F480271

General Info

Members Datasets Scaffolds Average Seq Length
775 321 741 262

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_1395193|Ga0451843_1395193_1071_1883
Length 263
Sequence MAASKAEAGNRTPLMAGNWKLTFDHQQAAHFVQKLAWTLEDAKHDFDAVEVALLPPFTDLRSVQTLVDGDKLQFRYGAQDLSEHDKGAYTGEVSGGMLAKLGCTYAVVGHSERRTVVNAKVKAAYRHGLTPILCVGEGLDVRKSQEHVPHCEQQIDRDLAGITAEQVASIVIAYEPVWAIGTGEVATPEDAQEVCAAIRTRLAGLYSPEIAGGVRILYGGSVKAANVAGIMAQPDVDGALVGGASTDPAEFASIARYRDHKTG

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
4 2643221613 Oerskovia sp. Root22 Isolate Unclassified
5 2643221615 Nocardioides sp. Root224 Isolate Unclassified
6 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
7 2643221641 Nocardioides sp. Root122 Isolate Unclassified
8 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
9 2643221696 Nocardioides sp. Root140 Isolate Unclassified
10 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
11 2643221711 Terrabacter sp. Root85 Isolate Unclassified
12 2643221721 Oerskovia sp. Root918 Isolate Unclassified
13 2738541305 Nocardioides sp. CF167 Isolate Unclassified
14 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
15 2739367898 Nocardioides sp. CF479 Isolate Unclassified
16 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
17 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
18 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
19 2808606394 Promicromonospora sp. C35 Isolate Unclassified
20 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
21 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
22 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
23 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
24 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
25 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
26 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
27 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
28 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
29 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
30 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
31 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
32 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
33 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
36 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
37 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
164 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
180 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
181 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
193 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
194 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
198 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
199 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
285 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
286 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
287 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
313 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
314 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
320 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
321 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 0.52
Isolates 4.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.68
Nodule 0.13
Rhizoplane 10.19
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 5.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000241 3300000549 Bacteria 10041
2 JGI24735J21928_10025374 3300002067 Bacteria 1789
3 JGI24738J21930_10004130 3300002075 Bacteria 3579
4 JGI24744J21845_10003101 3300002077 Bacteria 3407
5 Ga0007423J48922_100026 3300003285 Bacteria 6067
6 Ga0007423J48922_100029 3300003285 Bacteria 3404
7 JGI25407J50210_10020881 3300003373 Bacteria 1703
8 Ga0070658_10108699 3300005327 Bacteria 2295
9 Ga0070658_10180206 3300005327 Bacteria 1778
10 Ga0070676_10099639 3300005328 Bacteria 1793
11 Ga0070683_100028647 3300005329 Bacteria 5035
12 Ga0070683_100198245 3300005329 Bacteria 1906
13 Ga0070683_100507177 3300005329 Bacteria 1153
14 Ga0068869_100087538 3300005334 Bacteria 2337
15 Ga0070680_100083184 3300005336 Bacteria 2643
16 Ga0070682_100055635 3300005337 Bacteria 2486
17 Ga0070682_100091053 3300005337 Bacteria 1995
18 Ga0070682_100383418 3300005337 Bacteria 1058
19 Ga0068868_100202380 3300005338 Bacteria 1656
20 Ga0070660_100394953 3300005339 Bacteria 1143
21 Ga0070689_100373282 3300005340 Bacteria 1201
22 Ga0070692_10002700 3300005345 Bacteria 6953
23 Ga0070692_10014659 3300005345 Bacteria 3689
24 Ga0070668_100060446 3300005347 Bacteria 2934
25 Ga0070675_100103827 3300005354 Bacteria 2397
26 Ga0070674_100056117 3300005356 Bacteria 2730
27 Ga0070674_100112604 3300005356 Bacteria 2000
28 Ga0070673_100275094 3300005364 Bacteria 1475
29 Ga0070659_100013602 3300005366 Bacteria 6062
30 Ga0070659_100023295 3300005366 Bacteria 4738
31 Ga0070659_100062050 3300005366 Bacteria 2954
32 Ga0070659_100251874 3300005366 Bacteria 1464
33 Ga0070667_100050900 3300005367 Bacteria 3491
34 Ga0070667_100219563 3300005367 Bacteria 1692
35 Ga0070714_100013479 3300005435 Bacteria 6551
36 Ga0070701_10027670 3300005438 Bacteria 2780
37 Ga0070700_100048768 3300005441 Bacteria 2626
38 Ga0070708_100316500 3300005445 Bacteria 1470
39 Ga0070663_100117139 3300005455 Bacteria 2009
40 Ga0070678_100290557 3300005456 Bacteria 1386
41 Ga0068867_100003083 3300005459 Bacteria 11743
42 Ga0068867_100055185 3300005459 Bacteria 2937
43 Ga0068867_100400648 3300005459 Bacteria 1157
44 Ga0070698_100008110 3300005471 Bacteria 11352
45 Ga0070679_100043095 3300005530 Bacteria 4495
46 Ga0070684_100001477 3300005535 Bacteria 16957
47 Ga0070684_100134421 3300005535 Bacteria 2233
48 Ga0070684_100364623 3300005535 Bacteria 1330
49 Ga0070684_100467158 3300005535 Bacteria 1167
50 Ga0068853_100116035 3300005539 Bacteria 2384
51 Ga0068853_100192805 3300005539 Bacteria 1852
52 Ga0068853_100539853 3300005539 Bacteria 1104
53 Ga0070672_100009022 3300005543 Bacteria 6856
54 Ga0070686_100136762 3300005544 Bacteria 1701
55 Ga0070665_100202474 3300005548 Bacteria 1985
56 Ga0068855_100075566 3300005563 Bacteria 3912
57 Ga0070664_100046261 3300005564 Bacteria 3676
58 Ga0068857_100513532 3300005577 Bacteria 1125
59 Ga0068856_100013092 3300005614 Bacteria 8034
60 Ga0068852_100166849 3300005616 Bacteria 2061
61 Ga0068852_100348298 3300005616 Bacteria 1446
62 Ga0068864_100091213 3300005618 Bacteria 2687
63 Ga0068866_10149273 3300005718 Bacteria 1352
64 Ga0068861_100005561 3300005719 Bacteria 8537
65 Ga0068861_100035396 3300005719 Bacteria 3698
66 Ga0068861_100113898 3300005719 Bacteria 2171
67 Ga0068860_100000490 3300005843 Bacteria 48926
68 Ga0081455_10000389 3300005937 Bacteria 58107
69 Ga0081455_10000462 3300005937 Bacteria 53037
70 Ga0081455_10002237 3300005937 Bacteria 23049
71 Ga0081455_10007912 3300005937 Bacteria 11128
72 Ga0081455_10035251 3300005937 Bacteria 4474
73 Ga0081455_10039452 3300005937 Bacteria 4173
74 Ga0081538_10000092 3300005981 Bacteria 87123
75 Ga0081538_10000958 3300005981 Bacteria 30846
76 Ga0081538_10030060 3300005981 Bacteria 3697
77 Ga0081540_1029003 3300005983 Bacteria 3093
78 Ga0075365_10000677 3300006038 Bacteria 13683
79 Ga0075365_10016366 3300006038 Bacteria 4509
80 Ga0075365_10018410 3300006038 Bacteria 4293
81 Ga0075365_10023828 3300006038 Bacteria 3853
82 Ga0075365_10063538 3300006038 Bacteria 2472
83 Ga0075365_10102854 3300006038 Bacteria 1958
84 Ga0075365_10127904 3300006038 Bacteria 1757
85 Ga0075365_10134122 3300006038 Bacteria 1715
86 Ga0075365_10301673 3300006038 Bacteria 1127
87 Ga0075368_10000261 3300006042 Bacteria 15132
88 Ga0075368_10010386 3300006042 Bacteria 3365
89 Ga0075363_100003243 3300006048 Bacteria 6878
90 Ga0075363_100030888 3300006048 Bacteria 2775
91 Ga0075364_10052499 3300006051 Bacteria 2664
92 Ga0075364_10078519 3300006051 Bacteria 2180
93 Ga0075432_10000058 3300006058 Bacteria 21877
94 Ga0075362_10001939 3300006177 Bacteria 6799
95 Ga0075367_10021645 3300006178 Bacteria 3596
96 Ga0075367_10063602 3300006178 Bacteria 2206
97 Ga0075370_10020511 3300006353 Bacteria 3614
98 Ga0075370_10080619 3300006353 Bacteria 1870
99 Ga0075428_100001925 3300006844 Bacteria 22274
100 Ga0075428_100005267 3300006844 Bacteria 14385
101 Ga0075428_100006278 3300006844 Bacteria 13214
102 Ga0075430_100008725 3300006846 Bacteria 8556
103 Ga0075430_100022049 3300006846 Bacteria 5414
104 Ga0075431_100007939 3300006847 Bacteria 10578
105 Ga0075431_100038789 3300006847 Bacteria 4908
106 Ga0075433_10000219 3300006852 Bacteria 32497
107 Ga0075433_10000698 3300006852 Bacteria 22940
108 Ga0075433_10140536 3300006852 Bacteria 2146
109 Ga0075434_100062096 3300006871 Bacteria 3719
110 Ga0075434_100086091 3300006871 Bacteria 3142
111 Ga0075429_100003147 3300006880 Bacteria 14017
112 Ga0075429_100140024 3300006880 Bacteria 2118
113 Ga0068865_100021028 3300006881 Bacteria 4240
114 Ga0068865_100030955 3300006881 Bacteria 3563
115 Ga0068865_100129921 3300006881 Bacteria 1886
116 Ga0068865_100184051 3300006881 Bacteria 1611
117 Ga0075435_100009410 3300007076 Bacteria 7072
118 Ga0075435_100025910 3300007076 Bacteria 4570
119 Ga0111539_10000761 3300009094 Bacteria 41945
120 Ga0111539_10018138 3300009094 Bacteria 8717
121 Ga0111539_10093674 3300009094 Bacteria 3528
122 Ga0111539_10708063 3300009094 Bacteria 1172
123 Ga0105245_10004528 3300009098 Bacteria 12274
124 Ga0105245_10140867 3300009098 Bacteria 2271
125 Ga0105245_10200037 3300009098 Bacteria 1918
126 Ga0114129_10024763 3300009147 Bacteria 8508
127 Ga0114129_10025297 3300009147 Bacteria 8411
128 Ga0114129_10322865 3300009147 Bacteria 2052
129 Ga0105243_10005196 3300009148 Bacteria 10187
130 Ga0105243_10020623 3300009148 Bacteria 4997
131 Ga0105243_10037006 3300009148 Bacteria 3790
132 Ga0105243_10113163 3300009148 Bacteria 2275
133 Ga0105242_10079298 3300009176 Bacteria 2742
134 Ga0105242_10156328 3300009176 Bacteria 1992
135 Ga0105248_10025656 3300009177 Bacteria 6554
136 Ga0105238_10052181 3300009551 Bacteria 4111
137 Ga0105238_10168125 3300009551 Bacteria 2169
138 Ga0105238_10237316 3300009551 Bacteria 1801
139 Ga0105249_10009986 3300009553 Bacteria 8327
140 Ga0105249_10054015 3300009553 Bacteria 3672
141 Ga0105249_10082506 3300009553 Bacteria 2991
142 Ga0105249_10271503 3300009553 Bacteria 1690
143 Ga0105249_10995299 3300009553 Bacteria 907
144 Ga0105246_10085253 3300011119 Bacteria 2262
145 Ga0105246_10416826 3300011119 Bacteria 1119
146 Ga0157369_10027443 3300013105 Bacteria 6312
147 Ga0157369_10172032 3300013105 Bacteria 2282
148 Ga0157369_10547348 3300013105 Bacteria 1196
149 Ga0157369_10826588 3300013105 Bacteria 951
150 Ga0157374_10273545 3300013296 Bacteria 1666
151 Ga0163162_10011203 3300013306 Bacteria 8741
152 Ga0163162_10061724 3300013306 Bacteria 3786
153 Ga0163162_10810791 3300013306 Bacteria 1053
154 Ga0157372_10278953 3300013307 Bacteria 1943
155 Ga0157372_10300342 3300013307 Bacteria 1867
156 Ga0157372_10357501 3300013307 Bacteria 1702
157 Ga0157375_10048309 3300013308 Bacteria 4162
158 Ga0157375_10109681 3300013308 Bacteria 2856
159 Ga0163163_10037041 3300014325 Bacteria 4743
160 Ga0163163_10177142 3300014325 Bacteria 2179
161 Ga0163163_10308490 3300014325 Bacteria 1635
162 Ga0157380_10004955 3300014326 Bacteria 9279
163 Ga0157380_10027767 3300014326 Bacteria 4307
164 Ga0157380_10152224 3300014326 Bacteria 2001
165 Ga0157380_10210601 3300014326 Bacteria 1732
166 Ga0157380_10331148 3300014326 Bacteria 1416
167 Ga0157380_10472484 3300014326 Bacteria 1210
168 Ga0182008_10102494 3300014497 Bacteria 1415
169 Ga0157377_10051441 3300014745 Bacteria 2324
170 Ga0157377_10070470 3300014745 Bacteria 2020
171 Ga0157376_10230246 3300014969 Bacteria 1721
172 Ga0163161_10003339 3300017792 Bacteria 11257
173 Ga0163161_10141764 3300017792 Bacteria 1820
174 Ga0163161_10207374 3300017792 Bacteria 1513
175 Ga0163161_10271923 3300017792 Bacteria 1326
176 Ga0163161_10497617 3300017792 Bacteria 992
177 Ga0206353_11891153 3300020082 Bacteria 9416
178 Ga0213876_10095160 3300021384 Bacteria 1578
179 Ga0207688_10029422 3300025901 Bacteria 3024
180 Ga0207688_10076258 3300025901 Bacteria 1909
181 Ga0207688_10089026 3300025901 Bacteria 1770
182 Ga0207647_10012752 3300025904 Bacteria 5841
183 Ga0207647_10025112 3300025904 Bacteria 3921
184 Ga0207647_10072892 3300025904 Bacteria 2070
185 Ga0207643_10005142 3300025908 Bacteria 6998
186 Ga0207643_10223833 3300025908 Bacteria 1152
187 Ga0207705_10423181 3300025909 Bacteria 1031
188 Ga0207660_10067758 3300025917 Bacteria 2586
189 Ga0207662_10062504 3300025918 Bacteria 2238
190 Ga0207662_10132783 3300025918 Bacteria 1571
191 Ga0207662_10160643 3300025918 Bacteria 1435
192 Ga0207657_10001763 3300025919 Bacteria 23366
193 Ga0207657_10087902 3300025919 Bacteria 2599
194 Ga0207652_10337513 3300025921 Bacteria 1360
195 Ga0207652_10603986 3300025921 Bacteria 984
196 Ga0207659_10336380 3300025926 Bacteria 1249
197 Ga0207687_10128728 3300025927 Bacteria 1905
198 Ga0207687_10130345 3300025927 Bacteria 1894
199 Ga0207687_10133851 3300025927 Bacteria 1872
200 Ga0207687_10180507 3300025927 Bacteria 1635
201 Ga0207687_10256459 3300025927 Bacteria 1392
202 Ga0207687_10368383 3300025927 Bacteria 1174
203 Ga0207664_10007764 3300025929 Bacteria 7448
204 Ga0207644_10159274 3300025931 Bacteria 1754
205 Ga0207690_10107107 3300025932 Bacteria 2007
206 Ga0207690_10126865 3300025932 Bacteria 1862
207 Ga0207690_10249301 3300025932 Bacteria 1371
208 Ga0207690_10289523 3300025932 Bacteria 1278
209 Ga0207706_10019419 3300025933 Bacteria 6115
210 Ga0207709_10120289 3300025935 Bacteria 1772
211 Ga0207709_10482779 3300025935 Bacteria 964
212 Ga0207669_10124273 3300025937 Bacteria 1759
213 Ga0207704_10019073 3300025938 Bacteria 3595
214 Ga0207704_10095597 3300025938 Bacteria 1965
215 Ga0207691_10001326 3300025940 Bacteria 24697
216 Ga0207691_10392789 3300025940 Bacteria 1183
217 Ga0207691_10413407 3300025940 Bacteria 1150
218 Ga0207689_10098304 3300025942 Bacteria 2404
219 Ga0207661_10172572 3300025944 Bacteria 1883
220 Ga0207661_10323203 3300025944 Bacteria 1387
221 Ga0207679_10012019 3300025945 Bacteria 5629
222 Ga0207679_10714423 3300025945 Bacteria 910
223 Ga0207667_10242704 3300025949 Bacteria 1843
224 Ga0207651_10166275 3300025960 Bacteria 1735
225 Ga0207712_10029400 3300025961 Bacteria 3686
226 Ga0207712_10196338 3300025961 Bacteria 1597
227 Ga0207712_10333832 3300025961 Bacteria 1255
228 Ga0207668_10431852 3300025972 Bacteria 1120
229 Ga0207658_10035146 3300025986 Bacteria 3588
230 Ga0207658_10167902 3300025986 Bacteria 1805
231 Ga0207677_10289530 3300026023 Bacteria 1348
232 Ga0207639_10040091 3300026041 Bacteria 3494
233 Ga0207639_10131561 3300026041 Bacteria 2072
234 Ga0207639_10160167 3300026041 Bacteria 1895
235 Ga0207678_10146413 3300026067 Bacteria 2016
236 Ga0207678_10338638 3300026067 Bacteria 1296
237 Ga0207708_10001578 3300026075 Bacteria 17017
238 Ga0207708_10042287 3300026075 Bacteria 3474
239 Ga0207708_10208368 3300026075 Bacteria 1562
240 Ga0207702_10058589 3300026078 Bacteria 3278
241 Ga0207648_10000901 3300026089 Bacteria 33502
242 Ga0207648_10205336 3300026089 Bacteria 1748
243 Ga0207676_10437749 3300026095 Bacteria 1230
244 Ga0207676_10891979 3300026095 Bacteria 872
245 Ga0207675_100013667 3300026118 Bacteria 7575
246 Ga0207675_100015322 3300026118 Bacteria 7153
247 Ga0207675_100077611 3300026118 Bacteria 3112
248 Ga0207675_100527183 3300026118 Bacteria 1178
249 Ga0207675_100614879 3300026118 Bacteria 1090
250 Ga0207683_10033331 3300026121 Bacteria 4473
251 Ga0207683_10100850 3300026121 Bacteria 2577
252 Ga0207683_10235677 3300026121 Bacteria 1669
253 Ga0207683_10331275 3300026121 Bacteria 1395
254 Ga0207698_10266669 3300026142 Bacteria 1576
255 Ga0207698_10646285 3300026142 Bacteria 1047
256 Ga0209813_10002911 3300027866 Bacteria 3963
257 Ga0209813_10007472 3300027866 Bacteria 2725
258 Ga0207428_10000762 3300027907 Bacteria 36710
259 Ga0207428_10002987 3300027907 Bacteria 16703
260 Ga0207428_10010257 3300027907 Bacteria 8374
261 Ga0268266_10000855 3300028379 Bacteria 39694
262 Ga0268266_10115839 3300028379 Bacteria 2380
263 Ga0268264_10000155 3300028381 Bacteria 156029
264 Ga0314311_1057189 3300030733 Bacteria 1676
265 Ga0265340_10006814 3300031247 Bacteria 6251
266 Ga0307513_10004391 3300031456 Bacteria 18827
267 Ga0307408_100062770 3300031548 Bacteria 2716
268 Ga0307408_100135038 3300031548 Bacteria 1929
269 Ga0307408_100167735 3300031548 Bacteria 1750
270 Ga0316575_10000376 3300031665 Bacteria 12717
271 Ga0316575_10038672 3300031665 Bacteria 1882
272 Ga0316579_10000033 3300031691 Bacteria 31437
273 Ga0316579_10000355 3300031691 Bacteria 14402
274 Ga0316579_10005298 3300031691 Bacteria 5194
275 Ga0316576_10001640 3300031727 Bacteria 12249
276 Ga0316578_10001217 3300031728 Bacteria 10223
277 Ga0316578_10157706 3300031728 Bacteria 1367
278 Ga0307405_10010077 3300031731 Bacteria 4876
279 Ga0307405_10094581 3300031731 Bacteria 1988
280 Ga0316577_10011722 3300031733 Bacteria 4755
281 Ga0316577_10090677 3300031733 Bacteria 1711
282 Ga0307413_10002548 3300031824 Bacteria 7439
283 Ga0307413_10055842 3300031824 Bacteria 2405
284 Ga0307410_10000645 3300031852 Bacteria 14372
285 Ga0307410_10006401 3300031852 Bacteria 6353
286 Ga0307410_10007372 3300031852 Bacteria 6018
287 Ga0307410_10070418 3300031852 Bacteria 2423
288 Ga0307406_10000359 3300031901 Bacteria 26657
289 Ga0307406_10012203 3300031901 Bacteria 4895
290 Ga0307406_10151671 3300031901 Bacteria 1654
291 Ga0307407_10012934 3300031903 Bacteria 4031
292 Ga0307407_10020726 3300031903 Bacteria 3374
293 Ga0307412_10059763 3300031911 Bacteria 2556
294 Ga0307412_10067640 3300031911 Bacteria 2426
295 Ga0307412_10207975 3300031911 Bacteria 1491
296 Ga0307409_100000241 3300031995 Bacteria 22011
297 Ga0307409_100001043 3300031995 Bacteria 13011
298 Ga0307409_100035422 3300031995 Bacteria 3657
299 Ga0307409_100040532 3300031995 Bacteria 3469
300 Ga0307409_100041734 3300031995 Bacteria 3430
301 Ga0307409_100078462 3300031995 Bacteria 2657
302 Ga0307409_100078800 3300031995 Bacteria 2652
303 Ga0307409_100110479 3300031995 Bacteria 2304
304 Ga0307409_100150632 3300031995 Bacteria 2019
305 Ga0307409_100151305 3300031995 Bacteria 2015
306 Ga0307409_100287645 3300031995 Bacteria 1522
307 Ga0307409_100599072 3300031995 Bacteria 1089
308 Ga0307416_100000776 3300032002 Bacteria 16772
309 Ga0307416_100083322 3300032002 Bacteria 2712
310 Ga0307416_100134636 3300032002 Bacteria 2233
311 Ga0307416_100154824 3300032002 Bacteria 2108
312 Ga0307416_100516406 3300032002 Bacteria 1262
313 Ga0307416_100888235 3300032002 Bacteria 991
314 Ga0307416_100959530 3300032002 Bacteria 957
315 Ga0307414_10004139 3300032004 Bacteria 7832
316 Ga0307414_10011016 3300032004 Bacteria 5284
317 Ga0307414_10456763 3300032004 Bacteria 1122
318 Ga0307411_10008334 3300032005 Bacteria 5361
319 Ga0307411_10031205 3300032005 Bacteria 3275
320 Ga0307411_10252467 3300032005 Bacteria 1388
321 Ga0307415_100000728 3300032126 Bacteria 14755
322 Ga0307415_100019312 3300032126 Bacteria 4136
323 Ga0307415_100029261 3300032126 Bacteria 3518
324 Ga0316585_10003116 3300032137 Bacteria 4527
325 Ga0316585_10009466 3300032137 Bacteria 2844
326 Ga0316580_10003372 3300032139 Bacteria 4528
327 Ga0316580_10003712 3300032139 Bacteria 4370
328 Ga0316593_10009264 3300032168 Bacteria 2774
329 Ga0316574_0000549 3300035398 Bacteria 15524
330 Ga0316574_0006380 3300035398 Bacteria 6372
331 Ga0373931_0039381 3300035691 Bacteria 2477
332 Ga0316582_0000779 3300036647 Bacteria 12851
333 Ga0316582_0004670 3300036647 Bacteria 6957
334 Ga0316584_0015028 3300036712 Bacteria 5529
335 Ga0373925_0609984 3300037068 Bacteria 899
336 Ga0395899_0014501 3300037312 Bacteria 6016
337 Ga0395900_0079027 3300037418 Bacteria 3380
338 Ga0395900_0117332 3300037418 Bacteria 2731
339 Ga0395900_0169233 3300037418 Bacteria 2225
340 Ga0395900_0300749 3300037418 Bacteria 1591
341 Ga0395900_0325271 3300037418 Bacteria 1517
342 Ga0395900_0419699 3300037418 Bacteria 1299
343 Ga0395900_0754715 3300037418 Bacteria 903
344 Ga0395898_0140478 3300037466 Bacteria 2312
345 Ga0395898_0241060 3300037466 Bacteria 1724
346 Ga0395898_0375199 3300037466 Bacteria 1356
347 Ga0395905_0034140 3300037471 Bacteria 4776
348 Ga0395905_0093881 3300037471 Bacteria 2814
349 Ga0395905_0108491 3300037471 Bacteria 2606
350 Ga0395901_0018915 3300038443 Bacteria 7042
351 Ga0395901_0027733 3300038443 Bacteria 5822
352 Ga0395901_0200091 3300038443 Bacteria 2094
353 Ga0395901_0909266 3300038443 Bacteria 861
354 Ga0400485_22276 3300038735 Bacteria 21860
355 Ga0400488_09508 3300038741 Bacteria 1944
356 Ga0400486_20001 3300038742 Bacteria 106597
357 Ga0436365_1153546 3300039437 Bacteria 2434
358 Ga0439466_0088929 3300041411 Bacteria 969
359 Ga0451835_0652863 3300041492 Bacteria 1413
360 Ga0451837_0251532 3300041494 Bacteria 2706
361 Ga0451837_0412095 3300041494 Bacteria 4667
362 Ga0451839_0951328 3300041496 Bacteria 3233
363 Ga0451843_1395193 3300041509 Bacteria 2540
364 Ga0451843_1761125 3300041509 Bacteria 1066
365 Ga0451853_0197664 3300041512 Bacteria 5249
366 Ga0451853_1182483 3300041512 Bacteria 1199
367 Ga0451853_3166378 3300041512 Bacteria 2096
368 Ga0439431_0005845 3300041997 Bacteria 2718
369 Ga0439445_0014730 3300042004 Bacteria 1908
370 Ga0439448_0015915 3300042005 Bacteria 2284
371 Ga0439457_023294 3300042014 Bacteria 1370
372 Ga0439463_008813 3300042016 Bacteria 2482
373 Ga0439446_0026025 3300042156 Bacteria 1674
374 Ga0439434_0005938 3300042435 Bacteria 3565
375 Ga0439464_0016034 3300042439 Bacteria 2025
376 Ga0439460_0057403 3300042461 Bacteria 1181
377 Ga0466969_0076767 3300044656 Bacteria 1599
378 Ga0466972_0030057 3300044658 Bacteria 2675
379 Ga0466972_0055080 3300044658 Bacteria 1913
380 Ga0466972_0073388 3300044658 Bacteria 1631
381 Ga0466965_0001100 3300044683 Bacteria 10535
382 Ga0466965_0009959 3300044683 Bacteria 4423
383 Ga0466965_0036712 3300044683 Bacteria 2404
384 Ga0466965_0041162 3300044683 Bacteria 2276
385 Ga0466965_0048699 3300044683 Bacteria 2100
386 Ga0466965_0051632 3300044683 Bacteria 2040
387 Ga0466966_0060991 3300044684 Bacteria 2379
388 Ga0466966_0088437 3300044684 Bacteria 1925
389 Ga0466966_0095695 3300044684 Bacteria 1839
390 Ga0466966_0200383 3300044684 Bacteria 1208
391 Ga0466966_0340039 3300044684 Bacteria 902
392 Ga0466961_0060902 3300044693 Bacteria 2400
393 Ga0466961_0124038 3300044693 Bacteria 1621
394 Ga0466961_0163831 3300044693 Bacteria 1385
395 Ga0466961_0336385 3300044693 Bacteria 920
396 Ga0466963_0029911 3300044694 Bacteria 3509
397 Ga0466963_0110244 3300044694 Bacteria 1889
398 Ga0466963_0122025 3300044694 Bacteria 1794
399 Ga0466964_0014052 3300044706 Bacteria 3042
400 Ga0466964_0111170 3300044706 Bacteria 1222
401 Ga0466971_0043653 3300044719 Bacteria 2014
402 Ga0466971_0050259 3300044719 Bacteria 1876
403 Ga0466971_0059250 3300044719 Bacteria 1729
404 Ga0466971_0071171 3300044719 Bacteria 1580
405 Ga0466970_0032404 3300044765 Bacteria 2761
406 Ga0466970_0050536 3300044765 Bacteria 2217
407 Ga0466970_0071539 3300044765 Bacteria 1866
408 Ga0466970_0086758 3300044765 Bacteria 1696
409 Ga0466970_0115917 3300044765 Bacteria 1465
410 Ga0466970_0164061 3300044765 Bacteria 1229
411 Ga0466957_0062646 3300044842 Bacteria 2285
412 Ga0466957_0258150 3300044842 Bacteria 1160
413 Ga0466957_0457894 3300044842 Bacteria 880
414 Ga0466960_0001507 3300044901 Bacteria 8479
415 Ga0466960_0002211 3300044901 Bacteria 7261
416 Ga0466960_0012753 3300044901 Bacteria 3555
417 Ga0466960_0026422 3300044901 Bacteria 2637
418 Ga0466960_0034970 3300044901 Bacteria 2344
419 Ga0466960_0047606 3300044901 Bacteria 2057
420 Ga0466960_0083334 3300044901 Bacteria 1616
421 Ga0466960_0114095 3300044901 Bacteria 1407
422 Ga0466960_0197611 3300044901 Bacteria 1097
423 Ga0466960_0376094 3300044901 Bacteria 814
424 Ga0466959_0043735 3300045049 Bacteria 3300
425 Ga0466959_0222881 3300045049 Bacteria 1307
426 Ga0466959_0485068 3300045049 Bacteria 836
427 Ga0451576_0018962 3300045051 Bacteria 7516
428 Ga0466958_0054616 3300045836 Bacteria 2422
429 Ga0466958_0073838 3300045836 Bacteria 2089
430 Ga0466958_0187231 3300045836 Bacteria 1315
431 Ga0466967_0008910 3300045976 Bacteria 7404
432 Ga0466967_0018579 3300045976 Bacteria 5561
433 Ga0466967_0037567 3300045976 Bacteria 4145
434 Ga0466967_0090190 3300045976 Bacteria 2784
435 Ga0466967_0163412 3300045976 Bacteria 2091
436 Ga0466967_0231488 3300045976 Bacteria 1759
437 Ga0466967_0250665 3300045976 Bacteria 1691
438 Ga0466967_0595940 3300045976 Bacteria 1090
439 Ga0466967_0828343 3300045976 Bacteria 919
440 Ga0495627_017388 3300046453 Bacteria 2444
441 Ga0495592_0179842 3300046454 Bacteria 1441
442 Ga0495590_0041831 3300046457 Bacteria 1598
443 Ga0495641_0062082 3300046461 Bacteria 1686
444 Ga0495651_0221009 3300046462 Bacteria 1311
445 Ga0495653_0003372 3300046463 Bacteria 12843
446 Ga0495620_0034517 3300046515 Bacteria 2284
447 Ga0495632_0124754 3300046519 Bacteria 1201
448 Ga0495665_0213138 3300046531 Bacteria 1000
449 Ga0495586_0314972 3300046535 Bacteria 897
450 Ga0495656_0092515 3300046615 Bacteria 1385
451 Ga0495668_0075966 3300046616 Bacteria 1845
452 Ga0495674_0359852 3300047319 Bacteria 1180
453 Ga0495676_0443342 3300047321 Bacteria 857
454 Ga0496100_0000374 3300048903 Bacteria 21787
455 Ga0496100_0041446 3300048903 Bacteria 2935
456 Ga0496100_0103656 3300048903 Bacteria 1964
457 Ga0496100_0397986 3300048903 Bacteria 1048
458 Ga0496101_0066073 3300048904 Bacteria 2637
459 Ga0496101_0079801 3300048904 Bacteria 2416
460 Ga0496101_0169126 3300048904 Bacteria 1679
461 Ga0496102_0006762 3300048905 Bacteria 9792
462 Ga0496102_0008565 3300048905 Bacteria 8772
463 Ga0496102_0009142 3300048905 Bacteria 8499
464 Ga0496102_0035726 3300048905 Bacteria 4475
465 Ga0496102_0229456 3300048905 Bacteria 1750
466 Ga0496102_0254003 3300048905 Bacteria 1657
467 Ga0496102_0512265 3300048905 Bacteria 1122
468 Ga0496103_0025323 3300048906 Bacteria 3585
469 Ga0496103_0034012 3300048906 Bacteria 3116
470 Ga0496103_0060371 3300048906 Bacteria 2357
471 Ga0496103_0087483 3300048906 Bacteria 1964
472 Ga0496103_0340291 3300048906 Bacteria 965
473 Ga0496104_0001885 3300048907 Bacteria 18176
474 Ga0496104_0025182 3300048907 Bacteria 5483
475 Ga0496104_0094935 3300048907 Bacteria 2853
476 Ga0496104_0137073 3300048907 Bacteria 2351
477 Ga0496104_0548376 3300048907 Bacteria 1067
478 Ga0496104_0609769 3300048907 Bacteria 1001
479 Ga0496105_0000343 3300048908 Bacteria 30543
480 Ga0496105_0004871 3300048908 Bacteria 10137
481 Ga0496105_0034203 3300048908 Bacteria 4179
482 Ga0496105_0049207 3300048908 Bacteria 3479
483 Ga0496105_0200332 3300048908 Bacteria 1629
484 Ga0496106_0006613 3300048909 Bacteria 8578
485 Ga0496106_0178993 3300048909 Bacteria 1683
486 Ga0496106_0349852 3300048909 Bacteria 1187
487 Ga0496106_0361401 3300048909 Bacteria 1166
488 Ga0496107_0048983 3300048910 Bacteria 3044
489 Ga0496107_0327624 3300048910 Bacteria 1140
490 Ga0496107_0643730 3300048910 Bacteria 782
491 Ga0496108_0025707 3300048911 Bacteria 4854
492 Ga0496108_0079113 3300048911 Bacteria 2783
493 Ga0496108_0113661 3300048911 Bacteria 2317
494 Ga0496108_0171337 3300048911 Bacteria 1878
495 Ga0496108_0207548 3300048911 Bacteria 1700
496 Ga0496109_0014363 3300048912 Bacteria 6891
497 Ga0496109_0015105 3300048912 Bacteria 6721
498 Ga0496109_0063347 3300048912 Bacteria 3382
499 Ga0496109_0109916 3300048912 Bacteria 2563
500 Ga0496109_0141538 3300048912 Bacteria 2249
501 Ga0496110_0006701 3300048913 Bacteria 9157
502 Ga0496110_0016549 3300048913 Bacteria 6158
503 Ga0496110_0024390 3300048913 Bacteria 5155
504 Ga0496110_0026885 3300048913 Bacteria 4928
505 Ga0496110_0041099 3300048913 Bacteria 4033
506 Ga0496110_0158543 3300048913 Bacteria 2051
507 Ga0496110_0203886 3300048913 Bacteria 1797
508 Ga0496110_0205461 3300048913 Bacteria 1790
509 Ga0496110_0250735 3300048913 Bacteria 1611
510 Ga0496110_0302443 3300048913 Bacteria 1457
511 Ga0496110_0360402 3300048913 Bacteria 1325
512 Ga0496111_0044439 3300048914 Bacteria 3193
513 Ga0496111_0097649 3300048914 Bacteria 2156
514 Ga0496111_0113004 3300048914 Bacteria 2001
515 Ga0496111_0149059 3300048914 Bacteria 1735
516 Ga0496112_0256413 3300048915 Bacteria 1699
517 Ga0496113_0165252 3300048916 Bacteria 1751
518 Ga0496113_0174745 3300048916 Bacteria 1702
519 Ga0496113_0200997 3300048916 Bacteria 1584
520 Ga0496113_0359310 3300048916 Bacteria 1168
521 Ga0496114_0001386 3300048917 Bacteria 18369
522 Ga0496114_0004950 3300048917 Bacteria 10386
523 Ga0496114_0006813 3300048917 Bacteria 8998
524 Ga0496114_0015556 3300048917 Bacteria 6116
525 Ga0496114_0023486 3300048917 Bacteria 5032
526 Ga0496114_0038855 3300048917 Bacteria 3938
527 Ga0496114_0186050 3300048917 Bacteria 1815
528 Ga0496114_0274934 3300048917 Bacteria 1484
529 Ga0496114_0290830 3300048917 Bacteria 1441
530 Ga0496114_0525529 3300048917 Bacteria 1046
531 Ga0496114_0776492 3300048917 Bacteria 836
532 Ga0496115_0008918 3300048918 Bacteria 7437
533 Ga0496124_0065792 3300048927 Bacteria 3021
534 Ga0496126_0139088 3300048929 Bacteria 2092
535 Ga0501291_010049 3300049514 Bacteria 1340
536 Ga0501031_0001919 3300049568 Bacteria 13105
537 Ga0501031_0013782 3300049568 Bacteria 5269
538 Ga0501031_0090194 3300049568 Bacteria 1999
539 Ga0501031_0090304 3300049568 Bacteria 1998
540 Ga0501031_0117188 3300049568 Bacteria 1740
541 Ga0501031_0121470 3300049568 Bacteria 1707
542 Ga0501031_0312387 3300049568 Bacteria 1018
543 Ga0501032_0014184 3300049569 Bacteria 5645
544 Ga0501032_0057252 3300049569 Bacteria 2619
545 Ga0501032_0085286 3300049569 Bacteria 2100
546 Ga0501032_0130275 3300049569 Bacteria 1660
547 Ga0501032_0133184 3300049569 Bacteria 1639
548 Ga0501033_0002769 3300049570 Bacteria 14705
549 Ga0501033_0004714 3300049570 Bacteria 10913
550 Ga0501033_0151606 3300049570 Bacteria 1672
551 Ga0501034_0005406 3300049571 Bacteria 13967
552 Ga0501034_0011552 3300049571 Bacteria 9147
553 Ga0501034_0016438 3300049571 Bacteria 7594
554 Ga0501034_0041505 3300049571 Bacteria 4655
555 Ga0501034_0266027 3300049571 Bacteria 1656
556 Ga0501034_0742066 3300049571 Bacteria 878
557 Ga0501036_0002680 3300049572 Bacteria 14045
558 Ga0501036_0009496 3300049572 Bacteria 8003
559 Ga0501036_0032559 3300049572 Bacteria 4405
560 Ga0501036_0224731 3300049572 Bacteria 1576
561 Ga0501036_0235492 3300049572 Bacteria 1536
562 Ga0501036_0267558 3300049572 Bacteria 1431
563 Ga0501037_0018718 3300049573 Bacteria 5103
564 Ga0501037_0028809 3300049573 Bacteria 4103
565 Ga0501037_0088589 3300049573 Bacteria 2240
566 Ga0501038_0000969 3300049574 Bacteria 25734
567 Ga0501038_0003720 3300049574 Bacteria 14211
568 Ga0501038_0009754 3300049574 Bacteria 8803
569 Ga0501038_0012946 3300049574 Bacteria 7610
570 Ga0501038_0017662 3300049574 Bacteria 6448
571 Ga0501038_0302739 3300049574 Bacteria 1254
572 Ga0501039_0025011 3300049575 Bacteria 4585
573 Ga0501039_0146212 3300049575 Bacteria 1857
574 Ga0501039_0277384 3300049575 Bacteria 1318
575 Ga0501040_0004774 3300049576 Bacteria 8792
576 Ga0501041_0001143 3300049577 Bacteria 14519
577 Ga0501041_0074115 3300049577 Bacteria 2091
578 Ga0501041_0139130 3300049577 Bacteria 1514
579 Ga0501041_0178575 3300049577 Bacteria 1329
580 Ga0501042_0014278 3300049578 Bacteria 5420
581 Ga0501042_0020536 3300049578 Bacteria 4598
582 Ga0501042_0039243 3300049578 Bacteria 3364
583 Ga0501042_0080019 3300049578 Bacteria 2341
584 Ga0501042_0087679 3300049578 Bacteria 2233
585 Ga0501042_0106122 3300049578 Bacteria 2022
586 Ga0501042_0357083 3300049578 Bacteria 1057
587 Ga0501042_0418483 3300049578 Bacteria 971
588 Ga0501043_0016176 3300049579 Bacteria 5851
589 Ga0501043_0019591 3300049579 Bacteria 5310
590 Ga0501043_0053189 3300049579 Bacteria 3180
591 Ga0501043_0181884 3300049579 Bacteria 1638
592 Ga0501043_0281171 3300049579 Bacteria 1275
593 Ga0501046_0010494 3300049580 Bacteria 7950
594 Ga0501046_0021536 3300049580 Bacteria 5320
595 Ga0501046_0033243 3300049580 Bacteria 4169
596 Ga0501046_0058374 3300049580 Bacteria 3025
597 Ga0501046_0123814 3300049580 Bacteria 1966
598 Ga0501047_0030123 3300049581 Bacteria 5232
599 Ga0501048_0002219 3300049582 Bacteria 14794
600 Ga0501048_0003081 3300049582 Bacteria 12710
601 Ga0501048_0213315 3300049582 Bacteria 1369
602 Ga0501067_0001723 3300049583 Bacteria 12008
603 Ga0501067_0019013 3300049583 Bacteria 3801
604 Ga0501067_0038711 3300049583 Bacteria 2648
605 Ga0501067_0070136 3300049583 Bacteria 1941
606 Ga0501067_0358800 3300049583 Bacteria 813
607 Ga0501068_0005888 3300049584 Bacteria 6729
608 Ga0501068_0013176 3300049584 Bacteria 4702
609 Ga0501068_0058694 3300049584 Bacteria 2335
610 Ga0501068_0094978 3300049584 Bacteria 1843
611 Ga0501068_0245460 3300049584 Bacteria 1140
612 Ga0501069_0047720 3300049585 Bacteria 2377
613 Ga0501069_0069790 3300049585 Bacteria 1968
614 Ga0501069_0074031 3300049585 Bacteria 1910
615 Ga0501069_0082734 3300049585 Bacteria 1809
616 Ga0501070_0004831 3300049586 Bacteria 11513
617 Ga0501070_0007702 3300049586 Bacteria 9129
618 Ga0501070_0036195 3300049586 Bacteria 4122
619 Ga0501070_0211951 3300049586 Bacteria 1590
620 Ga0501070_0342901 3300049586 Bacteria 1213
621 Ga0501071_0003185 3300049587 Bacteria 10210
622 Ga0501071_0034794 3300049587 Bacteria 3587
623 Ga0501071_0133606 3300049587 Bacteria 1845
624 Ga0501071_0213437 3300049587 Bacteria 1451
625 Ga0501071_0240098 3300049587 Bacteria 1366
626 Ga0501072_0016523 3300049588 Bacteria 5669
627 Ga0501072_0035425 3300049588 Bacteria 3909
628 Ga0501072_0070239 3300049588 Bacteria 2765
629 Ga0501072_0082451 3300049588 Bacteria 2549
630 Ga0501072_0103443 3300049588 Bacteria 2263
631 Ga0501073_0011619 3300049589 Bacteria 6433
632 Ga0501073_0030168 3300049589 Bacteria 3872
633 Ga0501074_0002308 3300049590 Bacteria 13278
634 Ga0501074_0003143 3300049590 Bacteria 11647
635 Ga0501074_0026963 3300049590 Bacteria 4164
636 Ga0501074_0037999 3300049590 Bacteria 3489
637 Ga0501074_0118053 3300049590 Bacteria 1898
638 Ga0501074_0146696 3300049590 Bacteria 1687
639 Ga0501074_0383359 3300049590 Bacteria 997
640 Ga0501075_0074446 3300049591 Bacteria 2568
641 Ga0501075_0085897 3300049591 Bacteria 2384
642 Ga0501075_0124932 3300049591 Bacteria 1959
643 Ga0501075_0131643 3300049591 Bacteria 1906
644 Ga0501076_0003800 3300049592 Bacteria 10634
645 Ga0501076_0160942 3300049592 Bacteria 1828
646 Ga0501076_0321768 3300049592 Bacteria 1268
647 Ga0501076_0600094 3300049592 Bacteria 908
648 Ga0501077_0015410 3300049593 Bacteria 4813
649 Ga0501077_0023095 3300049593 Bacteria 3944
650 Ga0501077_0028507 3300049593 Bacteria 3548
651 Ga0501208_007016 3300049655 Bacteria 1462
652 Ga0501250_011169 3300049680 Bacteria 1043
653 Ga0501221_014152 3300049704 Bacteria 1479
654 Ga0501079_0001954 3300049741 Bacteria 14764
655 Ga0501079_0293633 3300049741 Bacteria 1271
656 Ga0501080_0001505 3300049742 Bacteria 19670
657 Ga0501080_0012257 3300049742 Bacteria 7854
658 Ga0501080_0036089 3300049742 Bacteria 4615
659 Ga0501080_0126596 3300049742 Bacteria 2366
660 Ga0501080_0266439 3300049742 Bacteria 1560
661 Ga0501081_0003820 3300049743 Bacteria 9645
662 Ga0501083_0036467 3300049744 Bacteria 3354
663 Ga0501035_0004064 3300049822 Bacteria 13923
664 Ga0501035_0018071 3300049822 Bacteria 6498
665 Ga0501035_0075878 3300049822 Bacteria 2973
666 Ga0501035_0103743 3300049822 Bacteria 2494
667 Ga0501035_0204511 3300049822 Bacteria 1692
668 Ga0501035_0334480 3300049822 Bacteria 1270
669 Ga0501044_0023962 3300049823 Bacteria 6486
670 Ga0501044_0042299 3300049823 Bacteria 4739
671 Ga0501044_0149052 3300049823 Bacteria 2322
672 Ga0501044_0368688 3300049823 Bacteria 1353
673 Ga0501044_0556480 3300049823 Bacteria 1044
674 Ga0501045_0003370 3300049824 Bacteria 10934
675 Ga0501045_0059854 3300049824 Bacteria 2791
676 Ga0501045_0209767 3300049824 Bacteria 1451
677 Ga0501045_0291358 3300049824 Bacteria 1215
678 nmdc:mga03683_35229_c1 3300050489 Bacteria 2029
679 nmdc:mga03683_7844_c1 3300050489 Bacteria 3726
680 nmdc:mga00v17_147224_c1 3300050491 Bacteria 1512
681 nmdc:mga00v17_17269_c1 3300050491 Bacteria 4081
682 nmdc:mga00v17_71838_c1 3300050491 Bacteria 2146
683 nmdc:mga00v17_88442_c1 3300050491 Bacteria 1545
684 nmdc:mga0yw44_20302_c1 3300050492 Bacteria 3685
685 nmdc:mga0yw44_55591_c1 3300050492 Bacteria 2409
686 nmdc:mga0yw44_612_c1 3300050492 Bacteria 12911
687 nmdc:mga0yw44_90408_c1 3300050492 Bacteria 1934
688 nmdc:mga0yw44_99668_c2 3300050492 Bacteria 1657
689 nmdc:mga06z11_2335_c1 3300050494 Bacteria 7226
690 nmdc:mga06z11_30411_c1 3300050494 Bacteria 2613
691 nmdc:mga06z11_907_c1 3300050494 Bacteria 10772
692 nmdc:mga04h51_2109_c1 3300050495 Bacteria 4668
693 nmdc:mga07m45_21596_c1 3300050496 Bacteria 3507
694 nmdc:mga07m45_366096_c1 3300050496 Bacteria 837
695 nmdc:mga07m45_76171_c1 3300050496 Bacteria 1913
696 nmdc:mga05p37_162_c1 3300050507 Bacteria 64436
697 nmdc:mga05p37_37668_c1 3300050507 Bacteria 5931
698 nmdc:mga09592_165_c1 3300050508 Bacteria 46519
699 nmdc:mga09592_18650_c1 3300050508 Bacteria 5691
700 nmdc:mga09592_230836_c1 3300050508 Bacteria 1603
701 nmdc:mga0qj67_17645_c1 3300050509 Bacteria 5429
702 nmdc:mga0qj67_256480_c1 3300050509 Bacteria 1419
703 nmdc:mga0qj67_6234_c1 3300050509 Bacteria 8757
704 nmdc:mga06r32_265_c1 3300050510 Bacteria 43312
705 nmdc:mga06r32_286911_c1 3300050510 Bacteria 1633
706 nmdc:mga06r32_656_c1 3300050510 Bacteria 30201
707 nmdc:mga08y16_164887_c1 3300050511 Bacteria 2302
708 nmdc:mga08y16_3562_c1 3300050511 Bacteria 16167
709 nmdc:mga08y16_389169_c1 3300050511 Bacteria 1428
710 nmdc:mga08y16_4203_c1 3300050511 Bacteria 15028
711 nmdc:mga0n895_217_c1 3300050512 Bacteria 36183
712 nmdc:mga0rr50_26718_c1 3300050513 Bacteria 4033
713 nmdc:mga0rr50_30846_c1 3300050513 Bacteria 3801
714 nmdc:mga0a205_1731_c1 3300050515 Bacteria 18865
715 nmdc:mga0a205_21032_c1 3300050515 Bacteria 6168
716 Ga0495601_0050241 3300053077 Bacteria 2630
717 Ga0495655_0113422 3300053083 Bacteria 817
718 Ga0495619_0357553 3300053085 Bacteria 1010
719 Ga0500644_0000047 3300053088 Bacteria 73844
720 Ga0500644_0141923 3300053088 Bacteria 955
721 Ga0500556_0000917 3300053104 Bacteria 16230
722 Ga0500593_000244 3300053117 Bacteria 22282
723 Ga0501084_0007477 3300054114 Bacteria 9006
724 Ga0501084_0056702 3300054114 Bacteria 3278
725 Ga0501084_0066555 3300054114 Bacteria 3014
726 Ga0501084_0151419 3300054114 Bacteria 1955
727 Ga0501084_0154364 3300054114 Bacteria 1936
728 Ga0501084_0255962 3300054114 Bacteria 1478
729 Ga0590075_010047 3300059424 Bacteria 2274
730 Ga0501082_0006014 3300060353 Bacteria 10523
731 Ga0501082_0013150 3300060353 Bacteria 7116
732 Ga0501082_0049469 3300060353 Bacteria 3625
733 Ga0501082_0058657 3300060353 Bacteria 3316
734 Ga0501082_0087906 3300060353 Bacteria 2682
735 Ga0466962_0023396 3300061719 Bacteria 2970
736 Ga0466962_0081188 3300061719 Bacteria 1551
737 Ga0466962_0275819 3300061719 Bacteria 829
738 Ga0530510_0002431 3300061734 Bacteria 12832
739 Ga0530510_0117871 3300061734 Bacteria 1948
740 Ga0530510_0418711 3300061734 Bacteria 1011
741 Ga0530510_0683569 3300061734 Bacteria 782

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10000677 Ga0075365_1000067712 233
2 3300006042 Ga0075368_10010386 Ga0075368_100103862 233
3 3300006048 Ga0075363_100030888 Ga0075363_1000308882 233
4 3300006051 Ga0075364_10052499 Ga0075364_100524993 233
5 3300006177 Ga0075362_10001939 Ga0075362_100019394 233
6 3300006353 Ga0075370_10020511 Ga0075370_100205114 233
7 3300027866 Ga0209813_10002911 Ga0209813_100029114 233
8 3300050489 nmdc:mga03683_7844_c1 nmdc:mga03683_7844_c1_1337_2107 233
9 3300050494 nmdc:mga06z11_907_c1 nmdc:mga06z11_907_c1_9219_9989 233
10 3300050495 nmdc:mga04h51_2109_c1 nmdc:mga04h51_2109_c1_2913_3683 233
11 3300050496 nmdc:mga07m45_76171_c1 nmdc:mga07m45_76171_c1_965_1735 233
12 3300006881 Ga0068865_100184051 Ga0068865_1001840512 234
13 3300037418 Ga0395900_0117332 Ga0395900_0117332_67_867 235
14 3300037418 Ga0395900_0754715 Ga0395900_0754715_19_816 235
15 3300048910 Ga0496107_0327624 Ga0496107_0327624_405_1112 235
16 3300050489 nmdc:mga03683_35229_c1 nmdc:mga03683_35229_c1_194_964 237
17 3300009553 Ga0105249_10995299 Ga0105249_109952991 238
18 3300053117 Ga0500593_000244 Ga0500593_000244_20715_21512 240
19 3300053104 Ga0500556_0000917 Ga0500556_0000917_14494_15306 244
20 3300005981 Ga0081538_10000092 Ga0081538_100000928 245
21 3300037471 Ga0395905_0108491 Ga0395905_0108491_93_887 245
22 3300044684 Ga0466966_0340039 Ga0466966_0340039_42_785 245
23 3300046454 Ga0495592_0179842 Ga0495592_0179842_694_1431 245
24 3300025918 Ga0207662_10160643 Ga0207662_101606432 247
25 3300025940 Ga0207691_10413407 Ga0207691_104134072 247
26 3300044683 Ga0466965_0048699 Ga0466965_0048699_1142_1939 247
27 3300037466 Ga0395898_0375199 Ga0395898_0375199_428_1228 248
28 3300038443 Ga0395901_0200091 Ga0395901_0200091_414_1214 248
29 3300005456 Ga0070678_100290557 Ga0070678_1002905572 249
30 3300026121 Ga0207683_10331275 Ga0207683_103312752 249
31 3300037068 Ga0373925_0609984 Ga0373925_0609984_11_763 250
32 3300041512 Ga0451853_1182483 Ga0451853_1182483_337_1146 250
33 3300048910 Ga0496107_0643730 Ga0496107_0643730_13_765 250
34 3300049568 Ga0501031_0312387 Ga0501031_0312387_16_768 250
35 3300049578 Ga0501042_0418483 Ga0501042_0418483_14_769 250
36 3300049823 Ga0501044_0556480 Ga0501044_0556480_281_1033 250
37 3300053083 Ga0495655_0113422 Ga0495655_0113422_15_767 250
38 3300061734 Ga0530510_0683569 Ga0530510_0683569_14_766 250
39 3300013308 Ga0157375_10109681 Ga0157375_101096813 251
40 3300017792 Ga0163161_10141764 Ga0163161_101417642 252
41 3300031665 Ga0316575_10038672 Ga0316575_100386722 252
42 3300031691 Ga0316579_10005298 Ga0316579_100052984 252
43 3300031728 Ga0316578_10157706 Ga0316578_101577062 252
44 3300031733 Ga0316577_10011722 Ga0316577_100117222 252
45 3300032137 Ga0316585_10003116 Ga0316585_100031164 252
46 3300032139 Ga0316580_10003372 Ga0316580_100033724 252
47 3300035398 Ga0316574_0006380 Ga0316574_0006380_924_1718 252
48 3300036647 Ga0316582_0000779 Ga0316582_0000779_7372_8166 252
49 3300049583 Ga0501067_0070136 Ga0501067_0070136_571_1335 254
50 3300041509 Ga0451843_1395193 Ga0451843_1395193_1071_1883 255
51 3300049591 Ga0501075_0124932 Ga0501075_0124932_46_813 255
52 iso_pu_bacteria 2622736605 2623499935 255
53 iso_pu_bacteria 2808606394 2809028817 255
54 3300005937 Ga0081455_10035251 Ga0081455_100352511 256
55 3300006038 Ga0075365_10134122 Ga0075365_101341222 256
56 3300006881 Ga0068865_100030955 Ga0068865_1000309553 256
57 3300007076 Ga0075435_100025910 Ga0075435_1000259103 256
58 3300009094 Ga0111539_10708063 Ga0111539_107080632 256
59 3300009147 Ga0114129_10322865 Ga0114129_103228654 256
60 3300011119 Ga0105246_10416826 Ga0105246_104168261 256
61 3300013307 Ga0157372_10278953 Ga0157372_102789533 256
62 3300013307 Ga0157372_10357501 Ga0157372_103575012 256
63 3300014326 Ga0157380_10152224 Ga0157380_101522243 256
64 3300025901 Ga0207688_10029422 Ga0207688_100294222 256
65 3300025938 Ga0207704_10019073 Ga0207704_100190733 256
66 3300026041 Ga0207639_10131561 Ga0207639_101315614 256
67 3300031548 Ga0307408_100135038 Ga0307408_1001350382 256
68 3300031995 Ga0307409_100287645 Ga0307409_1002876452 256
69 3300032004 Ga0307414_10011016 Ga0307414_100110165 256
70 3300032005 Ga0307411_10008334 Ga0307411_100083346 256
71 3300035691 Ga0373931_0039381 Ga0373931_0039381_856_1626 256
72 3300037418 Ga0395900_0300749 Ga0395900_0300749_22_795 256
73 3300037418 Ga0395900_0325271 Ga0395900_0325271_506_1276 256
74 3300037418 Ga0395900_0419699 Ga0395900_0419699_97_867 256
75 3300037466 Ga0395898_0241060 Ga0395898_0241060_22_792 256
76 3300038443 Ga0395901_0909266 Ga0395901_0909266_77_850 256
77 3300038735 Ga0400485_22276 Ga0400485_22276_6179_6949 256
78 3300038741 Ga0400488_09508 Ga0400488_09508_617_1387 256
79 3300038742 Ga0400486_20001 Ga0400486_20001_17100_17870 256
80 3300041411 Ga0439466_0088929 Ga0439466_0088929_41_814 256
81 3300041494 Ga0451837_0412095 Ga0451837_0412095_2444_3214 256
82 3300041496 Ga0451839_0951328 Ga0451839_0951328_264_1034 256
83 3300041997 Ga0439431_0005845 Ga0439431_0005845_933_1703 256
84 3300042005 Ga0439448_0015915 Ga0439448_0015915_610_1380 256
85 3300042461 Ga0439460_0057403 Ga0439460_0057403_344_1114 256
86 3300044683 Ga0466965_0051632 Ga0466965_0051632_626_1396 256
87 3300044684 Ga0466966_0088437 Ga0466966_0088437_696_1469 256
88 3300044684 Ga0466966_0095695 Ga0466966_0095695_486_1256 256
89 3300044693 Ga0466961_0060902 Ga0466961_0060902_1612_2382 256
90 3300044693 Ga0466961_0163831 Ga0466961_0163831_557_1330 256
91 3300044693 Ga0466961_0336385 Ga0466961_0336385_121_891 256
92 3300044694 Ga0466963_0110244 Ga0466963_0110244_820_1590 256
93 3300044706 Ga0466964_0014052 Ga0466964_0014052_1334_2104 256
94 3300044719 Ga0466971_0071171 Ga0466971_0071171_325_1095 256
95 3300044765 Ga0466970_0032404 Ga0466970_0032404_405_1178 256
96 3300044765 Ga0466970_0086758 Ga0466970_0086758_577_1347 256
97 3300044765 Ga0466970_0164061 Ga0466970_0164061_422_1192 256
98 3300044842 Ga0466957_0258150 Ga0466957_0258150_333_1103 256
99 3300044901 Ga0466960_0001507 Ga0466960_0001507_6506_7276 256
100 3300044901 Ga0466960_0034970 Ga0466960_0034970_935_1705 256
101 3300045836 Ga0466958_0187231 Ga0466958_0187231_54_824 256
102 3300045976 Ga0466967_0037567 Ga0466967_0037567_861_1631 256
103 3300045976 Ga0466967_0163412 Ga0466967_0163412_535_1308 256
104 3300045976 Ga0466967_0231488 Ga0466967_0231488_456_1226 256
105 3300046453 Ga0495627_017388 Ga0495627_017388_710_1480 256
106 3300046461 Ga0495641_0062082 Ga0495641_0062082_140_910 256
107 3300046531 Ga0495665_0213138 Ga0495665_0213138_129_899 256
108 3300048903 Ga0496100_0000374 Ga0496100_0000374_34_807 256
109 3300048903 Ga0496100_0041446 Ga0496100_0041446_1231_2004 256
110 3300048904 Ga0496101_0169126 Ga0496101_0169126_296_1069 256
111 3300048905 Ga0496102_0009142 Ga0496102_0009142_3069_3842 256
112 3300048906 Ga0496103_0025323 Ga0496103_0025323_1525_2298 256
113 3300048907 Ga0496104_0137073 Ga0496104_0137073_1085_1858 256
114 3300048908 Ga0496105_0034203 Ga0496105_0034203_29_802 256
115 3300048909 Ga0496106_0361401 Ga0496106_0361401_176_949 256
116 3300048911 Ga0496108_0079113 Ga0496108_0079113_1510_2283 256
117 3300048911 Ga0496108_0171337 Ga0496108_0171337_724_1494 256
118 3300048913 Ga0496110_0041099 Ga0496110_0041099_2543_3316 256
119 3300048913 Ga0496110_0250735 Ga0496110_0250735_92_862 256
120 3300048914 Ga0496111_0044439 Ga0496111_0044439_1371_2144 256
121 3300048916 Ga0496113_0174745 Ga0496113_0174745_501_1274 256
122 3300048917 Ga0496114_0023486 Ga0496114_0023486_359_1132 256
123 3300048917 Ga0496114_0186050 Ga0496114_0186050_1026_1799 256
124 3300048917 Ga0496114_0776492 Ga0496114_0776492_12_782 256
125 3300048929 Ga0496126_0139088 Ga0496126_0139088_1268_2041 256
126 3300049568 Ga0501031_0117188 Ga0501031_0117188_935_1708 256
127 3300049568 Ga0501031_0121470 Ga0501031_0121470_778_1548 256
128 3300049569 Ga0501032_0014184 Ga0501032_0014184_50_823 256
129 3300049570 Ga0501033_0002769 Ga0501033_0002769_25_798 256
130 3300049571 Ga0501034_0011552 Ga0501034_0011552_5693_6466 256
131 3300049571 Ga0501034_0742066 Ga0501034_0742066_23_793 256
132 3300049572 Ga0501036_0224731 Ga0501036_0224731_666_1436 256
133 3300049572 Ga0501036_0267558 Ga0501036_0267558_18_788 256
134 3300049574 Ga0501038_0003720 Ga0501038_0003720_5390_6163 256
135 3300049575 Ga0501039_0146212 Ga0501039_0146212_576_1346 256
136 3300049578 Ga0501042_0357083 Ga0501042_0357083_21_791 256
137 3300049579 Ga0501043_0053189 Ga0501043_0053189_1577_2350 256
138 3300049580 Ga0501046_0033243 Ga0501046_0033243_28_801 256
139 3300049582 Ga0501048_0213315 Ga0501048_0213315_428_1198 256
140 3300049583 Ga0501067_0358800 Ga0501067_0358800_28_798 256
141 3300049584 Ga0501068_0013176 Ga0501068_0013176_55_825 256
142 3300049584 Ga0501068_0245460 Ga0501068_0245460_317_1087 256
143 3300049585 Ga0501069_0074031 Ga0501069_0074031_635_1405 256
144 3300049586 Ga0501070_0342901 Ga0501070_0342901_368_1138 256
145 3300049590 Ga0501074_0118053 Ga0501074_0118053_512_1282 256
146 3300049592 Ga0501076_0600094 Ga0501076_0600094_47_817 256
147 3300049742 Ga0501080_0266439 Ga0501080_0266439_714_1484 256
148 3300049822 Ga0501035_0204511 Ga0501035_0204511_903_1673 256
149 3300049823 Ga0501044_0042299 Ga0501044_0042299_2603_3376 256
150 3300049824 Ga0501045_0209767 Ga0501045_0209767_182_952 256
151 3300050491 nmdc:mga00v17_147224_c1 nmdc:mga00v17_147224_c1_185_955 256
152 3300050491 nmdc:mga00v17_71838_c1 nmdc:mga00v17_71838_c1_519_1289 256
153 3300050492 nmdc:mga0yw44_55591_c1 nmdc:mga0yw44_55591_c1_1033_1803 256
154 3300050492 nmdc:mga0yw44_90408_c1 nmdc:mga0yw44_90408_c1_984_1754 256
155 3300050509 nmdc:mga0qj67_17645_c1 nmdc:mga0qj67_17645_c1_3282_4052 256
156 3300050510 nmdc:mga06r32_286911_c1 nmdc:mga06r32_286911_c1_102_872 256
157 3300050511 nmdc:mga08y16_389169_c1 nmdc:mga08y16_389169_c1_439_1209 256
158 3300053088 Ga0500644_0000047 Ga0500644_0000047_66150_66920 256
159 3300054114 Ga0501084_0154364 Ga0501084_0154364_566_1336 256
160 3300060353 Ga0501082_0013150 Ga0501082_0013150_13_786 256
161 3300061719 Ga0466962_0275819 Ga0466962_0275819_18_788 256
162 3300061734 Ga0530510_0418711 Ga0530510_0418711_158_931 256
163 3300044765 Ga0466970_0071539 Ga0466970_0071539_188_1027 257
164 3300006042 Ga0075368_10000261 Ga0075368_1000026113 258
165 3300006048 Ga0075363_100003243 Ga0075363_1000032435 258
166 3300006178 Ga0075367_10021645 Ga0075367_100216454 258
167 3300027866 Ga0209813_10007472 Ga0209813_100074722 258
168 3300045049 Ga0466959_0222881 Ga0466959_0222881_211_1020 258
169 3300049578 Ga0501042_0106122 Ga0501042_0106122_359_1198 258
170 3300049580 Ga0501046_0123814 Ga0501046_0123814_1037_1876 258
171 3300049591 Ga0501075_0085897 Ga0501075_0085897_1296_2135 258
172 3300050494 nmdc:mga06z11_2335_c1 nmdc:mga06z11_2335_c1_3151_3945 258
173 3300054114 Ga0501084_0255962 Ga0501084_0255962_110_949 258
174 iso_pu_bacteria 2643221697 2644537693 258
175 3300044901 Ga0466960_0083334 Ga0466960_0083334_238_1050 259
176 iso_pu_bacteria 2643221561 2643826011 259
177 iso_pu_bacteria 2643221696 2644531999 259
178 iso_pu_bacteria 2835188231 2835189984 259
179 iso_pu_bacteria 2857481737 2857482186 259
180 3300005983 Ga0081540_1029003 Ga0081540_10290032 260
181 3300013105 Ga0157369_10027443 Ga0157369_100274433 260
182 3300014326 Ga0157380_10027767 Ga0157380_100277675 260
183 3300017792 Ga0163161_10271923 Ga0163161_102719232 260
184 3300031665 Ga0316575_10000376 Ga0316575_1000037610 260
185 3300031691 Ga0316579_10000355 Ga0316579_1000035512 260
186 3300031727 Ga0316576_10001640 Ga0316576_1000164011 260
187 3300031728 Ga0316578_10001217 Ga0316578_1000121710 260
188 3300031733 Ga0316577_10090677 Ga0316577_100906772 260
189 3300032137 Ga0316585_10009466 Ga0316585_100094662 260
190 3300032139 Ga0316580_10003712 Ga0316580_100037124 260
191 3300032168 Ga0316593_10009264 Ga0316593_100092642 260
192 3300035398 Ga0316574_0000549 Ga0316574_0000549_12989_13786 260
193 3300036647 Ga0316582_0004670 Ga0316582_0004670_1039_1836 260
194 3300036712 Ga0316584_0015028 Ga0316584_0015028_2822_3619 260
195 3300042014 Ga0439457_023294 Ga0439457_023294_240_1037 260
196 3300044842 Ga0466957_0457894 Ga0466957_0457894_32_820 260
197 3300044901 Ga0466960_0376094 Ga0466960_0376094_13_798 260
198 3300045976 Ga0466967_0828343 Ga0466967_0828343_86_874 260
199 3300048912 Ga0496109_0063347 Ga0496109_0063347_416_1213 260
200 3300049586 Ga0501070_0211951 Ga0501070_0211951_13_804 260
201 iso_pu_bacteria 2643221567 2643849763 260
202 iso_pu_bacteria 2643221613 2644081587 260
203 iso_pu_bacteria 2643221615 2644088999 260
204 iso_pu_bacteria 2643221624 2644135765 260
205 iso_pu_bacteria 2643221657 2644318844 260
206 iso_pu_bacteria 2643221721 2644666209 260
207 iso_pu_bacteria 2739367654 2739605576 260
208 iso_pu_bacteria 2758568522 2760307589 260
209 iso_pu_bacteria 2758568621 2760623902 260
210 iso_pu_bacteria 2855386786 2855387086 260
211 iso_pu_bacteria 2935890801 2935891169 260
212 iso_pu_bacteria 8054609563 8054612899 260
213 iso_pu_bacteria 8056579771 8056585141 260
214 3300005337 Ga0070682_100091053 Ga0070682_1000910532 261
215 3300005445 Ga0070708_100316500 Ga0070708_1003165003 261
216 3300005455 Ga0070663_100117139 Ga0070663_1001171392 261
217 3300005459 Ga0068867_100055185 Ga0068867_1000551854 261
218 3300005471 Ga0070698_100008110 Ga0070698_1000081109 261
219 3300005548 Ga0070665_100202474 Ga0070665_1002024742 261
220 3300006038 Ga0075365_10102854 Ga0075365_101028543 261
221 3300009098 Ga0105245_10200037 Ga0105245_102000372 261
222 3300009148 Ga0105243_10037006 Ga0105243_100370065 261
223 3300009176 Ga0105242_10079298 Ga0105242_100792984 261
224 3300009551 Ga0105238_10168125 Ga0105238_101681253 261
225 3300011119 Ga0105246_10085253 Ga0105246_100852534 261
226 3300013105 Ga0157369_10826588 Ga0157369_108265881 261
227 3300013296 Ga0157374_10273545 Ga0157374_102735452 261
228 3300014745 Ga0157377_10051441 Ga0157377_100514412 261
229 3300025901 Ga0207688_10076258 Ga0207688_100762582 261
230 3300025927 Ga0207687_10180507 Ga0207687_101805072 261
231 3300025932 Ga0207690_10289523 Ga0207690_102895232 261
232 3300025940 Ga0207691_10392789 Ga0207691_103927892 261
233 3300026067 Ga0207678_10146413 Ga0207678_101464133 261
234 3300026089 Ga0207648_10205336 Ga0207648_102053362 261
235 3300026095 Ga0207676_10891979 Ga0207676_108919791 261
236 3300026121 Ga0207683_10033331 Ga0207683_100333316 261
237 3300028379 Ga0268266_10115839 Ga0268266_101158393 261
238 3300030733 Ga0314311_1057189 Ga0314311_10571892 261
239 3300032005 Ga0307411_10252467 Ga0307411_102524672 261
240 3300041512 Ga0451853_3166378 Ga0451853_3166378_243_1028 261
241 3300044684 Ga0466966_0200383 Ga0466966_0200383_327_1121 261
242 3300048906 Ga0496103_0340291 Ga0496103_0340291_94_879 261
243 3300048907 Ga0496104_0094935 Ga0496104_0094935_801_1586 261
244 3300048909 Ga0496106_0349852 Ga0496106_0349852_328_1125 261
245 3300048913 Ga0496110_0158543 Ga0496110_0158543_779_1564 261
246 3300048913 Ga0496110_0360402 Ga0496110_0360402_499_1296 261
247 3300049569 Ga0501032_0085286 Ga0501032_0085286_1208_2002 261
248 3300049578 Ga0501042_0087679 Ga0501042_0087679_553_1347 261
249 3300049579 Ga0501043_0181884 Ga0501043_0181884_780_1574 261
250 3300049583 Ga0501067_0038711 Ga0501067_0038711_893_1690 261
251 3300049824 Ga0501045_0059854 Ga0501045_0059854_1969_2760 261
252 3300061734 Ga0530510_0117871 Ga0530510_0117871_928_1722 261
253 iso_pu_bacteria 2643221711 2644611128 261
254 iso_pu_bacteria 2738541305 2738868250 261
255 iso_pu_bacteria 2818991318 2819427799 261
256 iso_pu_bacteria 2818991458 2819666675 261
257 3300003285 Ga0007423J48922_100026 Ga0007423J48922_1000264 262
258 3300003285 Ga0007423J48922_100029 Ga0007423J48922_1000292 262
259 3300003373 JGI25407J50210_10020881 JGI25407J50210_100208812 262
260 3300005327 Ga0070658_10108699 Ga0070658_101086992 262
261 3300005334 Ga0068869_100087538 Ga0068869_1000875384 262
262 3300005347 Ga0070668_100060446 Ga0070668_1000604464 262
263 3300005354 Ga0070675_100103827 Ga0070675_1001038274 262
264 3300005356 Ga0070674_100112604 Ga0070674_1001126043 262
265 3300005364 Ga0070673_100275094 Ga0070673_1002750942 262
266 3300005459 Ga0068867_100400648 Ga0068867_1004006482 262
267 3300005535 Ga0070684_100364623 Ga0070684_1003646231 262
268 3300005535 Ga0070684_100467158 Ga0070684_1004671581 262
269 3300005539 Ga0068853_100192805 Ga0068853_1001928054 262
270 3300005719 Ga0068861_100035396 Ga0068861_1000353965 262
271 3300005719 Ga0068861_100113898 Ga0068861_1001138982 262
272 3300005937 Ga0081455_10000389 Ga0081455_1000038923 262
273 3300005937 Ga0081455_10002237 Ga0081455_100022373 262
274 3300005937 Ga0081455_10039452 Ga0081455_100394524 262
275 3300005981 Ga0081538_10000958 Ga0081538_1000095810 262
276 3300006038 Ga0075365_10016366 Ga0075365_100163665 262
277 3300006058 Ga0075432_10000058 Ga0075432_1000005813 262
278 3300006844 Ga0075428_100005267 Ga0075428_1000052674 262
279 3300006844 Ga0075428_100006278 Ga0075428_1000062787 262
280 3300006846 Ga0075430_100022049 Ga0075430_1000220493 262
281 3300006847 Ga0075431_100007939 Ga0075431_1000079399 262
282 3300006852 Ga0075433_10000219 Ga0075433_100002198 262
283 3300006852 Ga0075433_10000698 Ga0075433_100006983 262
284 3300006871 Ga0075434_100062096 Ga0075434_1000620963 262
285 3300006871 Ga0075434_100086091 Ga0075434_1000860913 262
286 3300007076 Ga0075435_100009410 Ga0075435_1000094106 262
287 3300009094 Ga0111539_10000761 Ga0111539_1000076121 262
288 3300009098 Ga0105245_10140867 Ga0105245_101408673 262
289 3300009147 Ga0114129_10025297 Ga0114129_100252977 262
290 3300009148 Ga0105243_10020623 Ga0105243_100206232 262
291 3300009148 Ga0105243_10113163 Ga0105243_101131632 262
292 3300009551 Ga0105238_10237316 Ga0105238_102373163 262
293 3300009553 Ga0105249_10009986 Ga0105249_100099867 262
294 3300013306 Ga0163162_10061724 Ga0163162_100617243 262
295 3300013308 Ga0157375_10048309 Ga0157375_100483093 262
296 3300014325 Ga0163163_10177142 Ga0163163_101771423 262
297 3300014326 Ga0157380_10210601 Ga0157380_102106012 262
298 3300014497 Ga0182008_10102494 Ga0182008_101024942 262
299 3300014969 Ga0157376_10230246 Ga0157376_102302462 262
300 3300017792 Ga0163161_10003339 Ga0163161_100033396 262
301 3300017792 Ga0163161_10207374 Ga0163161_102073742 262
302 3300020082 Ga0206353_11891153 Ga0206353_118911536 262
303 3300025901 Ga0207688_10089026 Ga0207688_100890262 262
304 3300025918 Ga0207662_10132783 Ga0207662_101327832 262
305 3300025926 Ga0207659_10336380 Ga0207659_103363802 262
306 3300025927 Ga0207687_10130345 Ga0207687_101303452 262
307 3300025927 Ga0207687_10133851 Ga0207687_101338512 262
308 3300025927 Ga0207687_10256459 Ga0207687_102564591 262
309 3300025933 Ga0207706_10019419 Ga0207706_100194194 262
310 3300025942 Ga0207689_10098304 Ga0207689_100983044 262
311 3300025960 Ga0207651_10166275 Ga0207651_101662752 262
312 3300025961 Ga0207712_10029400 Ga0207712_100294003 262
313 3300026075 Ga0207708_10208368 Ga0207708_102083682 262
314 3300026095 Ga0207676_10437749 Ga0207676_104377491 262
315 3300026118 Ga0207675_100013667 Ga0207675_1000136674 262
316 3300026118 Ga0207675_100527183 Ga0207675_1005271831 262
317 3300026121 Ga0207683_10100850 Ga0207683_101008502 262
318 3300026142 Ga0207698_10266669 Ga0207698_102666693 262
319 3300027907 Ga0207428_10000762 Ga0207428_1000076218 262
320 3300027907 Ga0207428_10002987 Ga0207428_100029874 262
321 3300031247 Ga0265340_10006814 Ga0265340_100068144 262
322 3300031456 Ga0307513_10004391 Ga0307513_100043916 262
323 3300031548 Ga0307408_100062770 Ga0307408_1000627703 262
324 3300031548 Ga0307408_100167735 Ga0307408_1001677352 262
325 3300031691 Ga0316579_10000033 Ga0316579_1000003314 262
326 3300031731 Ga0307405_10010077 Ga0307405_100100771 262
327 3300031824 Ga0307413_10002548 Ga0307413_100025483 262
328 3300031852 Ga0307410_10000645 Ga0307410_1000064512 262
329 3300031852 Ga0307410_10006401 Ga0307410_100064016 262
330 3300031852 Ga0307410_10070418 Ga0307410_100704182 262
331 3300031901 Ga0307406_10000359 Ga0307406_1000035914 262
332 3300031901 Ga0307406_10012203 Ga0307406_100122035 262
333 3300031901 Ga0307406_10151671 Ga0307406_101516713 262
334 3300031903 Ga0307407_10020726 Ga0307407_100207262 262
335 3300031911 Ga0307412_10067640 Ga0307412_100676402 262
336 3300031995 Ga0307409_100000241 Ga0307409_1000002418 262
337 3300031995 Ga0307409_100001043 Ga0307409_10000104312 262
338 3300031995 Ga0307409_100041734 Ga0307409_1000417345 262
339 3300031995 Ga0307409_100078800 Ga0307409_1000788002 262
340 3300031995 Ga0307409_100110479 Ga0307409_1001104794 262
341 3300032002 Ga0307416_100000776 Ga0307416_1000007766 262
342 3300032002 Ga0307416_100083322 Ga0307416_1000833224 262
343 3300032002 Ga0307416_100134636 Ga0307416_1001346364 262
344 3300032002 Ga0307416_100888235 Ga0307416_1008882351 262
345 3300032004 Ga0307414_10004139 Ga0307414_100041394 262
346 3300032005 Ga0307411_10031205 Ga0307411_100312055 262
347 3300032126 Ga0307415_100000728 Ga0307415_1000007286 262
348 3300042016 Ga0439463_008813 Ga0439463_008813_1314_2102 262
349 3300042439 Ga0439464_0016034 Ga0439464_0016034_750_1538 262
350 3300044901 Ga0466960_0047606 Ga0466960_0047606_80_886 262
351 3300044901 Ga0466960_0197611 Ga0466960_0197611_57_845 262
352 3300046457 Ga0495590_0041831 Ga0495590_0041831_774_1562 262
353 3300046462 Ga0495651_0221009 Ga0495651_0221009_303_1091 262
354 3300046463 Ga0495653_0003372 Ga0495653_0003372_3077_3865 262
355 3300046515 Ga0495620_0034517 Ga0495620_0034517_658_1446 262
356 3300046519 Ga0495632_0124754 Ga0495632_0124754_30_818 262
357 3300046615 Ga0495656_0092515 Ga0495656_0092515_129_917 262
358 3300046616 Ga0495668_0075966 Ga0495668_0075966_605_1393 262
359 3300047319 Ga0495674_0359852 Ga0495674_0359852_330_1118 262
360 3300048905 Ga0496102_0035726 Ga0496102_0035726_1676_2482 262
361 3300048914 Ga0496111_0097649 Ga0496111_0097649_387_1181 262
362 3300048917 Ga0496114_0001386 Ga0496114_0001386_14425_15231 262
363 3300048917 Ga0496114_0015556 Ga0496114_0015556_3256_4062 262
364 3300049514 Ga0501291_010049 Ga0501291_010049_93_881 262
365 3300049568 Ga0501031_0001919 Ga0501031_0001919_4840_5646 262
366 3300049568 Ga0501031_0013782 Ga0501031_0013782_3464_4252 262
367 3300049569 Ga0501032_0133184 Ga0501032_0133184_144_932 262
368 3300049570 Ga0501033_0004714 Ga0501033_0004714_5383_6174 262
369 3300049572 Ga0501036_0002680 Ga0501036_0002680_1350_2156 262
370 3300049572 Ga0501036_0009496 Ga0501036_0009496_2970_3758 262
371 3300049573 Ga0501037_0028809 Ga0501037_0028809_724_1512 262
372 3300049573 Ga0501037_0088589 Ga0501037_0088589_686_1492 262
373 3300049574 Ga0501038_0012946 Ga0501038_0012946_2106_2894 262
374 3300049574 Ga0501038_0017662 Ga0501038_0017662_5173_5979 262
375 3300049575 Ga0501039_0025011 Ga0501039_0025011_3129_3935 262
376 3300049576 Ga0501040_0004774 Ga0501040_0004774_2594_3400 262
377 3300049577 Ga0501041_0001143 Ga0501041_0001143_12847_13653 262
378 3300049577 Ga0501041_0074115 Ga0501041_0074115_221_1009 262
379 3300049578 Ga0501042_0014278 Ga0501042_0014278_3463_4251 262
380 3300049578 Ga0501042_0020536 Ga0501042_0020536_2988_3794 262
381 3300049579 Ga0501043_0019591 Ga0501043_0019591_777_1583 262
382 3300049579 Ga0501043_0281171 Ga0501043_0281171_367_1158 262
383 3300049580 Ga0501046_0010494 Ga0501046_0010494_3741_4532 262
384 3300049580 Ga0501046_0058374 Ga0501046_0058374_1420_2226 262
385 3300049582 Ga0501048_0002219 Ga0501048_0002219_9214_10020 262
386 3300049584 Ga0501068_0094978 Ga0501068_0094978_790_1596 262
387 3300049587 Ga0501071_0003185 Ga0501071_0003185_9011_9817 262
388 3300049587 Ga0501071_0034794 Ga0501071_0034794_1976_2764 262
389 3300049588 Ga0501072_0070239 Ga0501072_0070239_874_1662 262
390 3300049588 Ga0501072_0082451 Ga0501072_0082451_805_1611 262
391 3300049590 Ga0501074_0026963 Ga0501074_0026963_273_1061 262
392 3300049590 Ga0501074_0037999 Ga0501074_0037999_823_1629 262
393 3300049591 Ga0501075_0074446 Ga0501075_0074446_790_1596 262
394 3300049592 Ga0501076_0003800 Ga0501076_0003800_693_1481 262
395 3300049592 Ga0501076_0160942 Ga0501076_0160942_240_1046 262
396 3300049593 Ga0501077_0023095 Ga0501077_0023095_2483_3289 262
397 3300049655 Ga0501208_007016 Ga0501208_007016_406_1194 262
398 3300049680 Ga0501250_011169 Ga0501250_011169_89_877 262
399 3300049704 Ga0501221_014152 Ga0501221_014152_526_1314 262
400 3300049741 Ga0501079_0001954 Ga0501079_0001954_7160_7966 262
401 3300049742 Ga0501080_0126596 Ga0501080_0126596_1379_2185 262
402 3300049743 Ga0501081_0003820 Ga0501081_0003820_579_1385 262
403 3300049822 Ga0501035_0075878 Ga0501035_0075878_349_1137 262
404 3300049822 Ga0501035_0103743 Ga0501035_0103743_82_888 262
405 3300049823 Ga0501044_0368688 Ga0501044_0368688_277_1068 262
406 3300049824 Ga0501045_0003370 Ga0501045_0003370_2771_3577 262
407 3300050492 nmdc:mga0yw44_20302_c1 nmdc:mga0yw44_20302_c1_2175_2975 262
408 3300050507 nmdc:mga05p37_37668_c1 nmdc:mga05p37_37668_c1_4189_4977 262
409 3300050508 nmdc:mga09592_18650_c1 nmdc:mga09592_18650_c1_1972_2760 262
410 3300050511 nmdc:mga08y16_4203_c1 nmdc:mga08y16_4203_c1_12362_13150 262
411 3300050512 nmdc:mga0n895_217_c1 nmdc:mga0n895_217_c1_20270_21058 262
412 3300050513 nmdc:mga0rr50_26718_c1 nmdc:mga0rr50_26718_c1_2549_3337 262
413 3300050513 nmdc:mga0rr50_30846_c1 nmdc:mga0rr50_30846_c1_1530_2318 262
414 3300050515 nmdc:mga0a205_1731_c1 nmdc:mga0a205_1731_c1_13936_14724 262
415 3300050515 nmdc:mga0a205_21032_c1 nmdc:mga0a205_21032_c1_1484_2272 262
416 3300053085 Ga0495619_0357553 Ga0495619_0357553_210_998 262
417 3300054114 Ga0501084_0007477 Ga0501084_0007477_758_1564 262
418 3300054114 Ga0501084_0151419 Ga0501084_0151419_392_1180 262
419 3300060353 Ga0501082_0049469 Ga0501082_0049469_740_1528 262
420 3300060353 Ga0501082_0058657 Ga0501082_0058657_1646_2452 262
421 3300061734 Ga0530510_0002431 Ga0530510_0002431_6203_7009 262
422 iso_pu_bacteria 2818991462 2819691809 262
423 iso_pu_bacteria 2818991469 2819729414 262
424 3300002067 JGI24735J21928_10025374 JGI24735J21928_100253742 263
425 3300005327 Ga0070658_10180206 Ga0070658_101802061 263
426 3300005329 Ga0070683_100028647 Ga0070683_1000286474 263
427 3300005336 Ga0070680_100083184 Ga0070680_1000831843 263
428 3300005337 Ga0070682_100055635 Ga0070682_1000556354 263
429 3300005339 Ga0070660_100394953 Ga0070660_1003949532 263
430 3300005345 Ga0070692_10014659 Ga0070692_100146592 263
431 3300005366 Ga0070659_100062050 Ga0070659_1000620503 263
432 3300005367 Ga0070667_100219563 Ga0070667_1002195633 263
433 3300005530 Ga0070679_100043095 Ga0070679_1000430953 263
434 3300005535 Ga0070684_100001477 Ga0070684_10000147714 263
435 3300005539 Ga0068853_100539853 Ga0068853_1005398531 263
436 3300005563 Ga0068855_100075566 Ga0068855_1000755662 263
437 3300005614 Ga0068856_100013092 Ga0068856_1000130925 263
438 3300005616 Ga0068852_100348298 Ga0068852_1003482982 263
439 3300005718 Ga0068866_10149273 Ga0068866_101492731 263
440 3300006038 Ga0075365_10023828 Ga0075365_100238283 263
441 3300009094 Ga0111539_10093674 Ga0111539_100936743 263
442 3300009098 Ga0105245_10004528 Ga0105245_100045283 263
443 3300009176 Ga0105242_10156328 Ga0105242_101563283 263
444 3300009177 Ga0105248_10025656 Ga0105248_100256563 263
445 3300009553 Ga0105249_10054015 Ga0105249_100540154 263
446 3300013105 Ga0157369_10172032 Ga0157369_101720322 263
447 3300013306 Ga0163162_10011203 Ga0163162_100112037 263
448 3300013306 Ga0163162_10810791 Ga0163162_108107912 263
449 3300013307 Ga0157372_10300342 Ga0157372_103003422 263
450 3300014325 Ga0163163_10037041 Ga0163163_100370416 263
451 3300014325 Ga0163163_10308490 Ga0163163_103084902 263
452 3300014326 Ga0157380_10472484 Ga0157380_104724842 263
453 3300021384 Ga0213876_10095160 Ga0213876_100951602 263
454 3300025904 Ga0207647_10025112 Ga0207647_100251126 263
455 3300025904 Ga0207647_10072892 Ga0207647_100728922 263
456 3300025917 Ga0207660_10067758 Ga0207660_100677583 263
457 3300025921 Ga0207652_10337513 Ga0207652_103375131 263
458 3300025921 Ga0207652_10603986 Ga0207652_106039862 263
459 3300025932 Ga0207690_10126865 Ga0207690_101268652 263
460 3300025935 Ga0207709_10482779 Ga0207709_104827791 263
461 3300025944 Ga0207661_10172572 Ga0207661_101725722 263
462 3300025944 Ga0207661_10323203 Ga0207661_103232033 263
463 3300025949 Ga0207667_10242704 Ga0207667_102427042 263
464 3300025986 Ga0207658_10167902 Ga0207658_101679022 263
465 3300026023 Ga0207677_10289530 Ga0207677_102895302 263
466 3300026041 Ga0207639_10040091 Ga0207639_100400912 263
467 3300026078 Ga0207702_10058589 Ga0207702_100585893 263
468 3300026121 Ga0207683_10235677 Ga0207683_102356772 263
469 3300026142 Ga0207698_10646285 Ga0207698_106462852 263
470 3300028379 Ga0268266_10000855 Ga0268266_1000085534 263
471 3300031995 Ga0307409_100151305 Ga0307409_1001513053 263
472 3300031995 Ga0307409_100599072 Ga0307409_1005990721 263
473 3300032004 Ga0307414_10456763 Ga0307414_104567631 263
474 3300039437 Ga0436365_1153546 Ga0436365_1153546_503_1294 263
475 3300041492 Ga0451835_0652863 Ga0451835_0652863_22_825 263
476 3300041509 Ga0451843_1761125 Ga0451843_1761125_28_831 263
477 3300044658 Ga0466972_0073388 Ga0466972_0073388_827_1621 263
478 3300044683 Ga0466965_0001100 Ga0466965_0001100_1451_2245 263
479 3300044694 Ga0466963_0122025 Ga0466963_0122025_474_1268 263
480 3300044719 Ga0466971_0043653 Ga0466971_0043653_128_922 263
481 3300045051 Ga0451576_0018962 Ga0451576_0018962_3074_3865 263
482 3300045836 Ga0466958_0054616 Ga0466958_0054616_846_1640 263
483 3300045976 Ga0466967_0008910 Ga0466967_0008910_5124_5915 263
484 3300045976 Ga0466967_0090190 Ga0466967_0090190_591_1382 263
485 3300045976 Ga0466967_0595940 Ga0466967_0595940_274_1065 263
486 3300047321 Ga0495676_0443342 Ga0495676_0443342_19_810 263
487 3300048903 Ga0496100_0397986 Ga0496100_0397986_40_837 263
488 3300048904 Ga0496101_0079801 Ga0496101_0079801_1379_2170 263
489 3300048905 Ga0496102_0006762 Ga0496102_0006762_8526_9317 263
490 3300048905 Ga0496102_0229456 Ga0496102_0229456_903_1700 263
491 3300048905 Ga0496102_0254003 Ga0496102_0254003_637_1428 263
492 3300048906 Ga0496103_0034012 Ga0496103_0034012_319_1110 263
493 3300048906 Ga0496103_0060371 Ga0496103_0060371_1167_1958 263
494 3300048907 Ga0496104_0001885 Ga0496104_0001885_10143_10940 263
495 3300048908 Ga0496105_0000343 Ga0496105_0000343_24508_25305 263
496 3300048909 Ga0496106_0006613 Ga0496106_0006613_890_1681 263
497 3300048910 Ga0496107_0048983 Ga0496107_0048983_2059_2850 263
498 3300048911 Ga0496108_0207548 Ga0496108_0207548_682_1479 263
499 3300048912 Ga0496109_0015105 Ga0496109_0015105_4525_5322 263
500 3300048912 Ga0496109_0109916 Ga0496109_0109916_449_1243 263
501 3300048912 Ga0496109_0141538 Ga0496109_0141538_584_1375 263
502 3300048913 Ga0496110_0006701 Ga0496110_0006701_3781_4572 263
503 3300048914 Ga0496111_0149059 Ga0496111_0149059_300_1094 263
504 3300048915 Ga0496112_0256413 Ga0496112_0256413_108_899 263
505 3300048916 Ga0496113_0359310 Ga0496113_0359310_30_821 263
506 3300048917 Ga0496114_0006813 Ga0496114_0006813_7237_8034 263
507 3300048917 Ga0496114_0038855 Ga0496114_0038855_2481_3272 263
508 3300048917 Ga0496114_0525529 Ga0496114_0525529_58_849 263
509 3300048918 Ga0496115_0008918 Ga0496115_0008918_235_1032 263
510 3300049568 Ga0501031_0090304 Ga0501031_0090304_479_1270 263
511 3300049569 Ga0501032_0057252 Ga0501032_0057252_1018_1812 263
512 3300049569 Ga0501032_0130275 Ga0501032_0130275_533_1324 263
513 3300049571 Ga0501034_0016438 Ga0501034_0016438_113_907 263
514 3300049571 Ga0501034_0041505 Ga0501034_0041505_554_1345 263
515 3300049571 Ga0501034_0266027 Ga0501034_0266027_647_1438 263
516 3300049572 Ga0501036_0032559 Ga0501036_0032559_269_1063 263
517 3300049572 Ga0501036_0235492 Ga0501036_0235492_642_1442 263
518 3300049573 Ga0501037_0018718 Ga0501037_0018718_1999_2793 263
519 3300049574 Ga0501038_0009754 Ga0501038_0009754_3371_4165 263
520 3300049574 Ga0501038_0302739 Ga0501038_0302739_243_1034 263
521 3300049578 Ga0501042_0039243 Ga0501042_0039243_855_1649 263
522 3300049579 Ga0501043_0016176 Ga0501043_0016176_4487_5281 263
523 3300049580 Ga0501046_0021536 Ga0501046_0021536_2128_2922 263
524 3300049581 Ga0501047_0030123 Ga0501047_0030123_2439_3233 263
525 3300049582 Ga0501048_0003081 Ga0501048_0003081_10949_11743 263
526 3300049583 Ga0501067_0001723 Ga0501067_0001723_8982_9773 263
527 3300049583 Ga0501067_0019013 Ga0501067_0019013_763_1554 263
528 3300049584 Ga0501068_0005888 Ga0501068_0005888_5147_5938 263
529 3300049584 Ga0501068_0058694 Ga0501068_0058694_706_1497 263
530 3300049585 Ga0501069_0047720 Ga0501069_0047720_189_980 263
531 3300049585 Ga0501069_0082734 Ga0501069_0082734_515_1306 263
532 3300049586 Ga0501070_0004831 Ga0501070_0004831_1771_2565 263
533 3300049586 Ga0501070_0007702 Ga0501070_0007702_4416_5207 263
534 3300049586 Ga0501070_0036195 Ga0501070_0036195_2149_2940 263
535 3300049587 Ga0501071_0213437 Ga0501071_0213437_142_933 263
536 3300049588 Ga0501072_0035425 Ga0501072_0035425_1655_2446 263
537 3300049588 Ga0501072_0103443 Ga0501072_0103443_766_1557 263
538 3300049589 Ga0501073_0011619 Ga0501073_0011619_2149_2940 263
539 3300049589 Ga0501073_0030168 Ga0501073_0030168_2389_3180 263
540 3300049590 Ga0501074_0002308 Ga0501074_0002308_2320_3111 263
541 3300049590 Ga0501074_0003143 Ga0501074_0003143_1788_2579 263
542 3300049590 Ga0501074_0146696 Ga0501074_0146696_43_834 263
543 3300049590 Ga0501074_0383359 Ga0501074_0383359_188_982 263
544 3300049592 Ga0501076_0321768 Ga0501076_0321768_131_922 263
545 3300049593 Ga0501077_0015410 Ga0501077_0015410_1788_2579 263
546 3300049593 Ga0501077_0028507 Ga0501077_0028507_715_1506 263
547 3300049741 Ga0501079_0293633 Ga0501079_0293633_142_933 263
548 3300049742 Ga0501080_0001505 Ga0501080_0001505_12351_13142 263
549 3300049742 Ga0501080_0012257 Ga0501080_0012257_6064_6855 263
550 3300049742 Ga0501080_0036089 Ga0501080_0036089_51_845 263
551 3300049744 Ga0501083_0036467 Ga0501083_0036467_1641_2432 263
552 3300049822 Ga0501035_0004064 Ga0501035_0004064_10065_10859 263
553 3300049822 Ga0501035_0334480 Ga0501035_0334480_452_1243 263
554 3300049823 Ga0501044_0149052 Ga0501044_0149052_915_1709 263
555 3300050511 nmdc:mga08y16_164887_c1 nmdc:mga08y16_164887_c1_1323_2117 263
556 3300054114 Ga0501084_0056702 Ga0501084_0056702_445_1236 263
557 3300054114 Ga0501084_0066555 Ga0501084_0066555_793_1584 263
558 3300059424 Ga0590075_010047 Ga0590075_010047_764_1558 263
559 3300060353 Ga0501082_0006014 Ga0501082_0006014_493_1284 263
560 3300060353 Ga0501082_0087906 Ga0501082_0087906_1654_2445 263
561 3300061719 Ga0466962_0081188 Ga0466962_0081188_453_1247 263
562 iso_pu_bacteria 2643221641 2644232191 263
563 iso_pu_bacteria 2739367898 2740169400 263
564 iso_pu_bacteria 2893684298 2893684516 263
565 3300000549 LJQas_1000241 LJQas_10002413 264
566 3300002075 JGI24738J21930_10004130 JGI24738J21930_100041305 264
567 3300002077 JGI24744J21845_10003101 JGI24744J21845_100031013 264
568 3300005328 Ga0070676_10099639 Ga0070676_100996393 264
569 3300005329 Ga0070683_100198245 Ga0070683_1001982452 264
570 3300005329 Ga0070683_100507177 Ga0070683_1005071772 264
571 3300005337 Ga0070682_100383418 Ga0070682_1003834182 264
572 3300005338 Ga0068868_100202380 Ga0068868_1002023801 264
573 3300005340 Ga0070689_100373282 Ga0070689_1003732821 264
574 3300005345 Ga0070692_10002700 Ga0070692_100027008 264
575 3300005356 Ga0070674_100056117 Ga0070674_1000561174 264
576 3300005366 Ga0070659_100013602 Ga0070659_1000136024 264
577 3300005366 Ga0070659_100023295 Ga0070659_1000232955 264
578 3300005366 Ga0070659_100251874 Ga0070659_1002518742 264
579 3300005367 Ga0070667_100050900 Ga0070667_1000509001 264
580 3300005435 Ga0070714_100013479 Ga0070714_1000134796 264
581 3300005438 Ga0070701_10027670 Ga0070701_100276702 264
582 3300005441 Ga0070700_100048768 Ga0070700_1000487682 264
583 3300005459 Ga0068867_100003083 Ga0068867_1000030835 264
584 3300005535 Ga0070684_100134421 Ga0070684_1001344212 264
585 3300005539 Ga0068853_100116035 Ga0068853_1001160354 264
586 3300005543 Ga0070672_100009022 Ga0070672_1000090226 264
587 3300005544 Ga0070686_100136762 Ga0070686_1001367622 264
588 3300005564 Ga0070664_100046261 Ga0070664_1000462613 264
589 3300005577 Ga0068857_100513532 Ga0068857_1005135321 264
590 3300005616 Ga0068852_100166849 Ga0068852_1001668494 264
591 3300005618 Ga0068864_100091213 Ga0068864_1000912132 264
592 3300005719 Ga0068861_100005561 Ga0068861_1000055615 264
593 3300005843 Ga0068860_100000490 Ga0068860_10000049028 264
594 3300005937 Ga0081455_10000462 Ga0081455_1000046243 264
595 3300005937 Ga0081455_10007912 Ga0081455_100079123 264
596 3300005981 Ga0081538_10030060 Ga0081538_100300604 264
597 3300006038 Ga0075365_10018410 Ga0075365_100184102 264
598 3300006038 Ga0075365_10063538 Ga0075365_100635382 264
599 3300006038 Ga0075365_10127904 Ga0075365_101279043 264
600 3300006038 Ga0075365_10301673 Ga0075365_103016732 264
601 3300006051 Ga0075364_10078519 Ga0075364_100785192 264
602 3300006178 Ga0075367_10063602 Ga0075367_100636023 264
603 3300006353 Ga0075370_10080619 Ga0075370_100806192 264
604 3300006844 Ga0075428_100001925 Ga0075428_10000192518 264
605 3300006846 Ga0075430_100008725 Ga0075430_1000087252 264
606 3300006847 Ga0075431_100038789 Ga0075431_1000387896 264
607 3300006852 Ga0075433_10140536 Ga0075433_101405362 264
608 3300006880 Ga0075429_100003147 Ga0075429_1000031472 264
609 3300006880 Ga0075429_100140024 Ga0075429_1001400242 264
610 3300006881 Ga0068865_100021028 Ga0068865_1000210286 264
611 3300006881 Ga0068865_100129921 Ga0068865_1001299214 264
612 3300009094 Ga0111539_10018138 Ga0111539_100181384 264
613 3300009147 Ga0114129_10024763 Ga0114129_100247632 264
614 3300009148 Ga0105243_10005196 Ga0105243_100051968 264
615 3300009551 Ga0105238_10052181 Ga0105238_100521813 264
616 3300009553 Ga0105249_10082506 Ga0105249_100825062 264
617 3300009553 Ga0105249_10271503 Ga0105249_102715032 264
618 3300013105 Ga0157369_10547348 Ga0157369_105473481 264
619 3300014326 Ga0157380_10004955 Ga0157380_100049556 264
620 3300014326 Ga0157380_10331148 Ga0157380_103311482 264
621 3300014745 Ga0157377_10070470 Ga0157377_100704701 264
622 3300017792 Ga0163161_10497617 Ga0163161_104976171 264
623 3300025904 Ga0207647_10012752 Ga0207647_100127523 264
624 3300025908 Ga0207643_10005142 Ga0207643_100051429 264
625 3300025908 Ga0207643_10223833 Ga0207643_102238331 264
626 3300025909 Ga0207705_10423181 Ga0207705_104231811 264
627 3300025918 Ga0207662_10062504 Ga0207662_100625042 264
628 3300025919 Ga0207657_10001763 Ga0207657_1000176322 264
629 3300025919 Ga0207657_10087902 Ga0207657_100879024 264
630 3300025927 Ga0207687_10128728 Ga0207687_101287282 264
631 3300025927 Ga0207687_10368383 Ga0207687_103683832 264
632 3300025929 Ga0207664_10007764 Ga0207664_100077644 264
633 3300025931 Ga0207644_10159274 Ga0207644_101592743 264
634 3300025932 Ga0207690_10107107 Ga0207690_101071072 264
635 3300025932 Ga0207690_10249301 Ga0207690_102493012 264
636 3300025935 Ga0207709_10120289 Ga0207709_101202892 264
637 3300025937 Ga0207669_10124273 Ga0207669_101242732 264
638 3300025938 Ga0207704_10095597 Ga0207704_100955972 264
639 3300025940 Ga0207691_10001326 Ga0207691_1000132618 264
640 3300025945 Ga0207679_10012019 Ga0207679_100120193 264
641 3300025945 Ga0207679_10714423 Ga0207679_107144231 264
642 3300025961 Ga0207712_10196338 Ga0207712_101963383 264
643 3300025961 Ga0207712_10333832 Ga0207712_103338321 264
644 3300025972 Ga0207668_10431852 Ga0207668_104318521 264
645 3300025986 Ga0207658_10035146 Ga0207658_100351466 264
646 3300026041 Ga0207639_10160167 Ga0207639_101601673 264
647 3300026067 Ga0207678_10338638 Ga0207678_103386382 264
648 3300026075 Ga0207708_10001578 Ga0207708_1000157810 264
649 3300026075 Ga0207708_10042287 Ga0207708_100422871 264
650 3300026089 Ga0207648_10000901 Ga0207648_100009019 264
651 3300026118 Ga0207675_100015322 Ga0207675_1000153225 264
652 3300026118 Ga0207675_100077611 Ga0207675_1000776114 264
653 3300026118 Ga0207675_100614879 Ga0207675_1006148792 264
654 3300027907 Ga0207428_10010257 Ga0207428_100102574 264
655 3300028381 Ga0268264_10000155 Ga0268264_1000015527 264
656 3300031731 Ga0307405_10094581 Ga0307405_100945813 264
657 3300031824 Ga0307413_10055842 Ga0307413_100558422 264
658 3300031852 Ga0307410_10007372 Ga0307410_100073725 264
659 3300031903 Ga0307407_10012934 Ga0307407_100129344 264
660 3300031911 Ga0307412_10059763 Ga0307412_100597632 264
661 3300031911 Ga0307412_10207975 Ga0307412_102079752 264
662 3300031995 Ga0307409_100035422 Ga0307409_1000354222 264
663 3300031995 Ga0307409_100040532 Ga0307409_1000405323 264
664 3300031995 Ga0307409_100078462 Ga0307409_1000784623 264
665 3300031995 Ga0307409_100150632 Ga0307409_1001506323 264
666 3300032002 Ga0307416_100154824 Ga0307416_1001548242 264
667 3300032002 Ga0307416_100516406 Ga0307416_1005164062 264
668 3300032002 Ga0307416_100959530 Ga0307416_1009595302 264
669 3300032126 Ga0307415_100019312 Ga0307415_1000193123 264
670 3300032126 Ga0307415_100029261 Ga0307415_1000292612 264
671 3300037312 Ga0395899_0014501 Ga0395899_0014501_5098_5895 264
672 3300037418 Ga0395900_0079027 Ga0395900_0079027_2294_3106 264
673 3300037418 Ga0395900_0169233 Ga0395900_0169233_712_1509 264
674 3300037466 Ga0395898_0140478 Ga0395898_0140478_1453_2265 264
675 3300037471 Ga0395905_0034140 Ga0395905_0034140_725_1519 264
676 3300037471 Ga0395905_0093881 Ga0395905_0093881_1034_1846 264
677 3300038443 Ga0395901_0018915 Ga0395901_0018915_1657_2454 264
678 3300038443 Ga0395901_0027733 Ga0395901_0027733_3825_4637 264
679 3300041494 Ga0451837_0251532 Ga0451837_0251532_564_1370 264
680 3300041512 Ga0451853_0197664 Ga0451853_0197664_2904_3710 264
681 3300042004 Ga0439445_0014730 Ga0439445_0014730_416_1213 264
682 3300042156 Ga0439446_0026025 Ga0439446_0026025_534_1331 264
683 3300042435 Ga0439434_0005938 Ga0439434_0005938_682_1479 264
684 3300044656 Ga0466969_0076767 Ga0466969_0076767_59_856 264
685 3300044658 Ga0466972_0030057 Ga0466972_0030057_524_1321 264
686 3300044658 Ga0466972_0055080 Ga0466972_0055080_1011_1805 264
687 3300044683 Ga0466965_0009959 Ga0466965_0009959_2694_3491 264
688 3300044683 Ga0466965_0036712 Ga0466965_0036712_491_1285 264
689 3300044683 Ga0466965_0041162 Ga0466965_0041162_249_1046 264
690 3300044684 Ga0466966_0060991 Ga0466966_0060991_260_1057 264
691 3300044693 Ga0466961_0124038 Ga0466961_0124038_711_1508 264
692 3300044694 Ga0466963_0029911 Ga0466963_0029911_677_1474 264
693 3300044706 Ga0466964_0111170 Ga0466964_0111170_126_920 264
694 3300044719 Ga0466971_0050259 Ga0466971_0050259_651_1493 264
695 3300044719 Ga0466971_0059250 Ga0466971_0059250_390_1187 264
696 3300044765 Ga0466970_0050536 Ga0466970_0050536_593_1390 264
697 3300044765 Ga0466970_0115917 Ga0466970_0115917_100_897 264
698 3300044842 Ga0466957_0062646 Ga0466957_0062646_1427_2224 264
699 3300044901 Ga0466960_0002211 Ga0466960_0002211_2293_3090 264
700 3300044901 Ga0466960_0012753 Ga0466960_0012753_2724_3521 264
701 3300044901 Ga0466960_0026422 Ga0466960_0026422_696_1493 264
702 3300044901 Ga0466960_0114095 Ga0466960_0114095_193_990 264
703 3300045049 Ga0466959_0043735 Ga0466959_0043735_332_1129 264
704 3300045049 Ga0466959_0485068 Ga0466959_0485068_15_812 264
705 3300045836 Ga0466958_0073838 Ga0466958_0073838_809_1606 264
706 3300045976 Ga0466967_0018579 Ga0466967_0018579_3666_4463 264
707 3300045976 Ga0466967_0250665 Ga0466967_0250665_64_861 264
708 3300046535 Ga0495586_0314972 Ga0495586_0314972_57_869 264
709 3300048903 Ga0496100_0103656 Ga0496100_0103656_180_992 264
710 3300048904 Ga0496101_0066073 Ga0496101_0066073_994_1806 264
711 3300048905 Ga0496102_0008565 Ga0496102_0008565_764_1576 264
712 3300048905 Ga0496102_0512265 Ga0496102_0512265_91_903 264
713 3300048906 Ga0496103_0087483 Ga0496103_0087483_38_850 264
714 3300048907 Ga0496104_0025182 Ga0496104_0025182_2224_3036 264
715 3300048907 Ga0496104_0548376 Ga0496104_0548376_68_880 264
716 3300048907 Ga0496104_0609769 Ga0496104_0609769_160_972 264
717 3300048908 Ga0496105_0004871 Ga0496105_0004871_189_1001 264
718 3300048908 Ga0496105_0049207 Ga0496105_0049207_2105_2917 264
719 3300048908 Ga0496105_0200332 Ga0496105_0200332_166_960 264
720 3300048909 Ga0496106_0178993 Ga0496106_0178993_307_1104 264
721 3300048911 Ga0496108_0025707 Ga0496108_0025707_2616_3416 264
722 3300048911 Ga0496108_0113661 Ga0496108_0113661_1360_2154 264
723 3300048912 Ga0496109_0014363 Ga0496109_0014363_4538_5338 264
724 3300048913 Ga0496110_0016549 Ga0496110_0016549_1030_1842 264
725 3300048913 Ga0496110_0024390 Ga0496110_0024390_3452_4279 264
726 3300048913 Ga0496110_0026885 Ga0496110_0026885_2691_3485 264
727 3300048913 Ga0496110_0203886 Ga0496110_0203886_239_1051 264
728 3300048913 Ga0496110_0205461 Ga0496110_0205461_610_1407 264
729 3300048913 Ga0496110_0302443 Ga0496110_0302443_60_857 264
730 3300048914 Ga0496111_0113004 Ga0496111_0113004_791_1603 264
731 3300048916 Ga0496113_0165252 Ga0496113_0165252_895_1707 264
732 3300048916 Ga0496113_0200997 Ga0496113_0200997_300_1127 264
733 3300048917 Ga0496114_0004950 Ga0496114_0004950_7170_7976 264
734 3300048917 Ga0496114_0274934 Ga0496114_0274934_573_1391 264
735 3300048917 Ga0496114_0290830 Ga0496114_0290830_600_1412 264
736 3300048927 Ga0496124_0065792 Ga0496124_0065792_1124_1918 264
737 3300049568 Ga0501031_0090194 Ga0501031_0090194_1157_1957 264
738 3300049570 Ga0501033_0151606 Ga0501033_0151606_803_1600 264
739 3300049571 Ga0501034_0005406 Ga0501034_0005406_3808_4605 264
740 3300049574 Ga0501038_0000969 Ga0501038_0000969_4598_5395 264
741 3300049575 Ga0501039_0277384 Ga0501039_0277384_188_985 264
742 3300049577 Ga0501041_0139130 Ga0501041_0139130_676_1473 264
743 3300049577 Ga0501041_0178575 Ga0501041_0178575_453_1256 264
744 3300049578 Ga0501042_0080019 Ga0501042_0080019_458_1255 264
745 3300049585 Ga0501069_0069790 Ga0501069_0069790_218_1012 264
746 3300049587 Ga0501071_0133606 Ga0501071_0133606_595_1398 264
747 3300049587 Ga0501071_0240098 Ga0501071_0240098_525_1322 264
748 3300049588 Ga0501072_0016523 Ga0501072_0016523_1403_2197 264
749 3300049591 Ga0501075_0131643 Ga0501075_0131643_256_1059 264
750 3300049822 Ga0501035_0018071 Ga0501035_0018071_245_1042 264
751 3300049823 Ga0501044_0023962 Ga0501044_0023962_3462_4259 264
752 3300049824 Ga0501045_0291358 Ga0501045_0291358_240_1037 264
753 3300050491 nmdc:mga00v17_17269_c1 nmdc:mga00v17_17269_c1_2622_3416 264
754 3300050491 nmdc:mga00v17_88442_c1 nmdc:mga00v17_88442_c1_660_1454 264
755 3300050492 nmdc:mga0yw44_612_c1 nmdc:mga0yw44_612_c1_3135_3929 264
756 3300050492 nmdc:mga0yw44_99668_c2 nmdc:mga0yw44_99668_c2_321_1115 264
757 3300050494 nmdc:mga06z11_30411_c1 nmdc:mga06z11_30411_c1_918_1712 264
758 3300050496 nmdc:mga07m45_21596_c1 nmdc:mga07m45_21596_c1_1207_2001 264
759 3300050496 nmdc:mga07m45_366096_c1 nmdc:mga07m45_366096_c1_19_813 264
760 3300050507 nmdc:mga05p37_162_c1 nmdc:mga05p37_162_c1_33006_33803 264
761 3300050508 nmdc:mga09592_165_c1 nmdc:mga09592_165_c1_14430_15227 264
762 3300050508 nmdc:mga09592_230836_c1 nmdc:mga09592_230836_c1_154_951 264
763 3300050509 nmdc:mga0qj67_256480_c1 nmdc:mga0qj67_256480_c1_246_1043 264
764 3300050509 nmdc:mga0qj67_6234_c1 nmdc:mga0qj67_6234_c1_231_1028 264
765 3300050510 nmdc:mga06r32_265_c1 nmdc:mga06r32_265_c1_7437_8234 264
766 3300050510 nmdc:mga06r32_656_c1 nmdc:mga06r32_656_c1_13507_14304 264
767 3300050511 nmdc:mga08y16_3562_c1 nmdc:mga08y16_3562_c1_3276_4073 264
768 3300053077 Ga0495601_0050241 Ga0495601_0050241_877_1716 264
769 3300053088 Ga0500644_0141923 Ga0500644_0141923_76_870 264
770 3300061719 Ga0466962_0023396 Ga0466962_0023396_594_1391 264
771 iso_pu_bacteria 2773857762 2774392115 264
772 iso_pu_bacteria 2808606439 2809195903 264
773 iso_pu_bacteria 2811994878 2812351949 264
774 iso_pu_bacteria 2811994882 2812375055 264
775 iso_pu_bacteria 2891968417 2891970406 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

13

258

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y9a-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from streptomyces coelicolor 0.9847 5 260
4y9a-assembly2.cif.gz_C crystal structure of triosephosphate isomerase from streptomyces coelicolor 0.9809 5 260
3ta6-assembly1.cif.gz_A structure of mycobacterium tuberculosis triosephosphate isomerase 0.9792 5 258
4y8f-assembly1.cif.gz_A-2 crystal structure of triosephosphate isomerase from clostridium perfringens 0.9784 5 257
5ibx-assembly4.cif.gz_E 1.65 angstrom crystal structure of triosephosphate isomerase (tim) from streptococcus pneumoniae 0.9755 3 258
ID Description Score Start End Superfamily
af_A0A1D6MQG5_2_109_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9818 169 258 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9724 4 262 3.20.20.70
3taoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9687 4 262 3.20.20.70
4g1kC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9665 4 258 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9647 5 258 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3N0DUY5-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9986 4 264 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7Z0DBA7-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9976 4 260 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A1Q2CDE1-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9975 5 261 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A3D0S5W4-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9969 9 179 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-K7S3G5-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9968 5 259 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Feature Viewer

pLDDT pTM Quality
95.32 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map