1611 |
| 117 | Ga0075435_100009410 | 3300007076 | Bacteria | 7072 |
| 118 | Ga0075435_100025910 | 3300007076 | Bacteria | 4570 |
| 119 | Ga0111539_10000761 | 3300009094 | Bacteria | 41945 |
| 120 | Ga0111539_10018138 | 3300009094 | Bacteria | 8717 |
| 121 | Ga0111539_10093674 | 3300009094 | Bacteria | 3528 |
| 122 | Ga0111539_10708063 | 3300009094 | Bacteria | 1172 |
| 123 | Ga0105245_10004528 | 3300009098 | Bacteria | 12274 |
| 124 | Ga0105245_10140867 | 3300009098 | Bacteria | 2271 |
| 125 | Ga0105245_10200037 | 3300009098 | Bacteria | 1918 |
| 126 | Ga0114129_10024763 | 3300009147 | Bacteria | 8508 |
| 127 | Ga0114129_10025297 | 3300009147 | Bacteria | 8411 |
| 128 | Ga0114129_10322865 | 3300009147 | Bacteria | 2052 |
| 129 | Ga0105243_10005196 | 3300009148 | Bacteria | 10187 |
| 130 | Ga0105243_10020623 | 3300009148 | Bacteria | 4997 |
| 131 | Ga0105243_10037006 | 3300009148 | Bacteria | 3790 |
| 132 | Ga0105243_10113163 | 3300009148 | Bacteria | 2275 |
| 133 | Ga0105242_10079298 | 3300009176 | Bacteria | 2742 |
| 134 | Ga0105242_10156328 | 3300009176 | Bacteria | 1992 |
| 135 | Ga0105248_10025656 | 3300009177 | Bacteria | 6554 |
| 136 | Ga0105238_10052181 | 3300009551 | Bacteria | 4111 |
| 137 | Ga0105238_10168125 | 3300009551 | Bacteria | 2169 |
| 138 | Ga0105238_10237316 | 3300009551 | Bacteria | 1801 |
| 139 | Ga0105249_10009986 | 3300009553 | Bacteria | 8327 |
| 140 | Ga0105249_10054015 | 3300009553 | Bacteria | 3672 |
| 141 | Ga0105249_10082506 | 3300009553 | Bacteria | 2991 |
| 142 | Ga0105249_10271503 | 3300009553 | Bacteria | 1690 |
| 143 | Ga0105249_10995299 | 3300009553 | Bacteria | 907 |
| 144 | Ga0105246_10085253 | 3300011119 | Bacteria | 2262 |
| 145 | Ga0105246_10416826 | 3300011119 | Bacteria | 1119 |
| 146 | Ga0157369_10027443 | 3300013105 | Bacteria | 6312 |
| 147 | Ga0157369_10172032 | 3300013105 | Bacteria | 2282 |
| 148 | Ga0157369_10547348 | 3300013105 | Bacteria | 1196 |
| 149 | Ga0157369_10826588 | 3300013105 | Bacteria | 951 |
| 150 | Ga0157374_10273545 | 3300013296 | Bacteria | 1666 |
| 151 | Ga0163162_10011203 | 3300013306 | Bacteria | 8741 |
| 152 | Ga0163162_10061724 | 3300013306 | Bacteria | 3786 |
| 153 | Ga0163162_10810791 | 3300013306 | Bacteria | 1053 |
| 154 | Ga0157372_10278953 | 3300013307 | Bacteria | 1943 |
| 155 | Ga0157372_10300342 | 3300013307 | Bacteria | 1867 |
| 156 | Ga0157372_10357501 | 3300013307 | Bacteria | 1702 |
| 157 | Ga0157375_10048309 | 3300013308 | Bacteria | 4162 |
| 158 | Ga0157375_10109681 | 3300013308 | Bacteria | 2856 |
| 159 | Ga0163163_10037041 | 3300014325 | Bacteria | 4743 |
| 160 | Ga0163163_10177142 | 3300014325 | Bacteria | 2179 |
| 161 | Ga0163163_10308490 | 3300014325 | Bacteria | 1635 |
| 162 | Ga0157380_10004955 | 3300014326 | Bacteria | 9279 |
| 163 | Ga0157380_10027767 | 3300014326 | Bacteria | 4307 |
| 164 | Ga0157380_10152224 | 3300014326 | Bacteria | 2001 |
| 165 | Ga0157380_10210601 | 3300014326 | Bacteria | 1732 |
| 166 | Ga0157380_10331148 | 3300014326 | Bacteria | 1416 |
| 167 | Ga0157380_10472484 | 3300014326 | Bacteria | 1210 |
| 168 | Ga0182008_10102494 | 3300014497 | Bacteria | 1415 |
| 169 | Ga0157377_10051441 | 3300014745 | Bacteria | 2324 |
| 170 | Ga0157377_10070470 | 3300014745 | Bacteria | 2020 |
| 171 | Ga0157376_10230246 | 3300014969 | Bacteria | 1721 |
| 172 | Ga0163161_10003339 | 3300017792 | Bacteria | 11257 |
| 173 | Ga0163161_10141764 | 3300017792 | Bacteria | 1820 |
| 174 | Ga0163161_10207374 | 3300017792 | Bacteria | 1513 |
| 175 | Ga0163161_10271923 | 3300017792 | Bacteria | 1326 |
| 176 | Ga0163161_10497617 | 3300017792 | Bacteria | 992 |
| 177 | Ga0206353_11891153 | 3300020082 | Bacteria | 9416 |
| 178 | Ga0213876_10095160 | 3300021384 | Bacteria | 1578 |
| 179 | Ga0207688_10029422 | 3300025901 | Bacteria | 3024 |
| 180 | Ga0207688_10076258 | 3300025901 | Bacteria | 1909 |
| 181 | Ga0207688_10089026 | 3300025901 | Bacteria | 1770 |
| 182 | Ga0207647_10012752 | 3300025904 | Bacteria | 5841 |
| 183 | Ga0207647_10025112 | 3300025904 | Bacteria | 3921 |
| 184 | Ga0207647_10072892 | 3300025904 | Bacteria | 2070 |
| 185 | Ga0207643_10005142 | 3300025908 | Bacteria | 6998 |
| 186 | Ga0207643_10223833 | 3300025908 | Bacteria | 1152 |
| 187 | Ga0207705_10423181 | 3300025909 | Bacteria | 1031 |
| 188 | Ga0207660_10067758 | 3300025917 | Bacteria | 2586 |
| 189 | Ga0207662_10062504 | 3300025918 | Bacteria | 2238 |
| 190 | Ga0207662_10132783 | 3300025918 | Bacteria | 1571 |
| 191 | Ga0207662_10160643 | 3300025918 | Bacteria | 1435 |
| 192 | Ga0207657_10001763 | 3300025919 | Bacteria | 23366 |
| 193 | Ga0207657_10087902 | 3300025919 | Bacteria | 2599 |
| 194 | Ga0207652_10337513 | 3300025921 | Bacteria | 1360 |
| 195 | Ga0207652_10603986 | 3300025921 | Bacteria | 984 |
| 196 | Ga0207659_10336380 | 3300025926 | Bacteria | 1249 |
| 197 | Ga0207687_10128728 | 3300025927 | Bacteria | 1905 |
| 198 | Ga0207687_10130345 | 3300025927 | Bacteria | 1894 |
| 199 | Ga0207687_10133851 | 3300025927 | Bacteria | 1872 |
| 200 | Ga0207687_10180507 | 3300025927 | Bacteria | 1635 |
| 201 | Ga0207687_10256459 | 3300025927 | Bacteria | 1392 |
| 202 | Ga0207687_10368383 | 3300025927 | Bacteria | 1174 |
| 203 | Ga0207664_10007764 | 3300025929 | Bacteria | 7448 |
| 204 | Ga0207644_10159274 | 3300025931 | Bacteria | 1754 |
| 205 | Ga0207690_10107107 | 3300025932 | Bacteria | 2007 |
| 206 | Ga0207690_10126865 | 3300025932 | Bacteria | 1862 |
| 207 | Ga0207690_10249301 | 3300025932 | Bacteria | 1371 |
| 208 | Ga0207690_10289523 | 3300025932 | Bacteria | 1278 |
| 209 | Ga0207706_10019419 | 3300025933 | Bacteria | 6115 |
| 210 | Ga0207709_10120289 | 3300025935 | Bacteria | 1772 |
| 211 | Ga0207709_10482779 | 3300025935 | Bacteria | 964 |
| 212 | Ga0207669_10124273 | 3300025937 | Bacteria | 1759 |
| 213 | Ga0207704_10019073 | 3300025938 | Bacteria | 3595 |
| 214 | Ga0207704_10095597 | 3300025938 | Bacteria | 1965 |
| 215 | Ga0207691_10001326 | 3300025940 | Bacteria | 24697 |
| 216 | Ga0207691_10392789 | 3300025940 | Bacteria | 1183 |
| 217 | Ga0207691_10413407 | 3300025940 | Bacteria | 1150 |
| 218 | Ga0207689_10098304 | 3300025942 | Bacteria | 2404 |
| 219 | Ga0207661_10172572 | 3300025944 | Bacteria | 1883 |
| 220 | Ga0207661_10323203 | 3300025944 | Bacteria | 1387 |
| 221 | Ga0207679_10012019 | 3300025945 | Bacteria | 5629 |
| 222 | Ga0207679_10714423 | 3300025945 | Bacteria | 910 |
| 223 | Ga0207667_10242704 | 3300025949 | Bacteria | 1843 |
| 224 | Ga0207651_10166275 | 3300025960 | Bacteria | 1735 |
| 225 | Ga0207712_10029400 | 3300025961 | Bacteria | 3686 |
| 226 | Ga0207712_10196338 | 3300025961 | Bacteria | 1597 |
| 227 | Ga0207712_10333832 | 3300025961 | Bacteria | 1255 |
| 228 | Ga0207668_10431852 | 3300025972 | Bacteria | 1120 |
| 229 | Ga0207658_10035146 | 3300025986 | Bacteria | 3588 |
| 230 | Ga0207658_10167902 | 3300025986 | Bacteria | 1805 |
| 231 | Ga0207677_10289530 | 3300026023 | Bacteria | 1348 |
| 232 | Ga0207639_10040091 | 3300026041 | Bacteria | 3494 |
| 233 | Ga0207639_10131561 | 3300026041 | Bacteria | 2072 |
| 234 | Ga0207639_10160167 | 3300026041 | Bacteria | 1895 |
| 235 | Ga0207678_10146413 | 3300026067 | Bacteria | 2016 |
| 236 | Ga0207678_10338638 | 3300026067 | Bacteria | 1296 |
| 237 | Ga0207708_10001578 | 3300026075 | Bacteria | 17017 |
| 238 | Ga0207708_10042287 | 3300026075 | Bacteria | 3474 |
| 239 | Ga0207708_10208368 | 3300026075 | Bacteria | 1562 |
| 240 | Ga0207702_10058589 | 3300026078 | Bacteria | 3278 |
| 241 | Ga0207648_10000901 | 3300026089 | Bacteria | 33502 |
| 242 | Ga0207648_10205336 | 3300026089 | Bacteria | 1748 |
| 243 | Ga0207676_10437749 | 3300026095 | Bacteria | 1230 |
| 244 | Ga0207676_10891979 | 3300026095 | Bacteria | 872 |
| 245 | Ga0207675_100013667 | 3300026118 | Bacteria | 7575 |
| 246 | Ga0207675_100015322 | 3300026118 | Bacteria | 7153 |
| 247 | Ga0207675_100077611 | 3300026118 | Bacteria | 3112 |
| 248 | Ga0207675_100527183 | 3300026118 | Bacteria | 1178 |
| 249 | Ga0207675_100614879 | 3300026118 | Bacteria | 1090 |
| 250 | Ga0207683_10033331 | 3300026121 | Bacteria | 4473 |
| 251 | Ga0207683_10100850 | 3300026121 | Bacteria | 2577 |
| 252 | Ga0207683_10235677 | 3300026121 | Bacteria | 1669 |
| 253 | Ga0207683_10331275 | 3300026121 | Bacteria | 1395 |
| 254 | Ga0207698_10266669 | 3300026142 | Bacteria | 1576 |
| 255 | Ga0207698_10646285 | 3300026142 | Bacteria | 1047 |
| 256 | Ga0209813_10002911 | 3300027866 | Bacteria | 3963 |
| 257 | Ga0209813_10007472 | 3300027866 | Bacteria | 2725 |
| 258 | Ga0207428_10000762 | 3300027907 | Bacteria | 36710 |
| 259 | Ga0207428_10002987 | 3300027907 | Bacteria | 16703 |
| 260 | Ga0207428_10010257 | 3300027907 | Bacteria | 8374 |
| 261 | Ga0268266_10000855 | 3300028379 | Bacteria | 39694 |
| 262 | Ga0268266_10115839 | 3300028379 | Bacteria | 2380 |
| 263 | Ga0268264_10000155 | 3300028381 | Bacteria | 156029 |
| 264 | Ga0314311_1057189 | 3300030733 | Bacteria | 1676 |
| 265 | Ga0265340_10006814 | 3300031247 | Bacteria | 6251 |
| 266 | Ga0307513_10004391 | 3300031456 | Bacteria | 18827 |
| 267 | Ga0307408_100062770 | 3300031548 | Bacteria | 2716 |
| 268 | Ga0307408_100135038 | 3300031548 | Bacteria | 1929 |
| 269 | Ga0307408_100167735 | 3300031548 | Bacteria | 1750 |
| 270 | Ga0316575_10000376 | 3300031665 | Bacteria | 12717 |
| 271 | Ga0316575_10038672 | 3300031665 | Bacteria | 1882 |
| 272 | Ga0316579_10000033 | 3300031691 | Bacteria | 31437 |
| 273 | Ga0316579_10000355 | 3300031691 | Bacteria | 14402 |
| 274 | Ga0316579_10005298 | 3300031691 | Bacteria | 5194 |
| 275 | Ga0316576_10001640 | 3300031727 | Bacteria | 12249 |
| 276 | Ga0316578_10001217 | 3300031728 | Bacteria | 10223 |
| 277 | Ga0316578_10157706 | 3300031728 | Bacteria | 1367 |
| 278 | Ga0307405_10010077 | 3300031731 | Bacteria | 4876 |
| 279 | Ga0307405_10094581 | 3300031731 | Bacteria | 1988 |
| 280 | Ga0316577_10011722 | 3300031733 | Bacteria | 4755 |
| 281 | Ga0316577_10090677 | 3300031733 | Bacteria | 1711 |
| 282 | Ga0307413_10002548 | 3300031824 | Bacteria | 7439 |
| 283 | Ga0307413_10055842 | 3300031824 | Bacteria | 2405 |
| 284 | Ga0307410_10000645 | 3300031852 | Bacteria | 14372 |
| 285 | Ga0307410_10006401 | 3300031852 | Bacteria | 6353 |
| 286 | Ga0307410_10007372 | 3300031852 | Bacteria | 6018 |
| 287 | Ga0307410_10070418 | 3300031852 | Bacteria | 2423 |
| 288 | Ga0307406_10000359 | 3300031901 | Bacteria | 26657 |
| 289 | Ga0307406_10012203 | 3300031901 | Bacteria | 4895 |
| 290 | Ga0307406_10151671 | 3300031901 | Bacteria | 1654 |
| 291 | Ga0307407_10012934 | 3300031903 | Bacteria | 4031 |
| 292 | Ga0307407_10020726 | 3300031903 | Bacteria | 3374 |
| 293 | Ga0307412_10059763 | 3300031911 | Bacteria | 2556 |
| 294 | Ga0307412_10067640 | 3300031911 | Bacteria | 2426 |
| 295 | Ga0307412_10207975 | 3300031911 | Bacteria | 1491 |
| 296 | Ga0307409_100000241 | 3300031995 | Bacteria | 22011 |
| 297 | Ga0307409_100001043 | 3300031995 | Bacteria | 13011 |
| 298 | Ga0307409_100035422 | 3300031995 | Bacteria | 3657 |
| 299 | Ga0307409_100040532 | 3300031995 | Bacteria | 3469 |
| 300 | Ga0307409_100041734 | 3300031995 | Bacteria | 3430 |
| 301 | Ga0307409_100078462 | 3300031995 | Bacteria | 2657 |
| 302 | Ga0307409_100078800 | 3300031995 | Bacteria | 2652 |
| 303 | Ga0307409_100110479 | 3300031995 | Bacteria | 2304 |
| 304 | Ga0307409_100150632 | 3300031995 | Bacteria | 2019 |
| 305 | Ga0307409_100151305 | 3300031995 | Bacteria | 2015 |
| 306 | Ga0307409_100287645 | 3300031995 | Bacteria | 1522 |
| 307 | Ga0307409_100599072 | 3300031995 | Bacteria | 1089 |
| 308 | Ga0307416_100000776 | 3300032002 | Bacteria | 16772 |
| 309 | Ga0307416_100083322 | 3300032002 | Bacteria | 2712 |
| 310 | Ga0307416_100134636 | 3300032002 | Bacteria | 2233 |
| 311 | Ga0307416_100154824 | 3300032002 | Bacteria | 2108 |
| 312 | Ga0307416_100516406 | 3300032002 | Bacteria | 1262 |
| 313 | Ga0307416_100888235 | 3300032002 | Bacteria | 991 |
| 314 | Ga0307416_100959530 | 3300032002 | Bacteria | 957 |
| 315 | Ga0307414_10004139 | 3300032004 | Bacteria | 7832 |
| 316 | Ga0307414_10011016 | 3300032004 | Bacteria | 5284 |
| 317 | Ga0307414_10456763 | 3300032004 | Bacteria | 1122 |
| 318 | Ga0307411_10008334 | 3300032005 | Bacteria | 5361 |
| 319 | Ga0307411_10031205 | 3300032005 | Bacteria | 3275 |
| 320 | Ga0307411_10252467 | 3300032005 | Bacteria | 1388 |
| 321 | Ga0307415_100000728 | 3300032126 | Bacteria | 14755 |
| 322 | Ga0307415_100019312 | 3300032126 | Bacteria | 4136 |
| 323 | Ga0307415_100029261 | 3300032126 | Bacteria | 3518 |
| 324 | Ga0316585_10003116 | 3300032137 | Bacteria | 4527 |
| 325 | Ga0316585_10009466 | 3300032137 | Bacteria | 2844 |
| 326 | Ga0316580_10003372 | 3300032139 | Bacteria | 4528 |
| 327 | Ga0316580_10003712 | 3300032139 | Bacteria | 4370 |
| 328 | Ga0316593_10009264 | 3300032168 | Bacteria | 2774 |
| 329 | Ga0316574_0000549 | 3300035398 | Bacteria | 15524 |
| 330 | Ga0316574_0006380 | 3300035398 | Bacteria | 6372 |
| 331 | Ga0373931_0039381 | 3300035691 | Bacteria | 2477 |
| 332 | Ga0316582_0000779 | 3300036647 | Bacteria | 12851 |
| 333 | Ga0316582_0004670 | 3300036647 | Bacteria | 6957 |
| 334 | Ga0316584_0015028 | 3300036712 | Bacteria | 5529 |
| 335 | Ga0373925_0609984 | 3300037068 | Bacteria | 899 |
| 336 | Ga0395899_0014501 | 3300037312 | Bacteria | 6016 |
| 337 | Ga0395900_0079027 | 3300037418 | Bacteria | 3380 |
| 338 | Ga0395900_0117332 | 3300037418 | Bacteria | 2731 |
| 339 | Ga0395900_0169233 | 3300037418 | Bacteria | 2225 |
| 340 | Ga0395900_0300749 | 3300037418 | Bacteria | 1591 |
| 341 | Ga0395900_0325271 | 3300037418 | Bacteria | 1517 |
| 342 | Ga0395900_0419699 | 3300037418 | Bacteria | 1299 |
| 343 | Ga0395900_0754715 | 3300037418 | Bacteria | 903 |
| 344 | Ga0395898_0140478 | 3300037466 | Bacteria | 2312 |
| 345 | Ga0395898_0241060 | 3300037466 | Bacteria | 1724 |
| 346 | Ga0395898_0375199 | 3300037466 | Bacteria | 1356 |
| 347 | Ga0395905_0034140 | 3300037471 | Bacteria | 4776 |
| 348 | Ga0395905_0093881 | 3300037471 | Bacteria | 2814 |
| 349 | Ga0395905_0108491 | 3300037471 | Bacteria | 2606 |
| 350 | Ga0395901_0018915 | 3300038443 | Bacteria | 7042 |
| 351 | Ga0395901_0027733 | 3300038443 | Bacteria | 5822 |
| 352 | Ga0395901_0200091 | 3300038443 | Bacteria | 2094 |
| 353 | Ga0395901_0909266 | 3300038443 | Bacteria | 861 |
| 354 | Ga0400485_22276 | 3300038735 | Bacteria | 21860 |
| 355 | Ga0400488_09508 | 3300038741 | Bacteria | 1944 |
| 356 | Ga0400486_20001 | 3300038742 | Bacteria | 106597 |
| 357 | Ga0436365_1153546 | 3300039437 | Bacteria | 2434 |
| 358 | Ga0439466_0088929 | 3300041411 | Bacteria | 969 |
| 359 | Ga0451835_0652863 | 3300041492 | Bacteria | 1413 |
| 360 | Ga0451837_0251532 | 3300041494 | Bacteria | 2706 |
| 361 | Ga0451837_0412095 | 3300041494 | Bacteria | 4667 |
| 362 | Ga0451839_0951328 | 3300041496 | Bacteria | 3233 |
| 363 | Ga0451843_1395193 | 3300041509 | Bacteria | 2540 |
| 364 | Ga0451843_1761125 | 3300041509 | Bacteria | 1066 |
| 365 | Ga0451853_0197664 | 3300041512 | Bacteria | 5249 |
| 366 | Ga0451853_1182483 | 3300041512 | Bacteria | 1199 |
| 367 | Ga0451853_3166378 | 3300041512 | Bacteria | 2096 |
| 368 | Ga0439431_0005845 | 3300041997 | Bacteria | 2718 |
| 369 | Ga0439445_0014730 | 3300042004 | Bacteria | 1908 |
| 370 | Ga0439448_0015915 | 3300042005 | Bacteria | 2284 |
| 371 | Ga0439457_023294 | 3300042014 | Bacteria | 1370 |
| 372 | Ga0439463_008813 | 3300042016 | Bacteria | 2482 |
| 373 | Ga0439446_0026025 | 3300042156 | Bacteria | 1674 |
| 374 | Ga0439434_0005938 | 3300042435 | Bacteria | 3565 |
| 375 | Ga0439464_0016034 | 3300042439 | Bacteria | 2025 |
| 376 | Ga0439460_0057403 | 3300042461 | Bacteria | 1181 |
| 377 | Ga0466969_0076767 | 3300044656 | Bacteria | 1599 |
| 378 | Ga0466972_0030057 | 3300044658 | Bacteria | 2675 |
| 379 | Ga0466972_0055080 | 3300044658 | Bacteria | 1913 |
| 380 | Ga0466972_0073388 | 3300044658 | Bacteria | 1631 |
| 381 | Ga0466965_0001100 | 3300044683 | Bacteria | 10535 |
| 382 | Ga0466965_0009959 | 3300044683 | Bacteria | 4423 |
| 383 | Ga0466965_0036712 | 3300044683 | Bacteria | 2404 |
| 384 | Ga0466965_0041162 | 3300044683 | Bacteria | 2276 |
| 385 | Ga0466965_0048699 | 3300044683 | Bacteria | 2100 |
| 386 | Ga0466965_0051632 | 3300044683 | Bacteria | 2040 |
| 387 | Ga0466966_0060991 | 3300044684 | Bacteria | 2379 |
| 388 | Ga0466966_0088437 | 3300044684 | Bacteria | 1925 |
| 389 | Ga0466966_0095695 | 3300044684 | Bacteria | 1839 |
| 390 | Ga0466966_0200383 | 3300044684 | Bacteria | 1208 |
| 391 | Ga0466966_0340039 | 3300044684 | Bacteria | 902 |
| 392 | Ga0466961_0060902 | 3300044693 | Bacteria | 2400 |
| 393 | Ga0466961_0124038 | 3300044693 | Bacteria | 1621 |
| 394 | Ga0466961_0163831 | 3300044693 | Bacteria | 1385 |
| 395 | Ga0466961_0336385 | 3300044693 | Bacteria | 920 |
| 396 | Ga0466963_0029911 | 3300044694 | Bacteria | 3509 |
| 397 | Ga0466963_0110244 | 3300044694 | Bacteria | 1889 |
| 398 | Ga0466963_0122025 | 3300044694 | Bacteria | 1794 |
| 399 | Ga0466964_0014052 | 3300044706 | Bacteria | 3042 |
| 400 | Ga0466964_0111170 | 3300044706 | Bacteria | 1222 |
| 401 | Ga0466971_0043653 | 3300044719 | Bacteria | 2014 |
| 402 | Ga0466971_0050259 | 3300044719 | Bacteria | 1876 |
| 403 | Ga0466971_0059250 | 3300044719 | Bacteria | 1729 |
| 404 | Ga0466971_0071171 | 3300044719 | Bacteria | 1580 |
| 405 | Ga0466970_0032404 | 3300044765 | Bacteria | 2761 |
| 406 | Ga0466970_0050536 | 3300044765 | Bacteria | 2217 |
| 407 | Ga0466970_0071539 | 3300044765 | Bacteria | 1866 |
| 408 | Ga0466970_0086758 | 3300044765 | Bacteria | 1696 |
| 409 | Ga0466970_0115917 | 3300044765 | Bacteria | 1465 |
| 410 | Ga0466970_0164061 | 3300044765 | Bacteria | 1229 |
| 411 | Ga0466957_0062646 | 3300044842 | Bacteria | 2285 |
| 412 | Ga0466957_0258150 | 3300044842 | Bacteria | 1160 |
| 413 | Ga0466957_0457894 | 3300044842 | Bacteria | 880 |
| 414 | Ga0466960_0001507 | 3300044901 | Bacteria | 8479 |
| 415 | Ga0466960_0002211 | 3300044901 | Bacteria | 7261 |
| 416 | Ga0466960_0012753 | 3300044901 | Bacteria | 3555 |
| 417 | Ga0466960_0026422 | 3300044901 | Bacteria | 2637 |
| 418 | Ga0466960_0034970 | 3300044901 | Bacteria | 2344 |
| 419 | Ga0466960_0047606 | 3300044901 | Bacteria | 2057 |
| 420 | Ga0466960_0083334 | 3300044901 | Bacteria | 1616 |
| 421 | Ga0466960_0114095 | 3300044901 | Bacteria | 1407 |
| 422 | Ga0466960_0197611 | 3300044901 | Bacteria | 1097 |
| 423 | Ga0466960_0376094 | 3300044901 | Bacteria | 814 |
| 424 | Ga0466959_0043735 | 3300045049 | Bacteria | 3300 |
| 425 | Ga0466959_0222881 | 3300045049 | Bacteria | 1307 |
| 426 | Ga0466959_0485068 | 3300045049 | Bacteria | 836 |
| 427 | Ga0451576_0018962 | 3300045051 | Bacteria | 7516 |
| 428 | Ga0466958_0054616 | 3300045836 | Bacteria | 2422 |
| 429 | Ga0466958_0073838 | 3300045836 | Bacteria | 2089 |
| 430 | Ga0466958_0187231 | 3300045836 | Bacteria | 1315 |
| 431 | Ga0466967_0008910 | 3300045976 | Bacteria | 7404 |
| 432 | Ga0466967_0018579 | 3300045976 | Bacteria | 5561 |
| 433 | Ga0466967_0037567 | 3300045976 | Bacteria | 4145 |
| 434 | Ga0466967_0090190 | 3300045976 | Bacteria | 2784 |
| 435 | Ga0466967_0163412 | 3300045976 | Bacteria | 2091 |
| 436 | Ga0466967_0231488 | 3300045976 | Bacteria | 1759 |
| 437 | Ga0466967_0250665 | 3300045976 | Bacteria | 1691 |
| 438 | Ga0466967_0595940 | 3300045976 | Bacteria | 1090 |
| 439 | Ga0466967_0828343 | 3300045976 | Bacteria | 919 |
| 440 | Ga0495627_017388 | 3300046453 | Bacteria | 2444 |
| 441 | Ga0495592_0179842 | 3300046454 | Bacteria | 1441 |
| 442 | Ga0495590_0041831 | 3300046457 | Bacteria | 1598 |
| 443 | Ga0495641_0062082 | 3300046461 | Bacteria | 1686 |
| 444 | Ga0495651_0221009 | 3300046462 | Bacteria | 1311 |
| 445 | Ga0495653_0003372 | 3300046463 | Bacteria | 12843 |
| 446 | Ga0495620_0034517 | 3300046515 | Bacteria | 2284 |
| 447 | Ga0495632_0124754 | 3300046519 | Bacteria | 1201 |
| 448 | Ga0495665_0213138 | 3300046531 | Bacteria | 1000 |
| 449 | Ga0495586_0314972 | 3300046535 | Bacteria | 897 |
| 450 | Ga0495656_0092515 | 3300046615 | Bacteria | 1385 |
| 451 | Ga0495668_0075966 | 3300046616 | Bacteria | 1845 |
| 452 | Ga0495674_0359852 | 3300047319 | Bacteria | 1180 |
| 453 | Ga0495676_0443342 | 3300047321 | Bacteria | 857 |
| 454 | Ga0496100_0000374 | 3300048903 | Bacteria | 21787 |
| 455 | Ga0496100_0041446 | 3300048903 | Bacteria | 2935 |
| 456 | Ga0496100_0103656 | 3300048903 | Bacteria | 1964 |
| 457 | Ga0496100_0397986 | 3300048903 | Bacteria | 1048 |
| 458 | Ga0496101_0066073 | 3300048904 | Bacteria | 2637 |
| 459 | Ga0496101_0079801 | 3300048904 | Bacteria | 2416 |
| 460 | Ga0496101_0169126 | 3300048904 | Bacteria | 1679 |
| 461 | Ga0496102_0006762 | 3300048905 | Bacteria | 9792 |
| 462 | Ga0496102_0008565 | 3300048905 | Bacteria | 8772 |
| 463 | Ga0496102_0009142 | 3300048905 | Bacteria | 8499 |
| 464 | Ga0496102_0035726 | 3300048905 | Bacteria | 4475 |
| 465 | Ga0496102_0229456 | 3300048905 | Bacteria | 1750 |
| 466 | Ga0496102_0254003 | 3300048905 | Bacteria | 1657 |
| 467 | Ga0496102_0512265 | 3300048905 | Bacteria | 1122 |
| 468 | Ga0496103_0025323 | 3300048906 | Bacteria | 3585 |
| 469 | Ga0496103_0034012 | 3300048906 | Bacteria | 3116 |
| 470 | Ga0496103_0060371 | 3300048906 | Bacteria | 2357 |
| 471 | Ga0496103_0087483 | 3300048906 | Bacteria | 1964 |
| 472 | Ga0496103_0340291 | 3300048906 | Bacteria | 965 |
| 473 | Ga0496104_0001885 | 3300048907 | Bacteria | 18176 |
| 474 | Ga0496104_0025182 | 3300048907 | Bacteria | 5483 |
| 475 | Ga0496104_0094935 | 3300048907 | Bacteria | 2853 |
| 476 | Ga0496104_0137073 | 3300048907 | Bacteria | 2351 |
| 477 | Ga0496104_0548376 | 3300048907 | Bacteria | 1067 |
| 478 | Ga0496104_0609769 | 3300048907 | Bacteria | 1001 |
| 479 | Ga0496105_0000343 | 3300048908 | Bacteria | 30543 |
| 480 | Ga0496105_0004871 | 3300048908 | Bacteria | 10137 |
| 481 | Ga0496105_0034203 | 3300048908 | Bacteria | 4179 |
| 482 | Ga0496105_0049207 | 3300048908 | Bacteria | 3479 |
| 483 | Ga0496105_0200332 | 3300048908 | Bacteria | 1629 |
| 484 | Ga0496106_0006613 | 3300048909 | Bacteria | 8578 |
| 485 | Ga0496106_0178993 | 3300048909 | Bacteria | 1683 |
| 486 | Ga0496106_0349852 | 3300048909 | Bacteria | 1187 |
| 487 | Ga0496106_0361401 | 3300048909 | Bacteria | 1166 |
| 488 | Ga0496107_0048983 | 3300048910 | Bacteria | 3044 |
| 489 | Ga0496107_0327624 | 3300048910 | Bacteria | 1140 |
| 490 | Ga0496107_0643730 | 3300048910 | Bacteria | 782 |
| 491 | Ga0496108_0025707 | 3300048911 | Bacteria | 4854 |
| 492 | Ga0496108_0079113 | 3300048911 | Bacteria | 2783 |
| 493 | Ga0496108_0113661 | 3300048911 | Bacteria | 2317 |
| 494 | Ga0496108_0171337 | 3300048911 | Bacteria | 1878 |
| 495 | Ga0496108_0207548 | 3300048911 | Bacteria | 1700 |
| 496 | Ga0496109_0014363 | 3300048912 | Bacteria | 6891 |
| 497 | Ga0496109_0015105 | 3300048912 | Bacteria | 6721 |
| 498 | Ga0496109_0063347 | 3300048912 | Bacteria | 3382 |
| 499 | Ga0496109_0109916 | 3300048912 | Bacteria | 2563 |
| 500 | Ga0496109_0141538 | 3300048912 | Bacteria | 2249 |
| 501 | Ga0496110_0006701 | 3300048913 | Bacteria | 9157 |
| 502 | Ga0496110_0016549 | 3300048913 | Bacteria | 6158 |
| 503 | Ga0496110_0024390 | 3300048913 | Bacteria | 5155 |
| 504 | Ga0496110_0026885 | 3300048913 | Bacteria | 4928 |
| 505 | Ga0496110_0041099 | 3300048913 | Bacteria | 4033 |
| 506 | Ga0496110_0158543 | 3300048913 | Bacteria | 2051 |
| 507 | Ga0496110_0203886 | 3300048913 | Bacteria | 1797 |
| 508 | Ga0496110_0205461 | 3300048913 | Bacteria | 1790 |
| 509 | Ga0496110_0250735 | 3300048913 | Bacteria | 1611 |
| 510 | Ga0496110_0302443 | 3300048913 | Bacteria | 1457 |
| 511 | Ga0496110_0360402 | 3300048913 | Bacteria | 1325 |
| 512 | Ga0496111_0044439 | 3300048914 | Bacteria | 3193 |
| 513 | Ga0496111_0097649 | 3300048914 | Bacteria | 2156 |
| 514 | Ga0496111_0113004 | 3300048914 | Bacteria | 2001 |
| 515 | Ga0496111_0149059 | 3300048914 | Bacteria | 1735 |
| 516 | Ga0496112_0256413 | 3300048915 | Bacteria | 1699 |
| 517 | Ga0496113_0165252 | 3300048916 | Bacteria | 1751 |
| 518 | Ga0496113_0174745 | 3300048916 | Bacteria | 1702 |
| 519 | Ga0496113_0200997 | 3300048916 | Bacteria | 1584 |
| 520 | Ga0496113_0359310 | 3300048916 | Bacteria | 1168 |
| 521 | Ga0496114_0001386 | 3300048917 | Bacteria | 18369 |
| 522 | Ga0496114_0004950 | 3300048917 | Bacteria | 10386 |
| 523 | Ga0496114_0006813 | 3300048917 | Bacteria | 8998 |
| 524 | Ga0496114_0015556 | 3300048917 | Bacteria | 6116 |
| 525 | Ga0496114_0023486 | 3300048917 | Bacteria | 5032 |
| 526 | Ga0496114_0038855 | 3300048917 | Bacteria | 3938 |
| 527 | Ga0496114_0186050 | 3300048917 | Bacteria | 1815 |
| 528 | Ga0496114_0274934 | 3300048917 | Bacteria | 1484 |
| 529 | Ga0496114_0290830 | 3300048917 | Bacteria | 1441 |
| 530 | Ga0496114_0525529 | 3300048917 | Bacteria | 1046 |
| 531 | Ga0496114_0776492 | 3300048917 | Bacteria | 836 |
| 532 | Ga0496115_0008918 | 3300048918 | Bacteria | 7437 |
| 533 | Ga0496124_0065792 | 3300048927 | Bacteria | 3021 |
| 534 | Ga0496126_0139088 | 3300048929 | Bacteria | 2092 |
| 535 | Ga0501291_010049 | 3300049514 | Bacteria | 1340 |
| 536 | Ga0501031_0001919 | 3300049568 | Bacteria | 13105 |
| 537 | Ga0501031_0013782 | 3300049568 | Bacteria | 5269 |
| 538 | Ga0501031_0090194 | 3300049568 | Bacteria | 1999 |
| 539 | Ga0501031_0090304 | 3300049568 | Bacteria | 1998 |
| 540 | Ga0501031_0117188 | 3300049568 | Bacteria | 1740 |
| 541 | Ga0501031_0121470 | 3300049568 | Bacteria | 1707 |
| 542 | Ga0501031_0312387 | 3300049568 | Bacteria | 1018 |
| 543 | Ga0501032_0014184 | 3300049569 | Bacteria | 5645 |
| 544 | Ga0501032_0057252 | 3300049569 | Bacteria | 2619 |
| 545 | Ga0501032_0085286 | 3300049569 | Bacteria | 2100 |
| 546 | Ga0501032_0130275 | 3300049569 | Bacteria | 1660 |
| 547 | Ga0501032_0133184 | 3300049569 | Bacteria | 1639 |
| 548 | Ga0501033_0002769 | 3300049570 | Bacteria | 14705 |
| 549 | Ga0501033_0004714 | 3300049570 | Bacteria | 10913 |
| 550 | Ga0501033_0151606 | 3300049570 | Bacteria | 1672 |
| 551 | Ga0501034_0005406 | 3300049571 | Bacteria | 13967 |
| 552 | Ga0501034_0011552 | 3300049571 | Bacteria | 9147 |
| 553 | Ga0501034_0016438 | 3300049571 | Bacteria | 7594 |
| 554 | Ga0501034_0041505 | 3300049571 | Bacteria | 4655 |
| 555 | Ga0501034_0266027 | 3300049571 | Bacteria | 1656 |
| 556 | Ga0501034_0742066 | 3300049571 | Bacteria | 878 |
| 557 | Ga0501036_0002680 | 3300049572 | Bacteria | 14045 |
| 558 | Ga0501036_0009496 | 3300049572 | Bacteria | 8003 |
| 559 | Ga0501036_0032559 | 3300049572 | Bacteria | 4405 |
| 560 | Ga0501036_0224731 | 3300049572 | Bacteria | 1576 |
| 561 | Ga0501036_0235492 | 3300049572 | Bacteria | 1536 |
| 562 | Ga0501036_0267558 | 3300049572 | Bacteria | 1431 |
| 563 | Ga0501037_0018718 | 3300049573 | Bacteria | 5103 |
| 564 | Ga0501037_0028809 | 3300049573 | Bacteria | 4103 |
| 565 | Ga0501037_0088589 | 3300049573 | Bacteria | 2240 |
| 566 | Ga0501038_0000969 | 3300049574 | Bacteria | 25734 |
| 567 | Ga0501038_0003720 | 3300049574 | Bacteria | 14211 |
| 568 | Ga0501038_0009754 | 3300049574 | Bacteria | 8803 |
| 569 | Ga0501038_0012946 | 3300049574 | Bacteria | 7610 |
| 570 | Ga0501038_0017662 | 3300049574 | Bacteria | 6448 |
| 571 | Ga0501038_0302739 | 3300049574 | Bacteria | 1254 |
| 572 | Ga0501039_0025011 | 3300049575 | Bacteria | 4585 |
| 573 | Ga0501039_0146212 | 3300049575 | Bacteria | 1857 |
| 574 | Ga0501039_0277384 | 3300049575 | Bacteria | 1318 |
| 575 | Ga0501040_0004774 | 3300049576 | Bacteria | 8792 |
| 576 | Ga0501041_0001143 | 3300049577 | Bacteria | 14519 |
| 577 | Ga0501041_0074115 | 3300049577 | Bacteria | 2091 |
| 578 | Ga0501041_0139130 | 3300049577 | Bacteria | 1514 |
| 579 | Ga0501041_0178575 | 3300049577 | Bacteria | 1329 |
| 580 | Ga0501042_0014278 | 3300049578 | Bacteria | 5420 |
| 581 | Ga0501042_0020536 | 3300049578 | Bacteria | 4598 |
| 582 | Ga0501042_0039243 | 3300049578 | Bacteria | 3364 |
| 583 | Ga0501042_0080019 | 3300049578 | Bacteria | 2341 |
| 584 | Ga0501042_0087679 | 3300049578 | Bacteria | 2233 |
| 585 | Ga0501042_0106122 | 3300049578 | Bacteria | 2022 |
| 586 | Ga0501042_0357083 | 3300049578 | Bacteria | 1057 |
| 587 | Ga0501042_0418483 | 3300049578 | Bacteria | 971 |
| 588 | Ga0501043_0016176 | 3300049579 | Bacteria | 5851 |
| 589 | Ga0501043_0019591 | 3300049579 | Bacteria | 5310 |
| 590 | Ga0501043_0053189 | 3300049579 | Bacteria | 3180 |
| 591 | Ga0501043_0181884 | 3300049579 | Bacteria | 1638 |
| 592 | Ga0501043_0281171 | 3300049579 | Bacteria | 1275 |
| 593 | Ga0501046_0010494 | 3300049580 | Bacteria | 7950 |
| 594 | Ga0501046_0021536 | 3300049580 | Bacteria | 5320 |
| 595 | Ga0501046_0033243 | 3300049580 | Bacteria | 4169 |
| 596 | Ga0501046_0058374 | 3300049580 | Bacteria | 3025 |
| 597 | Ga0501046_0123814 | 3300049580 | Bacteria | 1966 |
| 598 | Ga0501047_0030123 | 3300049581 | Bacteria | 5232 |
| 599 | Ga0501048_0002219 | 3300049582 | Bacteria | 14794 |
| 600 | Ga0501048_0003081 | 3300049582 | Bacteria | 12710 |
| 601 | Ga0501048_0213315 | 3300049582 | Bacteria | 1369 |
| 602 | Ga0501067_0001723 | 3300049583 | Bacteria | 12008 |
| 603 | Ga0501067_0019013 | 3300049583 | Bacteria | 3801 |
| 604 | Ga0501067_0038711 | 3300049583 | Bacteria | 2648 |
| 605 | Ga0501067_0070136 | 3300049583 | Bacteria | 1941 |
| 606 | Ga0501067_0358800 | 3300049583 | Bacteria | 813 |
| 607 | Ga0501068_0005888 | 3300049584 | Bacteria | 6729 |
| 608 | Ga0501068_0013176 | 3300049584 | Bacteria | 4702 |
| 609 | Ga0501068_0058694 | 3300049584 | Bacteria | 2335 |
| 610 | Ga0501068_0094978 | 3300049584 | Bacteria | 1843 |
| 611 | Ga0501068_0245460 | 3300049584 | Bacteria | 1140 |
| 612 | Ga0501069_0047720 | 3300049585 | Bacteria | 2377 |
| 613 | Ga0501069_0069790 | 3300049585 | Bacteria | 1968 |
| 614 | Ga0501069_0074031 | 3300049585 | Bacteria | 1910 |
| 615 | Ga0501069_0082734 | 3300049585 | Bacteria | 1809 |
| 616 | Ga0501070_0004831 | 3300049586 | Bacteria | 11513 |
| 617 | Ga0501070_0007702 | 3300049586 | Bacteria | 9129 |
| 618 | Ga0501070_0036195 | 3300049586 | Bacteria | 4122 |
| 619 | Ga0501070_0211951 | 3300049586 | Bacteria | 1590 |
| 620 | Ga0501070_0342901 | 3300049586 | Bacteria | 1213 |
| 621 | Ga0501071_0003185 | 3300049587 | Bacteria | 10210 |
| 622 | Ga0501071_0034794 | 3300049587 | Bacteria | 3587 |
| 623 | Ga0501071_0133606 | 3300049587 | Bacteria | 1845 |
| 624 | Ga0501071_0213437 | 3300049587 | Bacteria | 1451 |
| 625 | Ga0501071_0240098 | 3300049587 | Bacteria | 1366 |
| 626 | Ga0501072_0016523 | 3300049588 | Bacteria | 5669 |
| 627 | Ga0501072_0035425 | 3300049588 | Bacteria | 3909 |
| 628 | Ga0501072_0070239 | 3300049588 | Bacteria | 2765 |
| 629 | Ga0501072_0082451 | 3300049588 | Bacteria | 2549 |
| 630 | Ga0501072_0103443 | 3300049588 | Bacteria | 2263 |
| 631 | Ga0501073_0011619 | 3300049589 | Bacteria | 6433 |
| 632 | Ga0501073_0030168 | 3300049589 | Bacteria | 3872 |
| 633 | Ga0501074_0002308 | 3300049590 | Bacteria | 13278 |
| 634 | Ga0501074_0003143 | 3300049590 | Bacteria | 11647 |
| 635 | Ga0501074_0026963 | 3300049590 | Bacteria | 4164 |
| 636 | Ga0501074_0037999 | 3300049590 | Bacteria | 3489 |
| 637 | Ga0501074_0118053 | 3300049590 | Bacteria | 1898 |
| 638 | Ga0501074_0146696 | 3300049590 | Bacteria | 1687 |
| 639 | Ga0501074_0383359 | 3300049590 | Bacteria | 997 |
| 640 | Ga0501075_0074446 | 3300049591 | Bacteria | 2568 |
| 641 | Ga0501075_0085897 | 3300049591 | Bacteria | 2384 |
| 642 | Ga0501075_0124932 | 3300049591 | Bacteria | 1959 |
| 643 | Ga0501075_0131643 | 3300049591 | Bacteria | 1906 |
| 644 | Ga0501076_0003800 | 3300049592 | Bacteria | 10634 |
| 645 | Ga0501076_0160942 | 3300049592 | Bacteria | 1828 |
| 646 | Ga0501076_0321768 | 3300049592 | Bacteria | 1268 |
| 647 | Ga0501076_0600094 | 3300049592 | Bacteria | 908 |
| 648 | Ga0501077_0015410 | 3300049593 | Bacteria | 4813 |
| 649 | Ga0501077_0023095 | 3300049593 | Bacteria | 3944 |
| 650 | Ga0501077_0028507 | 3300049593 | Bacteria | 3548 |
| 651 | Ga0501208_007016 | 3300049655 | Bacteria | 1462 |
| 652 | Ga0501250_011169 | 3300049680 | Bacteria | 1043 |
| 653 | Ga0501221_014152 | 3300049704 | Bacteria | 1479 |
| 654 | Ga0501079_0001954 | 3300049741 | Bacteria | 14764 |
| 655 | Ga0501079_0293633 | 3300049741 | Bacteria | 1271 |
| 656 | Ga0501080_0001505 | 3300049742 | Bacteria | 19670 |
| 657 | Ga0501080_0012257 | 3300049742 | Bacteria | 7854 |
| 658 | Ga0501080_0036089 | 3300049742 | Bacteria | 4615 |
| 659 | Ga0501080_0126596 | 3300049742 | Bacteria | 2366 |
| 660 | Ga0501080_0266439 | 3300049742 | Bacteria | 1560 |
| 661 | Ga0501081_0003820 | 3300049743 | Bacteria | 9645 |
| 662 | Ga0501083_0036467 | 3300049744 | Bacteria | 3354 |
| 663 | Ga0501035_0004064 | 3300049822 | Bacteria | 13923 |
| 664 | Ga0501035_0018071 | 3300049822 | Bacteria | 6498 |
| 665 | Ga0501035_0075878 | 3300049822 | Bacteria | 2973 |
| 666 | Ga0501035_0103743 | 3300049822 | Bacteria | 2494 |
| 667 | Ga0501035_0204511 | 3300049822 | Bacteria | 1692 |
| 668 | Ga0501035_0334480 | 3300049822 | Bacteria | 1270 |
| 669 | Ga0501044_0023962 | 3300049823 | Bacteria | 6486 |
| 670 | Ga0501044_0042299 | 3300049823 | Bacteria | 4739 |
| 671 | Ga0501044_0149052 | 3300049823 | Bacteria | 2322 |
| 672 | Ga0501044_0368688 | 3300049823 | Bacteria | 1353 |
| 673 | Ga0501044_0556480 | 3300049823 | Bacteria | 1044 |
| 674 | Ga0501045_0003370 | 3300049824 | Bacteria | 10934 |
| 675 | Ga0501045_0059854 | 3300049824 | Bacteria | 2791 |
| 676 | Ga0501045_0209767 | 3300049824 | Bacteria | 1451 |
| 677 | Ga0501045_0291358 | 3300049824 | Bacteria | 1215 |
| 678 | nmdc:mga03683_35229_c1 | 3300050489 | Bacteria | 2029 |
| 679 | nmdc:mga03683_7844_c1 | 3300050489 | Bacteria | 3726 |
| 680 | nmdc:mga00v17_147224_c1 | 3300050491 | Bacteria | 1512 |
| 681 | nmdc:mga00v17_17269_c1 | 3300050491 | Bacteria | 4081 |
| 682 | nmdc:mga00v17_71838_c1 | 3300050491 | Bacteria | 2146 |
| 683 | nmdc:mga00v17_88442_c1 | 3300050491 | Bacteria | 1545 |
| 684 | nmdc:mga0yw44_20302_c1 | 3300050492 | Bacteria | 3685 |
| 685 | nmdc:mga0yw44_55591_c1 | 3300050492 | Bacteria | 2409 |
| 686 | nmdc:mga0yw44_612_c1 | 3300050492 | Bacteria | 12911 |
| 687 | nmdc:mga0yw44_90408_c1 | 3300050492 | Bacteria | 1934 |
| 688 | nmdc:mga0yw44_99668_c2 | 3300050492 | Bacteria | 1657 |
| 689 | nmdc:mga06z11_2335_c1 | 3300050494 | Bacteria | 7226 |
| 690 | nmdc:mga06z11_30411_c1 | 3300050494 | Bacteria | 2613 |
| 691 | nmdc:mga06z11_907_c1 | 3300050494 | Bacteria | 10772 |
| 692 | nmdc:mga04h51_2109_c1 | 3300050495 | Bacteria | 4668 |
| 693 | nmdc:mga07m45_21596_c1 | 3300050496 | Bacteria | 3507 |
| 694 | nmdc:mga07m45_366096_c1 | 3300050496 | Bacteria | 837 |
| 695 | nmdc:mga07m45_76171_c1 | 3300050496 | Bacteria | 1913 |
| 696 | nmdc:mga05p37_162_c1 | 3300050507 | Bacteria | 64436 |
| 697 | nmdc:mga05p37_37668_c1 | 3300050507 | Bacteria | 5931 |
| 698 | nmdc:mga09592_165_c1 | 3300050508 | Bacteria | 46519 |
| 699 | nmdc:mga09592_18650_c1 | 3300050508 | Bacteria | 5691 |
| 700 | nmdc:mga09592_230836_c1 | 3300050508 | Bacteria | 1603 |
| 701 | nmdc:mga0qj67_17645_c1 | 3300050509 | Bacteria | 5429 |
| 702 | nmdc:mga0qj67_256480_c1 | 3300050509 | Bacteria | 1419 |
| 703 | nmdc:mga0qj67_6234_c1 | 3300050509 | Bacteria | 8757 |
| 704 | nmdc:mga06r32_265_c1 | 3300050510 | Bacteria | 43312 |
| 705 | nmdc:mga06r32_286911_c1 | 3300050510 | Bacteria | 1633 |
| 706 | nmdc:mga06r32_656_c1 | 3300050510 | Bacteria | 30201 |
| 707 | nmdc:mga08y16_164887_c1 | 3300050511 | Bacteria | 2302 |
| 708 | nmdc:mga08y16_3562_c1 | 3300050511 | Bacteria | 16167 |
| 709 | nmdc:mga08y16_389169_c1 | 3300050511 | Bacteria | 1428 |
| 710 | nmdc:mga08y16_4203_c1 | 3300050511 | Bacteria | 15028 |
| 711 | nmdc:mga0n895_217_c1 | 3300050512 | Bacteria | 36183 |
| 712 | nmdc:mga0rr50_26718_c1 | 3300050513 | Bacteria | 4033 |
| 713 | nmdc:mga0rr50_30846_c1 | 3300050513 | Bacteria | 3801 |
| 714 | nmdc:mga0a205_1731_c1 | 3300050515 | Bacteria | 18865 |
| 715 | nmdc:mga0a205_21032_c1 | 3300050515 | Bacteria | 6168 |
| 716 | Ga0495601_0050241 | 3300053077 | Bacteria | 2630 |
| 717 | Ga0495655_0113422 | 3300053083 | Bacteria | 817 |
| 718 | Ga0495619_0357553 | 3300053085 | Bacteria | 1010 |
| 719 | Ga0500644_0000047 | 3300053088 | Bacteria | 73844 |
| 720 | Ga0500644_0141923 | 3300053088 | Bacteria | 955 |
| 721 | Ga0500556_0000917 | 3300053104 | Bacteria | 16230 |
| 722 | Ga0500593_000244 | 3300053117 | Bacteria | 22282 |
| 723 | Ga0501084_0007477 | 3300054114 | Bacteria | 9006 |
| 724 | Ga0501084_0056702 | 3300054114 | Bacteria | 3278 |
| 725 | Ga0501084_0066555 | 3300054114 | Bacteria | 3014 |
| 726 | Ga0501084_0151419 | 3300054114 | Bacteria | 1955 |
| 727 | Ga0501084_0154364 | 3300054114 | Bacteria | 1936 |
| 728 | Ga0501084_0255962 | 3300054114 | Bacteria | 1478 |
| 729 | Ga0590075_010047 | 3300059424 | Bacteria | 2274 |
| 730 | Ga0501082_0006014 | 3300060353 | Bacteria | 10523 |
| 731 | Ga0501082_0013150 | 3300060353 | Bacteria | 7116 |
| 732 | Ga0501082_0049469 | 3300060353 | Bacteria | 3625 |
| 733 | Ga0501082_0058657 | 3300060353 | Bacteria | 3316 |
| 734 | Ga0501082_0087906 | 3300060353 | Bacteria | 2682 |
| 735 | Ga0466962_0023396 | 3300061719 | Bacteria | 2970 |
| 736 | Ga0466962_0081188 | 3300061719 | Bacteria | 1551 |
| 737 | Ga0466962_0275819 | 3300061719 | Bacteria | 829 |
| 738 | Ga0530510_0002431 | 3300061734 | Bacteria | 12832 |
| 739 | Ga0530510_0117871 | 3300061734 | Bacteria | 1948 |
| 740 | Ga0530510_0418711 | 3300061734 | Bacteria | 1011 |
| 741 | Ga0530510_0683569 | 3300061734 | Bacteria | 782 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10000677 | Ga0075365_1000067712 | 233 |
| 2 | 3300006042 | Ga0075368_10010386 | Ga0075368_100103862 | 233 |
| 3 | 3300006048 | Ga0075363_100030888 | Ga0075363_1000308882 | 233 |
| 4 | 3300006051 | Ga0075364_10052499 | Ga0075364_100524993 | 233 |
| 5 | 3300006177 | Ga0075362_10001939 | Ga0075362_100019394 | 233 |
| 6 | 3300006353 | Ga0075370_10020511 | Ga0075370_100205114 | 233 |
| 7 | 3300027866 | Ga0209813_10002911 | Ga0209813_100029114 | 233 |
| 8 | 3300050489 | nmdc:mga03683_7844_c1 | nmdc:mga03683_7844_c1_1337_2107 | 233 |
| 9 | 3300050494 | nmdc:mga06z11_907_c1 | nmdc:mga06z11_907_c1_9219_9989 | 233 |
| 10 | 3300050495 | nmdc:mga04h51_2109_c1 | nmdc:mga04h51_2109_c1_2913_3683 | 233 |
| 11 | 3300050496 | nmdc:mga07m45_76171_c1 | nmdc:mga07m45_76171_c1_965_1735 | 233 |
| 12 | 3300006881 | Ga0068865_100184051 | Ga0068865_1001840512 | 234 |
| 13 | 3300037418 | Ga0395900_0117332 | Ga0395900_0117332_67_867 | 235 |
| 14 | 3300037418 | Ga0395900_0754715 | Ga0395900_0754715_19_816 | 235 |
| 15 | 3300048910 | Ga0496107_0327624 | Ga0496107_0327624_405_1112 | 235 |
| 16 | 3300050489 | nmdc:mga03683_35229_c1 | nmdc:mga03683_35229_c1_194_964 | 237 |
| 17 | 3300009553 | Ga0105249_10995299 | Ga0105249_109952991 | 238 |
| 18 | 3300053117 | Ga0500593_000244 | Ga0500593_000244_20715_21512 | 240 |
| 19 | 3300053104 | Ga0500556_0000917 | Ga0500556_0000917_14494_15306 | 244 |
| 20 | 3300005981 | Ga0081538_10000092 | Ga0081538_100000928 | 245 |
| 21 | 3300037471 | Ga0395905_0108491 | Ga0395905_0108491_93_887 | 245 |
| 22 | 3300044684 | Ga0466966_0340039 | Ga0466966_0340039_42_785 | 245 |
| 23 | 3300046454 | Ga0495592_0179842 | Ga0495592_0179842_694_1431 | 245 |
| 24 | 3300025918 | Ga0207662_10160643 | Ga0207662_101606432 | 247 |
| 25 | 3300025940 | Ga0207691_10413407 | Ga0207691_104134072 | 247 |
| 26 | 3300044683 | Ga0466965_0048699 | Ga0466965_0048699_1142_1939 | 247 |
| 27 | 3300037466 | Ga0395898_0375199 | Ga0395898_0375199_428_1228 | 248 |
| 28 | 3300038443 | Ga0395901_0200091 | Ga0395901_0200091_414_1214 | 248 |
| 29 | 3300005456 | Ga0070678_100290557 | Ga0070678_1002905572 | 249 |
| 30 | 3300026121 | Ga0207683_10331275 | Ga0207683_103312752 | 249 |
| 31 | 3300037068 | Ga0373925_0609984 | Ga0373925_0609984_11_763 | 250 |
| 32 | 3300041512 | Ga0451853_1182483 | Ga0451853_1182483_337_1146 | 250 |
| 33 | 3300048910 | Ga0496107_0643730 | Ga0496107_0643730_13_765 | 250 |
| 34 | 3300049568 | Ga0501031_0312387 | Ga0501031_0312387_16_768 | 250 |
| 35 | 3300049578 | Ga0501042_0418483 | Ga0501042_0418483_14_769 | 250 |
| 36 | 3300049823 | Ga0501044_0556480 | Ga0501044_0556480_281_1033 | 250 |
| 37 | 3300053083 | Ga0495655_0113422 | Ga0495655_0113422_15_767 | 250 |
| 38 | 3300061734 | Ga0530510_0683569 | Ga0530510_0683569_14_766 | 250 |
| 39 | 3300013308 | Ga0157375_10109681 | Ga0157375_101096813 | 251 |
| 40 | 3300017792 | Ga0163161_10141764 | Ga0163161_101417642 | 252 |
| 41 | 3300031665 | Ga0316575_10038672 | Ga0316575_100386722 | 252 |
| 42 | 3300031691 | Ga0316579_10005298 | Ga0316579_100052984 | 252 |
| 43 | 3300031728 | Ga0316578_10157706 | Ga0316578_101577062 | 252 |
| 44 | 3300031733 | Ga0316577_10011722 | Ga0316577_100117222 | 252 |
| 45 | 3300032137 | Ga0316585_10003116 | Ga0316585_100031164 | 252 |
| 46 | 3300032139 | Ga0316580_10003372 | Ga0316580_100033724 | 252 |
| 47 | 3300035398 | Ga0316574_0006380 | Ga0316574_0006380_924_1718 | 252 |
| 48 | 3300036647 | Ga0316582_0000779 | Ga0316582_0000779_7372_8166 | 252 |
| 49 | 3300049583 | Ga0501067_0070136 | Ga0501067_0070136_571_1335 | 254 |
| 50 | 3300041509 | Ga0451843_1395193 | Ga0451843_1395193_1071_1883 | 255 |
| 51 | 3300049591 | Ga0501075_0124932 | Ga0501075_0124932_46_813 | 255 |
| 52 | iso_pu_bacteria | 2622736605 | 2623499935 | 255 |
| 53 | iso_pu_bacteria | 2808606394 | 2809028817 | 255 |
| 54 | 3300005937 | Ga0081455_10035251 | Ga0081455_100352511 | 256 |
| 55 | 3300006038 | Ga0075365_10134122 | Ga0075365_101341222 | 256 |
| 56 | 3300006881 | Ga0068865_100030955 | Ga0068865_1000309553 | 256 |
| 57 | 3300007076 | Ga0075435_100025910 | Ga0075435_1000259103 | 256 |
| 58 | 3300009094 | Ga0111539_10708063 | Ga0111539_107080632 | 256 |
| 59 | 3300009147 | Ga0114129_10322865 | Ga0114129_103228654 | 256 |
| 60 | 3300011119 | Ga0105246_10416826 | Ga0105246_104168261 | 256 |
| 61 | 3300013307 | Ga0157372_10278953 | Ga0157372_102789533 | 256 |
| 62 | 3300013307 | Ga0157372_10357501 | Ga0157372_103575012 | 256 |
| 63 | 3300014326 | Ga0157380_10152224 | Ga0157380_101522243 | 256 |
| 64 | 3300025901 | Ga0207688_10029422 | Ga0207688_100294222 | 256 |
| 65 | 3300025938 | Ga0207704_10019073 | Ga0207704_100190733 | 256 |
| 66 | 3300026041 | Ga0207639_10131561 | Ga0207639_101315614 | 256 |
| 67 | 3300031548 | Ga0307408_100135038 | Ga0307408_1001350382 | 256 |
| 68 | 3300031995 | Ga0307409_100287645 | Ga0307409_1002876452 | 256 |
| 69 | 3300032004 | Ga0307414_10011016 | Ga0307414_100110165 | 256 |
| 70 | 3300032005 | Ga0307411_10008334 | Ga0307411_100083346 | 256 |
| 71 | 3300035691 | Ga0373931_0039381 | Ga0373931_0039381_856_1626 | 256 |
| 72 | 3300037418 | Ga0395900_0300749 | Ga0395900_0300749_22_795 | 256 |
| 73 | 3300037418 | Ga0395900_0325271 | Ga0395900_0325271_506_1276 | 256 |
| 74 | 3300037418 | Ga0395900_0419699 | Ga0395900_0419699_97_867 | 256 |
| 75 | 3300037466 | Ga0395898_0241060 | Ga0395898_0241060_22_792 | 256 |
| 76 | 3300038443 | Ga0395901_0909266 | Ga0395901_0909266_77_850 | 256 |
| 77 | 3300038735 | Ga0400485_22276 | Ga0400485_22276_6179_6949 | 256 |
| 78 | 3300038741 | Ga0400488_09508 | Ga0400488_09508_617_1387 | 256 |
| 79 | 3300038742 | Ga0400486_20001 | Ga0400486_20001_17100_17870 | 256 |
| 80 | 3300041411 | Ga0439466_0088929 | Ga0439466_0088929_41_814 | 256 |
| 81 | 3300041494 | Ga0451837_0412095 | Ga0451837_0412095_2444_3214 | 256 |
| 82 | 3300041496 | Ga0451839_0951328 | Ga0451839_0951328_264_1034 | 256 |
| 83 | 3300041997 | Ga0439431_0005845 | Ga0439431_0005845_933_1703 | 256 |
| 84 | 3300042005 | Ga0439448_0015915 | Ga0439448_0015915_610_1380 | 256 |
| 85 | 3300042461 | Ga0439460_0057403 | Ga0439460_0057403_344_1114 | 256 |
| 86 | 3300044683 | Ga0466965_0051632 | Ga0466965_0051632_626_1396 | 256 |
| 87 | 3300044684 | Ga0466966_0088437 | Ga0466966_0088437_696_1469 | 256 |
| 88 | 3300044684 | Ga0466966_0095695 | Ga0466966_0095695_486_1256 | 256 |
| 89 | 3300044693 | Ga0466961_0060902 | Ga0466961_0060902_1612_2382 | 256 |
| 90 | 3300044693 | Ga0466961_0163831 | Ga0466961_0163831_557_1330 | 256 |
| 91 | 3300044693 | Ga0466961_0336385 | Ga0466961_0336385_121_891 | 256 |
| 92 | 3300044694 | Ga0466963_0110244 | Ga0466963_0110244_820_1590 | 256 |
| 93 | 3300044706 | Ga0466964_0014052 | Ga0466964_0014052_1334_2104 | 256 |
| 94 | 3300044719 | Ga0466971_0071171 | Ga0466971_0071171_325_1095 | 256 |
| 95 | 3300044765 | Ga0466970_0032404 | Ga0466970_0032404_405_1178 | 256 |
| 96 | 3300044765 | Ga0466970_0086758 | Ga0466970_0086758_577_1347 | 256 |
| 97 | 3300044765 | Ga0466970_0164061 | Ga0466970_0164061_422_1192 | 256 |
| 98 | 3300044842 | Ga0466957_0258150 | Ga0466957_0258150_333_1103 | 256 |
| 99 | 3300044901 | Ga0466960_0001507 | Ga0466960_0001507_6506_7276 | 256 |
| 100 | 3300044901 | Ga0466960_0034970 | Ga0466960_0034970_935_1705 | 256 |
| 101 | 3300045836 | Ga0466958_0187231 | Ga0466958_0187231_54_824 | 256 |
| 102 | 3300045976 | Ga0466967_0037567 | Ga0466967_0037567_861_1631 | 256 |
| 103 | 3300045976 | Ga0466967_0163412 | Ga0466967_0163412_535_1308 | 256 |
| 104 | 3300045976 | Ga0466967_0231488 | Ga0466967_0231488_456_1226 | 256 |
| 105 | 3300046453 | Ga0495627_017388 | Ga0495627_017388_710_1480 | 256 |
| 106 | 3300046461 | Ga0495641_0062082 | Ga0495641_0062082_140_910 | 256 |
| 107 | 3300046531 | Ga0495665_0213138 | Ga0495665_0213138_129_899 | 256 |
| 108 | 3300048903 | Ga0496100_0000374 | Ga0496100_0000374_34_807 | 256 |
| 109 | 3300048903 | Ga0496100_0041446 | Ga0496100_0041446_1231_2004 | 256 |
| 110 | 3300048904 | Ga0496101_0169126 | Ga0496101_0169126_296_1069 | 256 |
| 111 | 3300048905 | Ga0496102_0009142 | Ga0496102_0009142_3069_3842 | 256 |
| 112 | 3300048906 | Ga0496103_0025323 | Ga0496103_0025323_1525_2298 | 256 |
| 113 | 3300048907 | Ga0496104_0137073 | Ga0496104_0137073_1085_1858 | 256 |
| 114 | 3300048908 | Ga0496105_0034203 | Ga0496105_0034203_29_802 | 256 |
| 115 | 3300048909 | Ga0496106_0361401 | Ga0496106_0361401_176_949 | 256 |
| 116 | 3300048911 | Ga0496108_0079113 | Ga0496108_0079113_1510_2283 | 256 |
| 117 | 3300048911 | Ga0496108_0171337 | Ga0496108_0171337_724_1494 | 256 |
| 118 | 3300048913 | Ga0496110_0041099 | Ga0496110_0041099_2543_3316 | 256 |
| 119 | 3300048913 | Ga0496110_0250735 | Ga0496110_0250735_92_862 | 256 |
| 120 | 3300048914 | Ga0496111_0044439 | Ga0496111_0044439_1371_2144 | 256 |
| 121 | 3300048916 | Ga0496113_0174745 | Ga0496113_0174745_501_1274 | 256 |
| 122 | 3300048917 | Ga0496114_0023486 | Ga0496114_0023486_359_1132 | 256 |
| 123 | 3300048917 | Ga0496114_0186050 | Ga0496114_0186050_1026_1799 | 256 |
| 124 | 3300048917 | Ga0496114_0776492 | Ga0496114_0776492_12_782 | 256 |
| 125 | 3300048929 | Ga0496126_0139088 | Ga0496126_0139088_1268_2041 | 256 |
| 126 | 3300049568 | Ga0501031_0117188 | Ga0501031_0117188_935_1708 | 256 |
| 127 | 3300049568 | Ga0501031_0121470 | Ga0501031_0121470_778_1548 | 256 |
| 128 | 3300049569 | Ga0501032_0014184 | Ga0501032_0014184_50_823 | 256 |
| 129 | 3300049570 | Ga0501033_0002769 | Ga0501033_0002769_25_798 | 256 |
| 130 | 3300049571 | Ga0501034_0011552 | Ga0501034_0011552_5693_6466 | 256 |
| 131 | 3300049571 | Ga0501034_0742066 | Ga0501034_0742066_23_793 | 256 |
| 132 | 3300049572 | Ga0501036_0224731 | Ga0501036_0224731_666_1436 | 256 |
| 133 | 3300049572 | Ga0501036_0267558 | Ga0501036_0267558_18_788 | 256 |
| 134 | 3300049574 | Ga0501038_0003720 | Ga0501038_0003720_5390_6163 | 256 |
| 135 | 3300049575 | Ga0501039_0146212 | Ga0501039_0146212_576_1346 | 256 |
| 136 | 3300049578 | Ga0501042_0357083 | Ga0501042_0357083_21_791 | 256 |
| 137 | 3300049579 | Ga0501043_0053189 | Ga0501043_0053189_1577_2350 | 256 |
| 138 | 3300049580 | Ga0501046_0033243 | Ga0501046_0033243_28_801 | 256 |
| 139 | 3300049582 | Ga0501048_0213315 | Ga0501048_0213315_428_1198 | 256 |
| 140 | 3300049583 | Ga0501067_0358800 | Ga0501067_0358800_28_798 | 256 |
| 141 | 3300049584 | Ga0501068_0013176 | Ga0501068_0013176_55_825 | 256 |
| 142 | 3300049584 | Ga0501068_0245460 | Ga0501068_0245460_317_1087 | 256 |
| 143 | 3300049585 | Ga0501069_0074031 | Ga0501069_0074031_635_1405 | 256 |
| 144 | 3300049586 | Ga0501070_0342901 | Ga0501070_0342901_368_1138 | 256 |
| 145 | 3300049590 | Ga0501074_0118053 | Ga0501074_0118053_512_1282 | 256 |
| 146 | 3300049592 | Ga0501076_0600094 | Ga0501076_0600094_47_817 | 256 |
| 147 | 3300049742 | Ga0501080_0266439 | Ga0501080_0266439_714_1484 | 256 |
| 148 | 3300049822 | Ga0501035_0204511 | Ga0501035_0204511_903_1673 | 256 |
| 149 | 3300049823 | Ga0501044_0042299 | Ga0501044_0042299_2603_3376 | 256 |
| 150 | 3300049824 | Ga0501045_0209767 | Ga0501045_0209767_182_952 | 256 |
| 151 | 3300050491 | nmdc:mga00v17_147224_c1 | nmdc:mga00v17_147224_c1_185_955 | 256 |
| 152 | 3300050491 | nmdc:mga00v17_71838_c1 | nmdc:mga00v17_71838_c1_519_1289 | 256 |
| 153 | 3300050492 | nmdc:mga0yw44_55591_c1 | nmdc:mga0yw44_55591_c1_1033_1803 | 256 |
| 154 | 3300050492 | nmdc:mga0yw44_90408_c1 | nmdc:mga0yw44_90408_c1_984_1754 | 256 |
| 155 | 3300050509 | nmdc:mga0qj67_17645_c1 | nmdc:mga0qj67_17645_c1_3282_4052 | 256 |
| 156 | 3300050510 | nmdc:mga06r32_286911_c1 | nmdc:mga06r32_286911_c1_102_872 | 256 |
| 157 | 3300050511 | nmdc:mga08y16_389169_c1 | nmdc:mga08y16_389169_c1_439_1209 | 256 |
| 158 | 3300053088 | Ga0500644_0000047 | Ga0500644_0000047_66150_66920 | 256 |
| 159 | 3300054114 | Ga0501084_0154364 | Ga0501084_0154364_566_1336 | 256 |
| 160 | 3300060353 | Ga0501082_0013150 | Ga0501082_0013150_13_786 | 256 |
| 161 | 3300061719 | Ga0466962_0275819 | Ga0466962_0275819_18_788 | 256 |
| 162 | 3300061734 | Ga0530510_0418711 | Ga0530510_0418711_158_931 | 256 |
| 163 | 3300044765 | Ga0466970_0071539 | Ga0466970_0071539_188_1027 | 257 |
| 164 | 3300006042 | Ga0075368_10000261 | Ga0075368_1000026113 | 258 |
| 165 | 3300006048 | Ga0075363_100003243 | Ga0075363_1000032435 | 258 |
| 166 | 3300006178 | Ga0075367_10021645 | Ga0075367_100216454 | 258 |
| 167 | 3300027866 | Ga0209813_10007472 | Ga0209813_100074722 | 258 |
| 168 | 3300045049 | Ga0466959_0222881 | Ga0466959_0222881_211_1020 | 258 |
| 169 | 3300049578 | Ga0501042_0106122 | Ga0501042_0106122_359_1198 | 258 |
| 170 | 3300049580 | Ga0501046_0123814 | Ga0501046_0123814_1037_1876 | 258 |
| 171 | 3300049591 | Ga0501075_0085897 | Ga0501075_0085897_1296_2135 | 258 |
| 172 | 3300050494 | nmdc:mga06z11_2335_c1 | nmdc:mga06z11_2335_c1_3151_3945 | 258 |
| 173 | 3300054114 | Ga0501084_0255962 | Ga0501084_0255962_110_949 | 258 |
| 174 | iso_pu_bacteria | 2643221697 | 2644537693 | 258 |
| 175 | 3300044901 | Ga0466960_0083334 | Ga0466960_0083334_238_1050 | 259 |
| 176 | iso_pu_bacteria | 2643221561 | 2643826011 | 259 |
| 177 | iso_pu_bacteria | 2643221696 | 2644531999 | 259 |
| 178 | iso_pu_bacteria | 2835188231 | 2835189984 | 259 |
| 179 | iso_pu_bacteria | 2857481737 | 2857482186 | 259 |
| 180 | 3300005983 | Ga0081540_1029003 | Ga0081540_10290032 | 260 |
| 181 | 3300013105 | Ga0157369_10027443 | Ga0157369_100274433 | 260 |
| 182 | 3300014326 | Ga0157380_10027767 | Ga0157380_100277675 | 260 |
| 183 | 3300017792 | Ga0163161_10271923 | Ga0163161_102719232 | 260 |
| 184 | 3300031665 | Ga0316575_10000376 | Ga0316575_1000037610 | 260 |
| 185 | 3300031691 | Ga0316579_10000355 | Ga0316579_1000035512 | 260 |
| 186 | 3300031727 | Ga0316576_10001640 | Ga0316576_1000164011 | 260 |
| 187 | 3300031728 | Ga0316578_10001217 | Ga0316578_1000121710 | 260 |
| 188 | 3300031733 | Ga0316577_10090677 | Ga0316577_100906772 | 260 |
| 189 | 3300032137 | Ga0316585_10009466 | Ga0316585_100094662 | 260 |
| 190 | 3300032139 | Ga0316580_10003712 | Ga0316580_100037124 | 260 |
| 191 | 3300032168 | Ga0316593_10009264 | Ga0316593_100092642 | 260 |
| 192 | 3300035398 | Ga0316574_0000549 | Ga0316574_0000549_12989_13786 | 260 |
| 193 | 3300036647 | Ga0316582_0004670 | Ga0316582_0004670_1039_1836 | 260 |
| 194 | 3300036712 | Ga0316584_0015028 | Ga0316584_0015028_2822_3619 | 260 |
| 195 | 3300042014 | Ga0439457_023294 | Ga0439457_023294_240_1037 | 260 |
| 196 | 3300044842 | Ga0466957_0457894 | Ga0466957_0457894_32_820 | 260 |
| 197 | 3300044901 | Ga0466960_0376094 | Ga0466960_0376094_13_798 | 260 |
| 198 | 3300045976 | Ga0466967_0828343 | Ga0466967_0828343_86_874 | 260 |
| 199 | 3300048912 | Ga0496109_0063347 | Ga0496109_0063347_416_1213 | 260 |
| 200 | 3300049586 | Ga0501070_0211951 | Ga0501070_0211951_13_804 | 260 |
| 201 | iso_pu_bacteria | 2643221567 | 2643849763 | 260 |
| 202 | iso_pu_bacteria | 2643221613 | 2644081587 | 260 |
| 203 | iso_pu_bacteria | 2643221615 | 2644088999 | 260 |
| 204 | iso_pu_bacteria | 2643221624 | 2644135765 | 260 |
| 205 | iso_pu_bacteria | 2643221657 | 2644318844 | 260 |
| 206 | iso_pu_bacteria | 2643221721 | 2644666209 | 260 |
| 207 | iso_pu_bacteria | 2739367654 | 2739605576 | 260 |
| 208 | iso_pu_bacteria | 2758568522 | 2760307589 | 260 |
| 209 | iso_pu_bacteria | 2758568621 | 2760623902 | 260 |
| 210 | iso_pu_bacteria | 2855386786 | 2855387086 | 260 |
| 211 | iso_pu_bacteria | 2935890801 | 2935891169 | 260 |
| 212 | iso_pu_bacteria | 8054609563 | 8054612899 | 260 |
| 213 | iso_pu_bacteria | 8056579771 | 8056585141 | 260 |
| 214 | 3300005337 | Ga0070682_100091053 | Ga0070682_1000910532 | 261 |
| 215 | 3300005445 | Ga0070708_100316500 | Ga0070708_1003165003 | 261 |
| 216 | 3300005455 | Ga0070663_100117139 | Ga0070663_1001171392 | 261 |
| 217 | 3300005459 | Ga0068867_100055185 | Ga0068867_1000551854 | 261 |
| 218 | 3300005471 | Ga0070698_100008110 | Ga0070698_1000081109 | 261 |
| 219 | 3300005548 | Ga0070665_100202474 | Ga0070665_1002024742 | 261 |
| 220 | 3300006038 | Ga0075365_10102854 | Ga0075365_101028543 | 261 |
| 221 | 3300009098 | Ga0105245_10200037 | Ga0105245_102000372 | 261 |
| 222 | 3300009148 | Ga0105243_10037006 | Ga0105243_100370065 | 261 |
| 223 | 3300009176 | Ga0105242_10079298 | Ga0105242_100792984 | 261 |
| 224 | 3300009551 | Ga0105238_10168125 | Ga0105238_101681253 | 261 |
| 225 | 3300011119 | Ga0105246_10085253 | Ga0105246_100852534 | 261 |
| 226 | 3300013105 | Ga0157369_10826588 | Ga0157369_108265881 | 261 |
| 227 | 3300013296 | Ga0157374_10273545 | Ga0157374_102735452 | 261 |
| 228 | 3300014745 | Ga0157377_10051441 | Ga0157377_100514412 | 261 |
| 229 | 3300025901 | Ga0207688_10076258 | Ga0207688_100762582 | 261 |
| 230 | 3300025927 | Ga0207687_10180507 | Ga0207687_101805072 | 261 |
| 231 | 3300025932 | Ga0207690_10289523 | Ga0207690_102895232 | 261 |
| 232 | 3300025940 | Ga0207691_10392789 | Ga0207691_103927892 | 261 |
| 233 | 3300026067 | Ga0207678_10146413 | Ga0207678_101464133 | 261 |
| 234 | 3300026089 | Ga0207648_10205336 | Ga0207648_102053362 | 261 |
| 235 | 3300026095 | Ga0207676_10891979 | Ga0207676_108919791 | 261 |
| 236 | 3300026121 | Ga0207683_10033331 | Ga0207683_100333316 | 261 |
| 237 | 3300028379 | Ga0268266_10115839 | Ga0268266_101158393 | 261 |
| 238 | 3300030733 | Ga0314311_1057189 | Ga0314311_10571892 | 261 |
| 239 | 3300032005 | Ga0307411_10252467 | Ga0307411_102524672 | 261 |
| 240 | 3300041512 | Ga0451853_3166378 | Ga0451853_3166378_243_1028 | 261 |
| 241 | 3300044684 | Ga0466966_0200383 | Ga0466966_0200383_327_1121 | 261 |
| 242 | 3300048906 | Ga0496103_0340291 | Ga0496103_0340291_94_879 | 261 |
| 243 | 3300048907 | Ga0496104_0094935 | Ga0496104_0094935_801_1586 | 261 |
| 244 | 3300048909 | Ga0496106_0349852 | Ga0496106_0349852_328_1125 | 261 |
| 245 | 3300048913 | Ga0496110_0158543 | Ga0496110_0158543_779_1564 | 261 |
| 246 | 3300048913 | Ga0496110_0360402 | Ga0496110_0360402_499_1296 | 261 |
| 247 | 3300049569 | Ga0501032_0085286 | Ga0501032_0085286_1208_2002 | 261 |
| 248 | 3300049578 | Ga0501042_0087679 | Ga0501042_0087679_553_1347 | 261 |
| 249 | 3300049579 | Ga0501043_0181884 | Ga0501043_0181884_780_1574 | 261 |
| 250 | 3300049583 | Ga0501067_0038711 | Ga0501067_0038711_893_1690 | 261 |
| 251 | 3300049824 | Ga0501045_0059854 | Ga0501045_0059854_1969_2760 | 261 |
| 252 | 3300061734 | Ga0530510_0117871 | Ga0530510_0117871_928_1722 | 261 |
| 253 | iso_pu_bacteria | 2643221711 | 2644611128 | 261 |
| 254 | iso_pu_bacteria | 2738541305 | 2738868250 | 261 |
| 255 | iso_pu_bacteria | 2818991318 | 2819427799 | 261 |
| 256 | iso_pu_bacteria | 2818991458 | 2819666675 | 261 |
| 257 | 3300003285 | Ga0007423J48922_100026 | Ga0007423J48922_1000264 | 262 |
| 258 | 3300003285 | Ga0007423J48922_100029 | Ga0007423J48922_1000292 | 262 |
| 259 | 3300003373 | JGI25407J50210_10020881 | JGI25407J50210_100208812 | 262 |
| 260 | 3300005327 | Ga0070658_10108699 | Ga0070658_101086992 | 262 |
| 261 | 3300005334 | Ga0068869_100087538 | Ga0068869_1000875384 | 262 |
| 262 | 3300005347 | Ga0070668_100060446 | Ga0070668_1000604464 | 262 |
| 263 | 3300005354 | Ga0070675_100103827 | Ga0070675_1001038274 | 262 |
| 264 | 3300005356 | Ga0070674_100112604 | Ga0070674_1001126043 | 262 |
| 265 | 3300005364 | Ga0070673_100275094 | Ga0070673_1002750942 | 262 |
| 266 | 3300005459 | Ga0068867_100400648 | Ga0068867_1004006482 | 262 |
| 267 | 3300005535 | Ga0070684_100364623 | Ga0070684_1003646231 | 262 |
| 268 | 3300005535 | Ga0070684_100467158 | Ga0070684_1004671581 | 262 |
| 269 | 3300005539 | Ga0068853_100192805 | Ga0068853_1001928054 | 262 |
| 270 | 3300005719 | Ga0068861_100035396 | Ga0068861_1000353965 | 262 |
| 271 | 3300005719 | Ga0068861_100113898 | Ga0068861_1001138982 | 262 |
| 272 | 3300005937 | Ga0081455_10000389 | Ga0081455_1000038923 | 262 |
| 273 | 3300005937 | Ga0081455_10002237 | Ga0081455_100022373 | 262 |
| 274 | 3300005937 | Ga0081455_10039452 | Ga0081455_100394524 | 262 |
| 275 | 3300005981 | Ga0081538_10000958 | Ga0081538_1000095810 | 262 |
| 276 | 3300006038 | Ga0075365_10016366 | Ga0075365_100163665 | 262 |
| 277 | 3300006058 | Ga0075432_10000058 | Ga0075432_1000005813 | 262 |
| 278 | 3300006844 | Ga0075428_100005267 | Ga0075428_1000052674 | 262 |
| 279 | 3300006844 | Ga0075428_100006278 | Ga0075428_1000062787 | 262 |
| 280 | 3300006846 | Ga0075430_100022049 | Ga0075430_1000220493 | 262 |
| 281 | 3300006847 | Ga0075431_100007939 | Ga0075431_1000079399 | 262 |
| 282 | 3300006852 | Ga0075433_10000219 | Ga0075433_100002198 | 262 |
| 283 | 3300006852 | Ga0075433_10000698 | Ga0075433_100006983 | 262 |
| 284 | 3300006871 | Ga0075434_100062096 | Ga0075434_1000620963 | 262 |
| 285 | 3300006871 | Ga0075434_100086091 | Ga0075434_1000860913 | 262 |
| 286 | 3300007076 | Ga0075435_100009410 | Ga0075435_1000094106 | 262 |
| 287 | 3300009094 | Ga0111539_10000761 | Ga0111539_1000076121 | 262 |
| 288 | 3300009098 | Ga0105245_10140867 | Ga0105245_101408673 | 262 |
| 289 | 3300009147 | Ga0114129_10025297 | Ga0114129_100252977 | 262 |
| 290 | 3300009148 | Ga0105243_10020623 | Ga0105243_100206232 | 262 |
| 291 | 3300009148 | Ga0105243_10113163 | Ga0105243_101131632 | 262 |
| 292 | 3300009551 | Ga0105238_10237316 | Ga0105238_102373163 | 262 |
| 293 | 3300009553 | Ga0105249_10009986 | Ga0105249_100099867 | 262 |
| 294 | 3300013306 | Ga0163162_10061724 | Ga0163162_100617243 | 262 |
| 295 | 3300013308 | Ga0157375_10048309 | Ga0157375_100483093 | 262 |
| 296 | 3300014325 | Ga0163163_10177142 | Ga0163163_101771423 | 262 |
| 297 | 3300014326 | Ga0157380_10210601 | Ga0157380_102106012 | 262 |
| 298 | 3300014497 | Ga0182008_10102494 | Ga0182008_101024942 | 262 |
| 299 | 3300014969 | Ga0157376_10230246 | Ga0157376_102302462 | 262 |
| 300 | 3300017792 | Ga0163161_10003339 | Ga0163161_100033396 | 262 |
| 301 | 3300017792 | Ga0163161_10207374 | Ga0163161_102073742 | 262 |
| 302 | 3300020082 | Ga0206353_11891153 | Ga0206353_118911536 | 262 |
| 303 | 3300025901 | Ga0207688_10089026 | Ga0207688_100890262 | 262 |
| 304 | 3300025918 | Ga0207662_10132783 | Ga0207662_101327832 | 262 |
| 305 | 3300025926 | Ga0207659_10336380 | Ga0207659_103363802 | 262 |
| 306 | 3300025927 | Ga0207687_10130345 | Ga0207687_101303452 | 262 |
| 307 | 3300025927 | Ga0207687_10133851 | Ga0207687_101338512 | 262 |
| 308 | 3300025927 | Ga0207687_10256459 | Ga0207687_102564591 | 262 |
| 309 | 3300025933 | Ga0207706_10019419 | Ga0207706_100194194 | 262 |
| 310 | 3300025942 | Ga0207689_10098304 | Ga0207689_100983044 | 262 |
| 311 | 3300025960 | Ga0207651_10166275 | Ga0207651_101662752 | 262 |
| 312 | 3300025961 | Ga0207712_10029400 | Ga0207712_100294003 | 262 |
| 313 | 3300026075 | Ga0207708_10208368 | Ga0207708_102083682 | 262 |
| 314 | 3300026095 | Ga0207676_10437749 | Ga0207676_104377491 | 262 |
| 315 | 3300026118 | Ga0207675_100013667 | Ga0207675_1000136674 | 262 |
| 316 | 3300026118 | Ga0207675_100527183 | Ga0207675_1005271831 | 262 |
| 317 | 3300026121 | Ga0207683_10100850 | Ga0207683_101008502 | 262 |
| 318 | 3300026142 | Ga0207698_10266669 | Ga0207698_102666693 | 262 |
| 319 | 3300027907 | Ga0207428_10000762 | Ga0207428_1000076218 | 262 |
| 320 | 3300027907 | Ga0207428_10002987 | Ga0207428_100029874 | 262 |
| 321 | 3300031247 | Ga0265340_10006814 | Ga0265340_100068144 | 262 |
| 322 | 3300031456 | Ga0307513_10004391 | Ga0307513_100043916 | 262 |
| 323 | 3300031548 | Ga0307408_100062770 | Ga0307408_1000627703 | 262 |
| 324 | 3300031548 | Ga0307408_100167735 | Ga0307408_1001677352 | 262 |
| 325 | 3300031691 | Ga0316579_10000033 | Ga0316579_1000003314 | 262 |
| 326 | 3300031731 | Ga0307405_10010077 | Ga0307405_100100771 | 262 |
| 327 | 3300031824 | Ga0307413_10002548 | Ga0307413_100025483 | 262 |
| 328 | 3300031852 | Ga0307410_10000645 | Ga0307410_1000064512 | 262 |
| 329 | 3300031852 | Ga0307410_10006401 | Ga0307410_100064016 | 262 |
| 330 | 3300031852 | Ga0307410_10070418 | Ga0307410_100704182 | 262 |
| 331 | 3300031901 | Ga0307406_10000359 | Ga0307406_1000035914 | 262 |
| 332 | 3300031901 | Ga0307406_10012203 | Ga0307406_100122035 | 262 |
| 333 | 3300031901 | Ga0307406_10151671 | Ga0307406_101516713 | 262 |
| 334 | 3300031903 | Ga0307407_10020726 | Ga0307407_100207262 | 262 |
| 335 | 3300031911 | Ga0307412_10067640 | Ga0307412_100676402 | 262 |
| 336 | 3300031995 | Ga0307409_100000241 | Ga0307409_1000002418 | 262 |
| 337 | 3300031995 | Ga0307409_100001043 | Ga0307409_10000104312 | 262 |
| 338 | 3300031995 | Ga0307409_100041734 | Ga0307409_1000417345 | 262 |
| 339 | 3300031995 | Ga0307409_100078800 | Ga0307409_1000788002 | 262 |
| 340 | 3300031995 | Ga0307409_100110479 | Ga0307409_1001104794 | 262 |
| 341 | 3300032002 | Ga0307416_100000776 | Ga0307416_1000007766 | 262 |
| 342 | 3300032002 | Ga0307416_100083322 | Ga0307416_1000833224 | 262 |
| 343 | 3300032002 | Ga0307416_100134636 | Ga0307416_1001346364 | 262 |
| 344 | 3300032002 | Ga0307416_100888235 | Ga0307416_1008882351 | 262 |
| 345 | 3300032004 | Ga0307414_10004139 | Ga0307414_100041394 | 262 |
| 346 | 3300032005 | Ga0307411_10031205 | Ga0307411_100312055 | 262 |
| 347 | 3300032126 | Ga0307415_100000728 | Ga0307415_1000007286 | 262 |
| 348 | 3300042016 | Ga0439463_008813 | Ga0439463_008813_1314_2102 | 262 |
| 349 | 3300042439 | Ga0439464_0016034 | Ga0439464_0016034_750_1538 | 262 |
| 350 | 3300044901 | Ga0466960_0047606 | Ga0466960_0047606_80_886 | 262 |
| 351 | 3300044901 | Ga0466960_0197611 | Ga0466960_0197611_57_845 | 262 |
| 352 | 3300046457 | Ga0495590_0041831 | Ga0495590_0041831_774_1562 | 262 |
| 353 | 3300046462 | Ga0495651_0221009 | Ga0495651_0221009_303_1091 | 262 |
| 354 | 3300046463 | Ga0495653_0003372 | Ga0495653_0003372_3077_3865 | 262 |
| 355 | 3300046515 | Ga0495620_0034517 | Ga0495620_0034517_658_1446 | 262 |
| 356 | 3300046519 | Ga0495632_0124754 | Ga0495632_0124754_30_818 | 262 |
| 357 | 3300046615 | Ga0495656_0092515 | Ga0495656_0092515_129_917 | 262 |
| 358 | 3300046616 | Ga0495668_0075966 | Ga0495668_0075966_605_1393 | 262 |
| 359 | 3300047319 | Ga0495674_0359852 | Ga0495674_0359852_330_1118 | 262 |
| 360 | 3300048905 | Ga0496102_0035726 | Ga0496102_0035726_1676_2482 | 262 |
| 361 | 3300048914 | Ga0496111_0097649 | Ga0496111_0097649_387_1181 | 262 |
| 362 | 3300048917 | Ga0496114_0001386 | Ga0496114_0001386_14425_15231 | 262 |
| 363 | 3300048917 | Ga0496114_0015556 | Ga0496114_0015556_3256_4062 | 262 |
| 364 | 3300049514 | Ga0501291_010049 | Ga0501291_010049_93_881 | 262 |
| 365 | 3300049568 | Ga0501031_0001919 | Ga0501031_0001919_4840_5646 | 262 |
| 366 | 3300049568 | Ga0501031_0013782 | Ga0501031_0013782_3464_4252 | 262 |
| 367 | 3300049569 | Ga0501032_0133184 | Ga0501032_0133184_144_932 | 262 |
| 368 | 3300049570 | Ga0501033_0004714 | Ga0501033_0004714_5383_6174 | 262 |
| 369 | 3300049572 | Ga0501036_0002680 | Ga0501036_0002680_1350_2156 | 262 |
| 370 | 3300049572 | Ga0501036_0009496 | Ga0501036_0009496_2970_3758 | 262 |
| 371 | 3300049573 | Ga0501037_0028809 | Ga0501037_0028809_724_1512 | 262 |
| 372 | 3300049573 | Ga0501037_0088589 | Ga0501037_0088589_686_1492 | 262 |
| 373 | 3300049574 | Ga0501038_0012946 | Ga0501038_0012946_2106_2894 | 262 |
| 374 | 3300049574 | Ga0501038_0017662 | Ga0501038_0017662_5173_5979 | 262 |
| 375 | 3300049575 | Ga0501039_0025011 | Ga0501039_0025011_3129_3935 | 262 |
| 376 | 3300049576 | Ga0501040_0004774 | Ga0501040_0004774_2594_3400 | 262 |
| 377 | 3300049577 | Ga0501041_0001143 | Ga0501041_0001143_12847_13653 | 262 |
| 378 | 3300049577 | Ga0501041_0074115 | Ga0501041_0074115_221_1009 | 262 |
| 379 | 3300049578 | Ga0501042_0014278 | Ga0501042_0014278_3463_4251 | 262 |
| 380 | 3300049578 | Ga0501042_0020536 | Ga0501042_0020536_2988_3794 | 262 |
| 381 | 3300049579 | Ga0501043_0019591 | Ga0501043_0019591_777_1583 | 262 |
| 382 | 3300049579 | Ga0501043_0281171 | Ga0501043_0281171_367_1158 | 262 |
| 383 | 3300049580 | Ga0501046_0010494 | Ga0501046_0010494_3741_4532 | 262 |
| 384 | 3300049580 | Ga0501046_0058374 | Ga0501046_0058374_1420_2226 | 262 |
| 385 | 3300049582 | Ga0501048_0002219 | Ga0501048_0002219_9214_10020 | 262 |
| 386 | 3300049584 | Ga0501068_0094978 | Ga0501068_0094978_790_1596 | 262 |
| 387 | 3300049587 | Ga0501071_0003185 | Ga0501071_0003185_9011_9817 | 262 |
| 388 | 3300049587 | Ga0501071_0034794 | Ga0501071_0034794_1976_2764 | 262 |
| 389 | 3300049588 | Ga0501072_0070239 | Ga0501072_0070239_874_1662 | 262 |
| 390 | 3300049588 | Ga0501072_0082451 | Ga0501072_0082451_805_1611 | 262 |
| 391 | 3300049590 | Ga0501074_0026963 | Ga0501074_0026963_273_1061 | 262 |
| 392 | 3300049590 | Ga0501074_0037999 | Ga0501074_0037999_823_1629 | 262 |
| 393 | 3300049591 | Ga0501075_0074446 | Ga0501075_0074446_790_1596 | 262 |
| 394 | 3300049592 | Ga0501076_0003800 | Ga0501076_0003800_693_1481 | 262 |
| 395 | 3300049592 | Ga0501076_0160942 | Ga0501076_0160942_240_1046 | 262 |
| 396 | 3300049593 | Ga0501077_0023095 | Ga0501077_0023095_2483_3289 | 262 |
| 397 | 3300049655 | Ga0501208_007016 | Ga0501208_007016_406_1194 | 262 |
| 398 | 3300049680 | Ga0501250_011169 | Ga0501250_011169_89_877 | 262 |
| 399 | 3300049704 | Ga0501221_014152 | Ga0501221_014152_526_1314 | 262 |
| 400 | 3300049741 | Ga0501079_0001954 | Ga0501079_0001954_7160_7966 | 262 |
| 401 | 3300049742 | Ga0501080_0126596 | Ga0501080_0126596_1379_2185 | 262 |
| 402 | 3300049743 | Ga0501081_0003820 | Ga0501081_0003820_579_1385 | 262 |
| 403 | 3300049822 | Ga0501035_0075878 | Ga0501035_0075878_349_1137 | 262 |
| 404 | 3300049822 | Ga0501035_0103743 | Ga0501035_0103743_82_888 | 262 |
| 405 | 3300049823 | Ga0501044_0368688 | Ga0501044_0368688_277_1068 | 262 |
| 406 | 3300049824 | Ga0501045_0003370 | Ga0501045_0003370_2771_3577 | 262 |
| 407 | 3300050492 | nmdc:mga0yw44_20302_c1 | nmdc:mga0yw44_20302_c1_2175_2975 | 262 |
| 408 | 3300050507 | nmdc:mga05p37_37668_c1 | nmdc:mga05p37_37668_c1_4189_4977 | 262 |
| 409 | 3300050508 | nmdc:mga09592_18650_c1 | nmdc:mga09592_18650_c1_1972_2760 | 262 |
| 410 | 3300050511 | nmdc:mga08y16_4203_c1 | nmdc:mga08y16_4203_c1_12362_13150 | 262 |
| 411 | 3300050512 | nmdc:mga0n895_217_c1 | nmdc:mga0n895_217_c1_20270_21058 | 262 |
| 412 | 3300050513 | nmdc:mga0rr50_26718_c1 | nmdc:mga0rr50_26718_c1_2549_3337 | 262 |
| 413 | 3300050513 | nmdc:mga0rr50_30846_c1 | nmdc:mga0rr50_30846_c1_1530_2318 | 262 |
| 414 | 3300050515 | nmdc:mga0a205_1731_c1 | nmdc:mga0a205_1731_c1_13936_14724 | 262 |
| 415 | 3300050515 | nmdc:mga0a205_21032_c1 | nmdc:mga0a205_21032_c1_1484_2272 | 262 |
| 416 | 3300053085 | Ga0495619_0357553 | Ga0495619_0357553_210_998 | 262 |
| 417 | 3300054114 | Ga0501084_0007477 | Ga0501084_0007477_758_1564 | 262 |
| 418 | 3300054114 | Ga0501084_0151419 | Ga0501084_0151419_392_1180 | 262 |
| 419 | 3300060353 | Ga0501082_0049469 | Ga0501082_0049469_740_1528 | 262 |
| 420 | 3300060353 | Ga0501082_0058657 | Ga0501082_0058657_1646_2452 | 262 |
| 421 | 3300061734 | Ga0530510_0002431 | Ga0530510_0002431_6203_7009 | 262 |
| 422 | iso_pu_bacteria | 2818991462 | 2819691809 | 262 |
| 423 | iso_pu_bacteria | 2818991469 | 2819729414 | 262 |
| 424 | 3300002067 | JGI24735J21928_10025374 | JGI24735J21928_100253742 | 263 |
| 425 | 3300005327 | Ga0070658_10180206 | Ga0070658_101802061 | 263 |
| 426 | 3300005329 | Ga0070683_100028647 | Ga0070683_1000286474 | 263 |
| 427 | 3300005336 | Ga0070680_100083184 | Ga0070680_1000831843 | 263 |
| 428 | 3300005337 | Ga0070682_100055635 | Ga0070682_1000556354 | 263 |
| 429 | 3300005339 | Ga0070660_100394953 | Ga0070660_1003949532 | 263 |
| 430 | 3300005345 | Ga0070692_10014659 | Ga0070692_100146592 | 263 |
| 431 | 3300005366 | Ga0070659_100062050 | Ga0070659_1000620503 | 263 |
| 432 | 3300005367 | Ga0070667_100219563 | Ga0070667_1002195633 | 263 |
| 433 | 3300005530 | Ga0070679_100043095 | Ga0070679_1000430953 | 263 |
| 434 | 3300005535 | Ga0070684_100001477 | Ga0070684_10000147714 | 263 |
| 435 | 3300005539 | Ga0068853_100539853 | Ga0068853_1005398531 | 263 |
| 436 | 3300005563 | Ga0068855_100075566 | Ga0068855_1000755662 | 263 |
| 437 | 3300005614 | Ga0068856_100013092 | Ga0068856_1000130925 | 263 |
| 438 | 3300005616 | Ga0068852_100348298 | Ga0068852_1003482982 | 263 |
| 439 | 3300005718 | Ga0068866_10149273 | Ga0068866_101492731 | 263 |
| 440 | 3300006038 | Ga0075365_10023828 | Ga0075365_100238283 | 263 |
| 441 | 3300009094 | Ga0111539_10093674 | Ga0111539_100936743 | 263 |
| 442 | 3300009098 | Ga0105245_10004528 | Ga0105245_100045283 | 263 |
| 443 | 3300009176 | Ga0105242_10156328 | Ga0105242_101563283 | 263 |
| 444 | 3300009177 | Ga0105248_10025656 | Ga0105248_100256563 | 263 |
| 445 | 3300009553 | Ga0105249_10054015 | Ga0105249_100540154 | 263 |
| 446 | 3300013105 | Ga0157369_10172032 | Ga0157369_101720322 | 263 |
| 447 | 3300013306 | Ga0163162_10011203 | Ga0163162_100112037 | 263 |
| 448 | 3300013306 | Ga0163162_10810791 | Ga0163162_108107912 | 263 |
| 449 | 3300013307 | Ga0157372_10300342 | Ga0157372_103003422 | 263 |
| 450 | 3300014325 | Ga0163163_10037041 | Ga0163163_100370416 | 263 |
| 451 | 3300014325 | Ga0163163_10308490 | Ga0163163_103084902 | 263 |
| 452 | 3300014326 | Ga0157380_10472484 | Ga0157380_104724842 | 263 |
| 453 | 3300021384 | Ga0213876_10095160 | Ga0213876_100951602 | 263 |
| 454 | 3300025904 | Ga0207647_10025112 | Ga0207647_100251126 | 263 |
| 455 | 3300025904 | Ga0207647_10072892 | Ga0207647_100728922 | 263 |
| 456 | 3300025917 | Ga0207660_10067758 | Ga0207660_100677583 | 263 |
| 457 | 3300025921 | Ga0207652_10337513 | Ga0207652_103375131 | 263 |
| 458 | 3300025921 | Ga0207652_10603986 | Ga0207652_106039862 | 263 |
| 459 | 3300025932 | Ga0207690_10126865 | Ga0207690_101268652 | 263 |
| 460 | 3300025935 | Ga0207709_10482779 | Ga0207709_104827791 | 263 |
| 461 | 3300025944 | Ga0207661_10172572 | Ga0207661_101725722 | 263 |
| 462 | 3300025944 | Ga0207661_10323203 | Ga0207661_103232033 | 263 |
| 463 | 3300025949 | Ga0207667_10242704 | Ga0207667_102427042 | 263 |
| 464 | 3300025986 | Ga0207658_10167902 | Ga0207658_101679022 | 263 |
| 465 | 3300026023 | Ga0207677_10289530 | Ga0207677_102895302 | 263 |
| 466 | 3300026041 | Ga0207639_10040091 | Ga0207639_100400912 | 263 |
| 467 | 3300026078 | Ga0207702_10058589 | Ga0207702_100585893 | 263 |
| 468 | 3300026121 | Ga0207683_10235677 | Ga0207683_102356772 | 263 |
| 469 | 3300026142 | Ga0207698_10646285 | Ga0207698_106462852 | 263 |
| 470 | 3300028379 | Ga0268266_10000855 | Ga0268266_1000085534 | 263 |
| 471 | 3300031995 | Ga0307409_100151305 | Ga0307409_1001513053 | 263 |
| 472 | 3300031995 | Ga0307409_100599072 | Ga0307409_1005990721 | 263 |
| 473 | 3300032004 | Ga0307414_10456763 | Ga0307414_104567631 | 263 |
| 474 | 3300039437 | Ga0436365_1153546 | Ga0436365_1153546_503_1294 | 263 |
| 475 | 3300041492 | Ga0451835_0652863 | Ga0451835_0652863_22_825 | 263 |
| 476 | 3300041509 | Ga0451843_1761125 | Ga0451843_1761125_28_831 | 263 |
| 477 | 3300044658 | Ga0466972_0073388 | Ga0466972_0073388_827_1621 | 263 |
| 478 | 3300044683 | Ga0466965_0001100 | Ga0466965_0001100_1451_2245 | 263 |
| 479 | 3300044694 | Ga0466963_0122025 | Ga0466963_0122025_474_1268 | 263 |
| 480 | 3300044719 | Ga0466971_0043653 | Ga0466971_0043653_128_922 | 263 |
| 481 | 3300045051 | Ga0451576_0018962 | Ga0451576_0018962_3074_3865 | 263 |
| 482 | 3300045836 | Ga0466958_0054616 | Ga0466958_0054616_846_1640 | 263 |
| 483 | 3300045976 | Ga0466967_0008910 | Ga0466967_0008910_5124_5915 | 263 |
| 484 | 3300045976 | Ga0466967_0090190 | Ga0466967_0090190_591_1382 | 263 |
| 485 | 3300045976 | Ga0466967_0595940 | Ga0466967_0595940_274_1065 | 263 |
| 486 | 3300047321 | Ga0495676_0443342 | Ga0495676_0443342_19_810 | 263 |
| 487 | 3300048903 | Ga0496100_0397986 | Ga0496100_0397986_40_837 | 263 |
| 488 | 3300048904 | Ga0496101_0079801 | Ga0496101_0079801_1379_2170 | 263 |
| 489 | 3300048905 | Ga0496102_0006762 | Ga0496102_0006762_8526_9317 | 263 |
| 490 | 3300048905 | Ga0496102_0229456 | Ga0496102_0229456_903_1700 | 263 |
| 491 | 3300048905 | Ga0496102_0254003 | Ga0496102_0254003_637_1428 | 263 |
| 492 | 3300048906 | Ga0496103_0034012 | Ga0496103_0034012_319_1110 | 263 |
| 493 | 3300048906 | Ga0496103_0060371 | Ga0496103_0060371_1167_1958 | 263 |
| 494 | 3300048907 | Ga0496104_0001885 | Ga0496104_0001885_10143_10940 | 263 |
| 495 | 3300048908 | Ga0496105_0000343 | Ga0496105_0000343_24508_25305 | 263 |
| 496 | 3300048909 | Ga0496106_0006613 | Ga0496106_0006613_890_1681 | 263 |
| 497 | 3300048910 | Ga0496107_0048983 | Ga0496107_0048983_2059_2850 | 263 |
| 498 | 3300048911 | Ga0496108_0207548 | Ga0496108_0207548_682_1479 | 263 |
| 499 | 3300048912 | Ga0496109_0015105 | Ga0496109_0015105_4525_5322 | 263 |
| 500 | 3300048912 | Ga0496109_0109916 | Ga0496109_0109916_449_1243 | 263 |
| 501 | 3300048912 | Ga0496109_0141538 | Ga0496109_0141538_584_1375 | 263 |
| 502 | 3300048913 | Ga0496110_0006701 | Ga0496110_0006701_3781_4572 | 263 |
| 503 | 3300048914 | Ga0496111_0149059 | Ga0496111_0149059_300_1094 | 263 |
| 504 | 3300048915 | Ga0496112_0256413 | Ga0496112_0256413_108_899 | 263 |
| 505 | 3300048916 | Ga0496113_0359310 | Ga0496113_0359310_30_821 | 263 |
| 506 | 3300048917 | Ga0496114_0006813 | Ga0496114_0006813_7237_8034 | 263 |
| 507 | 3300048917 | Ga0496114_0038855 | Ga0496114_0038855_2481_3272 | 263 |
| 508 | 3300048917 | Ga0496114_0525529 | Ga0496114_0525529_58_849 | 263 |
| 509 | 3300048918 | Ga0496115_0008918 | Ga0496115_0008918_235_1032 | 263 |
| 510 | 3300049568 | Ga0501031_0090304 | Ga0501031_0090304_479_1270 | 263 |
| 511 | 3300049569 | Ga0501032_0057252 | Ga0501032_0057252_1018_1812 | 263 |
| 512 | 3300049569 | Ga0501032_0130275 | Ga0501032_0130275_533_1324 | 263 |
| 513 | 3300049571 | Ga0501034_0016438 | Ga0501034_0016438_113_907 | 263 |
| 514 | 3300049571 | Ga0501034_0041505 | Ga0501034_0041505_554_1345 | 263 |
| 515 | 3300049571 | Ga0501034_0266027 | Ga0501034_0266027_647_1438 | 263 |
| 516 | 3300049572 | Ga0501036_0032559 | Ga0501036_0032559_269_1063 | 263 |
| 517 | 3300049572 | Ga0501036_0235492 | Ga0501036_0235492_642_1442 | 263 |
| 518 | 3300049573 | Ga0501037_0018718 | Ga0501037_0018718_1999_2793 | 263 |
| 519 | 3300049574 | Ga0501038_0009754 | Ga0501038_0009754_3371_4165 | 263 |
| 520 | 3300049574 | Ga0501038_0302739 | Ga0501038_0302739_243_1034 | 263 |
| 521 | 3300049578 | Ga0501042_0039243 | Ga0501042_0039243_855_1649 | 263 |
| 522 | 3300049579 | Ga0501043_0016176 | Ga0501043_0016176_4487_5281 | 263 |
| 523 | 3300049580 | Ga0501046_0021536 | Ga0501046_0021536_2128_2922 | 263 |
| 524 | 3300049581 | Ga0501047_0030123 | Ga0501047_0030123_2439_3233 | 263 |
| 525 | 3300049582 | Ga0501048_0003081 | Ga0501048_0003081_10949_11743 | 263 |
| 526 | 3300049583 | Ga0501067_0001723 | Ga0501067_0001723_8982_9773 | 263 |
| 527 | 3300049583 | Ga0501067_0019013 | Ga0501067_0019013_763_1554 | 263 |
| 528 | 3300049584 | Ga0501068_0005888 | Ga0501068_0005888_5147_5938 | 263 |
| 529 | 3300049584 | Ga0501068_0058694 | Ga0501068_0058694_706_1497 | 263 |
| 530 | 3300049585 | Ga0501069_0047720 | Ga0501069_0047720_189_980 | 263 |
| 531 | 3300049585 | Ga0501069_0082734 | Ga0501069_0082734_515_1306 | 263 |
| 532 | 3300049586 | Ga0501070_0004831 | Ga0501070_0004831_1771_2565 | 263 |
| 533 | 3300049586 | Ga0501070_0007702 | Ga0501070_0007702_4416_5207 | 263 |
| 534 | 3300049586 | Ga0501070_0036195 | Ga0501070_0036195_2149_2940 | 263 |
| 535 | 3300049587 | Ga0501071_0213437 | Ga0501071_0213437_142_933 | 263 |
| 536 | 3300049588 | Ga0501072_0035425 | Ga0501072_0035425_1655_2446 | 263 |
| 537 | 3300049588 | Ga0501072_0103443 | Ga0501072_0103443_766_1557 | 263 |
| 538 | 3300049589 | Ga0501073_0011619 | Ga0501073_0011619_2149_2940 | 263 |
| 539 | 3300049589 | Ga0501073_0030168 | Ga0501073_0030168_2389_3180 | 263 |
| 540 | 3300049590 | Ga0501074_0002308 | Ga0501074_0002308_2320_3111 | 263 |
| 541 | 3300049590 | Ga0501074_0003143 | Ga0501074_0003143_1788_2579 | 263 |
| 542 | 3300049590 | Ga0501074_0146696 | Ga0501074_0146696_43_834 | 263 |
| 543 | 3300049590 | Ga0501074_0383359 | Ga0501074_0383359_188_982 | 263 |
| 544 | 3300049592 | Ga0501076_0321768 | Ga0501076_0321768_131_922 | 263 |
| 545 | 3300049593 | Ga0501077_0015410 | Ga0501077_0015410_1788_2579 | 263 |
| 546 | 3300049593 | Ga0501077_0028507 | Ga0501077_0028507_715_1506 | 263 |
| 547 | 3300049741 | Ga0501079_0293633 | Ga0501079_0293633_142_933 | 263 |
| 548 | 3300049742 | Ga0501080_0001505 | Ga0501080_0001505_12351_13142 | 263 |
| 549 | 3300049742 | Ga0501080_0012257 | Ga0501080_0012257_6064_6855 | 263 |
| 550 | 3300049742 | Ga0501080_0036089 | Ga0501080_0036089_51_845 | 263 |
| 551 | 3300049744 | Ga0501083_0036467 | Ga0501083_0036467_1641_2432 | 263 |
| 552 | 3300049822 | Ga0501035_0004064 | Ga0501035_0004064_10065_10859 | 263 |
| 553 | 3300049822 | Ga0501035_0334480 | Ga0501035_0334480_452_1243 | 263 |
| 554 | 3300049823 | Ga0501044_0149052 | Ga0501044_0149052_915_1709 | 263 |
| 555 | 3300050511 | nmdc:mga08y16_164887_c1 | nmdc:mga08y16_164887_c1_1323_2117 | 263 |
| 556 | 3300054114 | Ga0501084_0056702 | Ga0501084_0056702_445_1236 | 263 |
| 557 | 3300054114 | Ga0501084_0066555 | Ga0501084_0066555_793_1584 | 263 |
| 558 | 3300059424 | Ga0590075_010047 | Ga0590075_010047_764_1558 | 263 |
| 559 | 3300060353 | Ga0501082_0006014 | Ga0501082_0006014_493_1284 | 263 |
| 560 | 3300060353 | Ga0501082_0087906 | Ga0501082_0087906_1654_2445 | 263 |
| 561 | 3300061719 | Ga0466962_0081188 | Ga0466962_0081188_453_1247 | 263 |
| 562 | iso_pu_bacteria | 2643221641 | 2644232191 | 263 |
| 563 | iso_pu_bacteria | 2739367898 | 2740169400 | 263 |
| 564 | iso_pu_bacteria | 2893684298 | 2893684516 | 263 |
| 565 | 3300000549 | LJQas_1000241 | LJQas_10002413 | 264 |
| 566 | 3300002075 | JGI24738J21930_10004130 | JGI24738J21930_100041305 | 264 |
| 567 | 3300002077 | JGI24744J21845_10003101 | JGI24744J21845_100031013 | 264 |
| 568 | 3300005328 | Ga0070676_10099639 | Ga0070676_100996393 | 264 |
| 569 | 3300005329 | Ga0070683_100198245 | Ga0070683_1001982452 | 264 |
| 570 | 3300005329 | Ga0070683_100507177 | Ga0070683_1005071772 | 264 |
| 571 | 3300005337 | Ga0070682_100383418 | Ga0070682_1003834182 | 264 |
| 572 | 3300005338 | Ga0068868_100202380 | Ga0068868_1002023801 | 264 |
| 573 | 3300005340 | Ga0070689_100373282 | Ga0070689_1003732821 | 264 |
| 574 | 3300005345 | Ga0070692_10002700 | Ga0070692_100027008 | 264 |
| 575 | 3300005356 | Ga0070674_100056117 | Ga0070674_1000561174 | 264 |
| 576 | 3300005366 | Ga0070659_100013602 | Ga0070659_1000136024 | 264 |
| 577 | 3300005366 | Ga0070659_100023295 | Ga0070659_1000232955 | 264 |
| 578 | 3300005366 | Ga0070659_100251874 | Ga0070659_1002518742 | 264 |
| 579 | 3300005367 | Ga0070667_100050900 | Ga0070667_1000509001 | 264 |
| 580 | 3300005435 | Ga0070714_100013479 | Ga0070714_1000134796 | 264 |
| 581 | 3300005438 | Ga0070701_10027670 | Ga0070701_100276702 | 264 |
| 582 | 3300005441 | Ga0070700_100048768 | Ga0070700_1000487682 | 264 |
| 583 | 3300005459 | Ga0068867_100003083 | Ga0068867_1000030835 | 264 |
| 584 | 3300005535 | Ga0070684_100134421 | Ga0070684_1001344212 | 264 |
| 585 | 3300005539 | Ga0068853_100116035 | Ga0068853_1001160354 | 264 |
| 586 | 3300005543 | Ga0070672_100009022 | Ga0070672_1000090226 | 264 |
| 587 | 3300005544 | Ga0070686_100136762 | Ga0070686_1001367622 | 264 |
| 588 | 3300005564 | Ga0070664_100046261 | Ga0070664_1000462613 | 264 |
| 589 | 3300005577 | Ga0068857_100513532 | Ga0068857_1005135321 | 264 |
| 590 | 3300005616 | Ga0068852_100166849 | Ga0068852_1001668494 | 264 |
| 591 | 3300005618 | Ga0068864_100091213 | Ga0068864_1000912132 | 264 |
| 592 | 3300005719 | Ga0068861_100005561 | Ga0068861_1000055615 | 264 |
| 593 | 3300005843 | Ga0068860_100000490 | Ga0068860_10000049028 | 264 |
| 594 | 3300005937 | Ga0081455_10000462 | Ga0081455_1000046243 | 264 |
| 595 | 3300005937 | Ga0081455_10007912 | Ga0081455_100079123 | 264 |
| 596 | 3300005981 | Ga0081538_10030060 | Ga0081538_100300604 | 264 |
| 597 | 3300006038 | Ga0075365_10018410 | Ga0075365_100184102 | 264 |
| 598 | 3300006038 | Ga0075365_10063538 | Ga0075365_100635382 | 264 |
| 599 | 3300006038 | Ga0075365_10127904 | Ga0075365_101279043 | 264 |
| 600 | 3300006038 | Ga0075365_10301673 | Ga0075365_103016732 | 264 |
| 601 | 3300006051 | Ga0075364_10078519 | Ga0075364_100785192 | 264 |
| 602 | 3300006178 | Ga0075367_10063602 | Ga0075367_100636023 | 264 |
| 603 | 3300006353 | Ga0075370_10080619 | Ga0075370_100806192 | 264 |
| 604 | 3300006844 | Ga0075428_100001925 | Ga0075428_10000192518 | 264 |
| 605 | 3300006846 | Ga0075430_100008725 | Ga0075430_1000087252 | 264 |
| 606 | 3300006847 | Ga0075431_100038789 | Ga0075431_1000387896 | 264 |
| 607 | 3300006852 | Ga0075433_10140536 | Ga0075433_101405362 | 264 |
| 608 | 3300006880 | Ga0075429_100003147 | Ga0075429_1000031472 | 264 |
| 609 | 3300006880 | Ga0075429_100140024 | Ga0075429_1001400242 | 264 |
| 610 | 3300006881 | Ga0068865_100021028 | Ga0068865_1000210286 | 264 |
| 611 | 3300006881 | Ga0068865_100129921 | Ga0068865_1001299214 | 264 |
| 612 | 3300009094 | Ga0111539_10018138 | Ga0111539_100181384 | 264 |
| 613 | 3300009147 | Ga0114129_10024763 | Ga0114129_100247632 | 264 |
| 614 | 3300009148 | Ga0105243_10005196 | Ga0105243_100051968 | 264 |
| 615 | 3300009551 | Ga0105238_10052181 | Ga0105238_100521813 | 264 |
| 616 | 3300009553 | Ga0105249_10082506 | Ga0105249_100825062 | 264 |
| 617 | 3300009553 | Ga0105249_10271503 | Ga0105249_102715032 | 264 |
| 618 | 3300013105 | Ga0157369_10547348 | Ga0157369_105473481 | 264 |
| 619 | 3300014326 | Ga0157380_10004955 | Ga0157380_100049556 | 264 |
| 620 | 3300014326 | Ga0157380_10331148 | Ga0157380_103311482 | 264 |
| 621 | 3300014745 | Ga0157377_10070470 | Ga0157377_100704701 | 264 |
| 622 | 3300017792 | Ga0163161_10497617 | Ga0163161_104976171 | 264 |
| 623 | 3300025904 | Ga0207647_10012752 | Ga0207647_100127523 | 264 |
| 624 | 3300025908 | Ga0207643_10005142 | Ga0207643_100051429 | 264 |
| 625 | 3300025908 | Ga0207643_10223833 | Ga0207643_102238331 | 264 |
| 626 | 3300025909 | Ga0207705_10423181 | Ga0207705_104231811 | 264 |
| 627 | 3300025918 | Ga0207662_10062504 | Ga0207662_100625042 | 264 |
| 628 | 3300025919 | Ga0207657_10001763 | Ga0207657_1000176322 | 264 |
| 629 | 3300025919 | Ga0207657_10087902 | Ga0207657_100879024 | 264 |
| 630 | 3300025927 | Ga0207687_10128728 | Ga0207687_101287282 | 264 |
| 631 | 3300025927 | Ga0207687_10368383 | Ga0207687_103683832 | 264 |
| 632 | 3300025929 | Ga0207664_10007764 | Ga0207664_100077644 | 264 |
| 633 | 3300025931 | Ga0207644_10159274 | Ga0207644_101592743 | 264 |
| 634 | 3300025932 | Ga0207690_10107107 | Ga0207690_101071072 | 264 |
| 635 | 3300025932 | Ga0207690_10249301 | Ga0207690_102493012 | 264 |
| 636 | 3300025935 | Ga0207709_10120289 | Ga0207709_101202892 | 264 |
| 637 | 3300025937 | Ga0207669_10124273 | Ga0207669_101242732 | 264 |
| 638 | 3300025938 | Ga0207704_10095597 | Ga0207704_100955972 | 264 |
| 639 | 3300025940 | Ga0207691_10001326 | Ga0207691_1000132618 | 264 |
| 640 | 3300025945 | Ga0207679_10012019 | Ga0207679_100120193 | 264 |
| 641 | 3300025945 | Ga0207679_10714423 | Ga0207679_107144231 | 264 |
| 642 | 3300025961 | Ga0207712_10196338 | Ga0207712_101963383 | 264 |
| 643 | 3300025961 | Ga0207712_10333832 | Ga0207712_103338321 | 264 |
| 644 | 3300025972 | Ga0207668_10431852 | Ga0207668_104318521 | 264 |
| 645 | 3300025986 | Ga0207658_10035146 | Ga0207658_100351466 | 264 |
| 646 | 3300026041 | Ga0207639_10160167 | Ga0207639_101601673 | 264 |
| 647 | 3300026067 | Ga0207678_10338638 | Ga0207678_103386382 | 264 |
| 648 | 3300026075 | Ga0207708_10001578 | Ga0207708_1000157810 | 264 |
| 649 | 3300026075 | Ga0207708_10042287 | Ga0207708_100422871 | 264 |
| 650 | 3300026089 | Ga0207648_10000901 | Ga0207648_100009019 | 264 |
| 651 | 3300026118 | Ga0207675_100015322 | Ga0207675_1000153225 | 264 |
| 652 | 3300026118 | Ga0207675_100077611 | Ga0207675_1000776114 | 264 |
| 653 | 3300026118 | Ga0207675_100614879 | Ga0207675_1006148792 | 264 |
| 654 | 3300027907 | Ga0207428_10010257 | Ga0207428_100102574 | 264 |
| 655 | 3300028381 | Ga0268264_10000155 | Ga0268264_1000015527 | 264 |
| 656 | 3300031731 | Ga0307405_10094581 | Ga0307405_100945813 | 264 |
| 657 | 3300031824 | Ga0307413_10055842 | Ga0307413_100558422 | 264 |
| 658 | 3300031852 | Ga0307410_10007372 | Ga0307410_100073725 | 264 |
| 659 | 3300031903 | Ga0307407_10012934 | Ga0307407_100129344 | 264 |
| 660 | 3300031911 | Ga0307412_10059763 | Ga0307412_100597632 | 264 |
| 661 | 3300031911 | Ga0307412_10207975 | Ga0307412_102079752 | 264 |
| 662 | 3300031995 | Ga0307409_100035422 | Ga0307409_1000354222 | 264 |
| 663 | 3300031995 | Ga0307409_100040532 | Ga0307409_1000405323 | 264 |
| 664 | 3300031995 | Ga0307409_100078462 | Ga0307409_1000784623 | 264 |
| 665 | 3300031995 | Ga0307409_100150632 | Ga0307409_1001506323 | 264 |
| 666 | 3300032002 | Ga0307416_100154824 | Ga0307416_1001548242 | 264 |
| 667 | 3300032002 | Ga0307416_100516406 | Ga0307416_1005164062 | 264 |
| 668 | 3300032002 | Ga0307416_100959530 | Ga0307416_1009595302 | 264 |
| 669 | 3300032126 | Ga0307415_100019312 | Ga0307415_1000193123 | 264 |
| 670 | 3300032126 | Ga0307415_100029261 | Ga0307415_1000292612 | 264 |
| 671 | 3300037312 | Ga0395899_0014501 | Ga0395899_0014501_5098_5895 | 264 |
| 672 | 3300037418 | Ga0395900_0079027 | Ga0395900_0079027_2294_3106 | 264 |
| 673 | 3300037418 | Ga0395900_0169233 | Ga0395900_0169233_712_1509 | 264 |
| 674 | 3300037466 | Ga0395898_0140478 | Ga0395898_0140478_1453_2265 | 264 |
| 675 | 3300037471 | Ga0395905_0034140 | Ga0395905_0034140_725_1519 | 264 |
| 676 | 3300037471 | Ga0395905_0093881 | Ga0395905_0093881_1034_1846 | 264 |
| 677 | 3300038443 | Ga0395901_0018915 | Ga0395901_0018915_1657_2454 | 264 |
| 678 | 3300038443 | Ga0395901_0027733 | Ga0395901_0027733_3825_4637 | 264 |
| 679 | 3300041494 | Ga0451837_0251532 | Ga0451837_0251532_564_1370 | 264 |
| 680 | 3300041512 | Ga0451853_0197664 | Ga0451853_0197664_2904_3710 | 264 |
| 681 | 3300042004 | Ga0439445_0014730 | Ga0439445_0014730_416_1213 | 264 |
| 682 | 3300042156 | Ga0439446_0026025 | Ga0439446_0026025_534_1331 | 264 |
| 683 | 3300042435 | Ga0439434_0005938 | Ga0439434_0005938_682_1479 | 264 |
| 684 | 3300044656 | Ga0466969_0076767 | Ga0466969_0076767_59_856 | 264 |
| 685 | 3300044658 | Ga0466972_0030057 | Ga0466972_0030057_524_1321 | 264 |
| 686 | 3300044658 | Ga0466972_0055080 | Ga0466972_0055080_1011_1805 | 264 |
| 687 | 3300044683 | Ga0466965_0009959 | Ga0466965_0009959_2694_3491 | 264 |
| 688 | 3300044683 | Ga0466965_0036712 | Ga0466965_0036712_491_1285 | 264 |
| 689 | 3300044683 | Ga0466965_0041162 | Ga0466965_0041162_249_1046 | 264 |
| 690 | 3300044684 | Ga0466966_0060991 | Ga0466966_0060991_260_1057 | 264 |
| 691 | 3300044693 | Ga0466961_0124038 | Ga0466961_0124038_711_1508 | 264 |
| 692 | 3300044694 | Ga0466963_0029911 | Ga0466963_0029911_677_1474 | 264 |
| 693 | 3300044706 | Ga0466964_0111170 | Ga0466964_0111170_126_920 | 264 |
| 694 | 3300044719 | Ga0466971_0050259 | Ga0466971_0050259_651_1493 | 264 |
| 695 | 3300044719 | Ga0466971_0059250 | Ga0466971_0059250_390_1187 | 264 |
| 696 | 3300044765 | Ga0466970_0050536 | Ga0466970_0050536_593_1390 | 264 |
| 697 | 3300044765 | Ga0466970_0115917 | Ga0466970_0115917_100_897 | 264 |
| 698 | 3300044842 | Ga0466957_0062646 | Ga0466957_0062646_1427_2224 | 264 |
| 699 | 3300044901 | Ga0466960_0002211 | Ga0466960_0002211_2293_3090 | 264 |
| 700 | 3300044901 | Ga0466960_0012753 | Ga0466960_0012753_2724_3521 | 264 |
| 701 | 3300044901 | Ga0466960_0026422 | Ga0466960_0026422_696_1493 | 264 |
| 702 | 3300044901 | Ga0466960_0114095 | Ga0466960_0114095_193_990 | 264 |
| 703 | 3300045049 | Ga0466959_0043735 | Ga0466959_0043735_332_1129 | 264 |
| 704 | 3300045049 | Ga0466959_0485068 | Ga0466959_0485068_15_812 | 264 |
| 705 | 3300045836 | Ga0466958_0073838 | Ga0466958_0073838_809_1606 | 264 |
| 706 | 3300045976 | Ga0466967_0018579 | Ga0466967_0018579_3666_4463 | 264 |
| 707 | 3300045976 | Ga0466967_0250665 | Ga0466967_0250665_64_861 | 264 |
| 708 | 3300046535 | Ga0495586_0314972 | Ga0495586_0314972_57_869 | 264 |
| 709 | 3300048903 | Ga0496100_0103656 | Ga0496100_0103656_180_992 | 264 |
| 710 | 3300048904 | Ga0496101_0066073 | Ga0496101_0066073_994_1806 | 264 |
| 711 | 3300048905 | Ga0496102_0008565 | Ga0496102_0008565_764_1576 | 264 |
| 712 | 3300048905 | Ga0496102_0512265 | Ga0496102_0512265_91_903 | 264 |
| 713 | 3300048906 | Ga0496103_0087483 | Ga0496103_0087483_38_850 | 264 |
| 714 | 3300048907 | Ga0496104_0025182 | Ga0496104_0025182_2224_3036 | 264 |
| 715 | 3300048907 | Ga0496104_0548376 | Ga0496104_0548376_68_880 | 264 |
| 716 | 3300048907 | Ga0496104_0609769 | Ga0496104_0609769_160_972 | 264 |
| 717 | 3300048908 | Ga0496105_0004871 | Ga0496105_0004871_189_1001 | 264 |
| 718 | 3300048908 | Ga0496105_0049207 | Ga0496105_0049207_2105_2917 | 264 |
| 719 | 3300048908 | Ga0496105_0200332 | Ga0496105_0200332_166_960 | 264 |
| 720 | 3300048909 | Ga0496106_0178993 | Ga0496106_0178993_307_1104 | 264 |
| 721 | 3300048911 | Ga0496108_0025707 | Ga0496108_0025707_2616_3416 | 264 |
| 722 | 3300048911 | Ga0496108_0113661 | Ga0496108_0113661_1360_2154 | 264 |
| 723 | 3300048912 | Ga0496109_0014363 | Ga0496109_0014363_4538_5338 | 264 |
| 724 | 3300048913 | Ga0496110_0016549 | Ga0496110_0016549_1030_1842 | 264 |
| 725 | 3300048913 | Ga0496110_0024390 | Ga0496110_0024390_3452_4279 | 264 |
| 726 | 3300048913 | Ga0496110_0026885 | Ga0496110_0026885_2691_3485 | 264 |
| 727 | 3300048913 | Ga0496110_0203886 | Ga0496110_0203886_239_1051 | 264 |
| 728 | 3300048913 | Ga0496110_0205461 | Ga0496110_0205461_610_1407 | 264 |
| 729 | 3300048913 | Ga0496110_0302443 | Ga0496110_0302443_60_857 | 264 |
| 730 | 3300048914 | Ga0496111_0113004 | Ga0496111_0113004_791_1603 | 264 |
| 731 | 3300048916 | Ga0496113_0165252 | Ga0496113_0165252_895_1707 | 264 |
| 732 | 3300048916 | Ga0496113_0200997 | Ga0496113_0200997_300_1127 | 264 |
| 733 | 3300048917 | Ga0496114_0004950 | Ga0496114_0004950_7170_7976 | 264 |
| 734 | 3300048917 | Ga0496114_0274934 | Ga0496114_0274934_573_1391 | 264 |
| 735 | 3300048917 | Ga0496114_0290830 | Ga0496114_0290830_600_1412 | 264 |
| 736 | 3300048927 | Ga0496124_0065792 | Ga0496124_0065792_1124_1918 | 264 |
| 737 | 3300049568 | Ga0501031_0090194 | Ga0501031_0090194_1157_1957 | 264 |
| 738 | 3300049570 | Ga0501033_0151606 | Ga0501033_0151606_803_1600 | 264 |
| 739 | 3300049571 | Ga0501034_0005406 | Ga0501034_0005406_3808_4605 | 264 |
| 740 | 3300049574 | Ga0501038_0000969 | Ga0501038_0000969_4598_5395 | 264 |
| 741 | 3300049575 | Ga0501039_0277384 | Ga0501039_0277384_188_985 | 264 |
| 742 | 3300049577 | Ga0501041_0139130 | Ga0501041_0139130_676_1473 | 264 |
| 743 | 3300049577 | Ga0501041_0178575 | Ga0501041_0178575_453_1256 | 264 |
| 744 | 3300049578 | Ga0501042_0080019 | Ga0501042_0080019_458_1255 | 264 |
| 745 | 3300049585 | Ga0501069_0069790 | Ga0501069_0069790_218_1012 | 264 |
| 746 | 3300049587 | Ga0501071_0133606 | Ga0501071_0133606_595_1398 | 264 |
| 747 | 3300049587 | Ga0501071_0240098 | Ga0501071_0240098_525_1322 | 264 |
| 748 | 3300049588 | Ga0501072_0016523 | Ga0501072_0016523_1403_2197 | 264 |
| 749 | 3300049591 | Ga0501075_0131643 | Ga0501075_0131643_256_1059 | 264 |
| 750 | 3300049822 | Ga0501035_0018071 | Ga0501035_0018071_245_1042 | 264 |
| 751 | 3300049823 | Ga0501044_0023962 | Ga0501044_0023962_3462_4259 | 264 |
| 752 | 3300049824 | Ga0501045_0291358 | Ga0501045_0291358_240_1037 | 264 |
| 753 | 3300050491 | nmdc:mga00v17_17269_c1 | nmdc:mga00v17_17269_c1_2622_3416 | 264 |
| 754 | 3300050491 | nmdc:mga00v17_88442_c1 | nmdc:mga00v17_88442_c1_660_1454 | 264 |
| 755 | 3300050492 | nmdc:mga0yw44_612_c1 | nmdc:mga0yw44_612_c1_3135_3929 | 264 |
| 756 | 3300050492 | nmdc:mga0yw44_99668_c2 | nmdc:mga0yw44_99668_c2_321_1115 | 264 |
| 757 | 3300050494 | nmdc:mga06z11_30411_c1 | nmdc:mga06z11_30411_c1_918_1712 | 264 |
| 758 | 3300050496 | nmdc:mga07m45_21596_c1 | nmdc:mga07m45_21596_c1_1207_2001 | 264 |
| 759 | 3300050496 | nmdc:mga07m45_366096_c1 | nmdc:mga07m45_366096_c1_19_813 | 264 |
| 760 | 3300050507 | nmdc:mga05p37_162_c1 | nmdc:mga05p37_162_c1_33006_33803 | 264 |
| 761 | 3300050508 | nmdc:mga09592_165_c1 | nmdc:mga09592_165_c1_14430_15227 | 264 |
| 762 | 3300050508 | nmdc:mga09592_230836_c1 | nmdc:mga09592_230836_c1_154_951 | 264 |
| 763 | 3300050509 | nmdc:mga0qj67_256480_c1 | nmdc:mga0qj67_256480_c1_246_1043 | 264 |
| 764 | 3300050509 | nmdc:mga0qj67_6234_c1 | nmdc:mga0qj67_6234_c1_231_1028 | 264 |
| 765 | 3300050510 | nmdc:mga06r32_265_c1 | nmdc:mga06r32_265_c1_7437_8234 | 264 |
| 766 | 3300050510 | nmdc:mga06r32_656_c1 | nmdc:mga06r32_656_c1_13507_14304 | 264 |
| 767 | 3300050511 | nmdc:mga08y16_3562_c1 | nmdc:mga08y16_3562_c1_3276_4073 | 264 |
| 768 | 3300053077 | Ga0495601_0050241 | Ga0495601_0050241_877_1716 | 264 |
| 769 | 3300053088 | Ga0500644_0141923 | Ga0500644_0141923_76_870 | 264 |
| 770 | 3300061719 | Ga0466962_0023396 | Ga0466962_0023396_594_1391 | 264 |
| 771 | iso_pu_bacteria | 2773857762 | 2774392115 | 264 |
| 772 | iso_pu_bacteria | 2808606439 | 2809195903 | 264 |
| 773 | iso_pu_bacteria | 2811994878 | 2812351949 | 264 |
| 774 | iso_pu_bacteria | 2811994882 | 2812375055 | 264 |
| 775 | iso_pu_bacteria | 2891968417 | 2891970406 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4y9a-assembly2.cif.gz_C | crystal structure of triosephosphate isomerase from streptomyces coelicolor | 0.9847 | 5 | 260 |
| 4y9a-assembly2.cif.gz_C | crystal structure of triosephosphate isomerase from streptomyces coelicolor | 0.9809 | 5 | 260 |
| 3ta6-assembly1.cif.gz_A | structure of mycobacterium tuberculosis triosephosphate isomerase | 0.9792 | 5 | 258 |
| 4y8f-assembly1.cif.gz_A-2 | crystal structure of triosephosphate isomerase from clostridium perfringens | 0.9784 | 5 | 257 |
| 5ibx-assembly4.cif.gz_E | 1.65 angstrom crystal structure of triosephosphate isomerase (tim) from streptococcus pneumoniae | 0.9755 | 3 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6MQG5_2_109_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9818 | 169 | 258 | 3.20.20.70 |
| 3taoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9724 | 4 | 262 | 3.20.20.70 |
| 3taoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9687 | 4 | 262 | 3.20.20.70 |
| 4g1kC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9665 | 4 | 258 | 3.20.20.70 |
| 6bveB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9647 | 5 | 258 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N0DUY5-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9986 | 4 | 264 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A7Z0DBA7-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9976 | 4 | 260 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A1Q2CDE1-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9975 | 5 | 261 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-A0A3D0S5W4-F1-model_v4 | Triosephosphate isomerase (EC 5.3.1.1) | 0.9969 | 9 | 179 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
| AF-K7S3G5-F1-model_v4 | Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) | 0.9968 | 5 | 259 |
GO:0004807
GO:0005829 GO:0006094 GO:0006096 GO:0019563 GO:0046166 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar