F480253

General Info

Members Datasets Scaffolds Average Seq Length
775 611 509 308

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10069802|Ga0075364_100698022
Length 330
Sequence MANTMDSPRTAVSNPPVQPMETNLTQRDLIRRSATSELPPPERQLTPVAKLIDVSKCIGCKACQSACVEWNDTNPAVGENVGVYTNPHDLTADMFTLMRFTEWVNPETDNLEWLIRKDGCMHCADPGCLKACPAPGAIVQYSNGIVDFIHDNCIGCGYCVKGCPFNIPRISKADHRAYKCTLCSDRVAVGQGPACAKACPTQAIVFGTKEDMKKHAEGRIADLKSRGYANAGLYDPPGVGGTHVMYVLHHNDKPHIYADLPDNPAISAVVQTWKGATKYAGLAVMGLAAAGTLLHGLFAKANRVSKHEEEEAKELVDESVEHAEKREEDA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
10 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
11 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
15 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
16 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
17 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
18 2519103095 Burkholderia sp. KJ006 Isolate Nodule
19 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
20 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
21 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
22 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
23 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
24 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
25 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
26 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
27 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
28 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
29 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
30 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
31 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
32 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
33 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
34 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
35 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
36 2643221618 Ensifer sp. Root231 Isolate Unclassified
37 2643221626 Ensifer sp. Root31 Isolate Unclassified
38 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
39 2643221655 Ensifer sp. Root1252 Isolate Unclassified
40 2643221659 Ensifer sp. Root127 Isolate Unclassified
41 2643221698 Ensifer sp. Root142 Isolate Unclassified
42 2643221712 Ensifer sp. Root258 Isolate Unclassified
43 2643221718 Rhizobium sp. Root268 Isolate Unclassified
44 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
45 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
46 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
47 2721755523 Delftia sp. HK171 Isolate Unclassified
48 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
49 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
50 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
51 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
52 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
53 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
54 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
55 2818991467 Bosea vestrisii 3192 Isolate Unclassified
56 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
57 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
58 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
59 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
60 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
61 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
62 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
63 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
64 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
65 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
66 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
67 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
68 2844163670 Ensifer sp. 1H6 Isolate Unclassified
69 2854911287 Brucella lupini LUP21 Isolate Unclassified
70 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
71 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
72 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
73 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
74 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
75 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
76 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
77 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
78 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
79 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
80 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
81 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
82 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
83 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
84 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
85 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
86 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
87 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
88 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
89 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
90 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
91 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
92 2904564687 Burkholderia sp. 571 Isolate Unclassified
93 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
94 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
95 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
96 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
97 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
98 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
99 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
100 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
101 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
102 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
103 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
104 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
105 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
106 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
107 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
108 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
109 2919404418 Luteibacter sp. 3190 Isolate Unclassified
110 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
111 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
112 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
113 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
114 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
115 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
116 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
117 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
118 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
119 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
120 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
121 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
122 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
123 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
124 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
125 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
126 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
127 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
128 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
129 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
130 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
131 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
132 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
133 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
134 2928163908 Burkholderia sp. 567 Isolate Unclassified
135 2928536128 Burkholderia sola 565 Isolate Unclassified
136 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
137 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
138 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
139 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
140 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
141 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
142 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
143 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
144 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
145 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
146 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
147 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
148 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
149 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
150 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
151 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
152 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
153 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
154 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
155 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
156 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
157 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
158 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
159 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
160 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
161 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
162 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
163 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
164 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
165 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
166 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
167 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
168 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
169 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
170 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
171 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
172 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
173 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
174 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
175 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
176 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
177 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
178 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
179 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
180 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
181 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
182 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
183 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
184 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
185 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
186 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
187 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
188 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
189 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
190 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
191 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
192 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
193 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
194 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
195 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
196 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
197 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
198 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
199 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
200 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
201 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
202 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
203 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
204 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
205 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
206 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
207 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
208 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
209 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
210 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
211 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
212 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
213 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
214 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
215 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
216 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
217 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
218 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
219 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
220 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
221 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
222 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
223 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
224 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
225 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
226 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
227 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
228 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
229 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
230 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
231 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
232 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
233 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
234 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
235 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
236 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
237 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
238 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
239 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
240 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
241 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
242 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
243 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
244 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
245 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
246 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
247 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
248 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
249 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
250 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
251 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
252 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
253 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
254 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
255 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
256 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
257 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
258 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
259 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
260 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
261 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
262 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
263 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
264 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
265 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
266 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
267 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
268 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
269 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
271 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
272 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
273 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
274 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
275 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
276 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
277 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
278 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
279 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
280 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
281 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
282 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
283 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
284 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
285 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
286 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
287 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
288 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
289 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
290 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
291 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
292 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
293 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
294 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
295 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
296 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
297 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
298 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
299 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
300 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
301 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
302 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
303 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
304 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
305 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
306 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
307 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
308 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
309 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
310 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
311 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
312 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
313 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
314 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
315 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
316 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
317 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
318 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
319 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
320 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
321 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
322 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
323 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
324 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
325 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
326 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
327 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
328 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
329 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
330 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
331 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
332 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
333 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
334 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
335 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
336 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
337 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
338 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
339 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
340 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
341 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
342 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
343 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
344 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
345 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
346 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
347 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
348 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
349 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
350 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
351 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
352 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
353 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
354 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
355 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
356 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
357 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
358 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
359 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
361 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
362 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
363 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
364 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
365 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
366 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
371 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
373 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
374 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
377 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
378 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
380 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
381 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
382 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
383 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
384 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
386 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
423 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
424 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
425 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
426 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
429 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
430 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
431 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
432 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
433 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
434 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
435 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
436 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
437 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
438 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
439 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
440 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
441 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
442 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
443 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
444 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
445 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
446 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
447 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
448 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
449 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
450 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
451 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
452 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
453 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
454 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
455 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
456 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
457 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
458 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
459 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
460 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
461 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
462 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
463 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
464 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
465 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
466 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
467 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
468 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
469 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
470 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
471 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
472 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
473 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
474 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
475 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
476 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
477 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
478 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
479 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
480 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
481 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
482 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
483 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
484 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
485 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
486 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
487 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
488 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
489 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
490 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
491 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
492 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
493 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
494 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
495 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
496 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
497 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
498 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
499 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
500 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
501 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
502 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
503 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
504 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
505 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
506 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
507 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
508 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
509 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
510 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
511 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
512 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
513 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
514 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
515 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
516 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
517 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
518 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
519 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
520 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
521 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
522 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
523 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
524 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
525 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
526 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
527 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
528 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
529 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
530 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
531 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
532 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
533 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
534 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
535 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
536 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
537 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
538 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
539 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
540 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
541 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
542 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
543 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
544 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
545 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
546 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
547 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
548 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
549 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
550 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
551 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
552 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
553 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
554 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
555 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
556 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
557 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
558 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
559 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
560 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
561 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
562 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
565 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
566 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
567 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
570 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
571 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
572 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
573 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
574 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
575 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
576 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
577 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
578 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
579 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
580 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
581 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
582 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
583 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
584 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
585 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
586 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
587 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
588 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
589 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
590 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
591 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
592 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
593 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
594 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
595 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
596 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
597 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
598 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
599 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
600 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
602 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
603 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
604 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
605 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
606 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
607 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
608 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
609 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
610 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
611 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 64.13
Metatranscriptomes 1.55
Isolates 34.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.1
Nodule 25.55
Rhizoplane 4.39
Rhizosphere 47.74
Stem 0
Stem Tuber 0
Unclassified 11.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10012955 3300001989 Bacteria 3052
2 JGI24738J21930_10000095 3300002075 Bacteria 20134
3 JGI25156J39149_1000311 3300002705 Bacteria 32300
4 JGI25150J39212_1002960 3300002774 Bacteria 4094
5 JGI25151J46595_10000056 3300003187 Bacteria 151555
6 Ga0006562J51391_1005875 3300003578 Bacteria 6709
7 Ga0055539_1000180 3300003752 Bacteria 53702
8 Ga0055533_1000169 3300003756 Bacteria 59989
9 Ga0055525_1000526 3300003759 Bacteria 18471
10 Ga0055529_1000290 3300003763 Bacteria 58992
11 Ga0055526_1000114 3300003771 Bacteria 71399
12 Ga0055526_1003873 3300003771 Bacteria 9276
13 Ga0055526_1008399 3300003771 Bacteria 5162
14 Ga0055524_1000089 3300003775 Bacteria 115137
15 Ga0055528_1004510 3300003790 Bacteria 6688
16 Ga0055528_1013940 3300003790 Bacteria 3012
17 Ga0058863_11912999 3300004799 Bacteria 2601
18 Ga0058860_11973371 3300004801 Bacteria 1960
19 Ga0065704_10079656 3300005289 Bacteria 4107
20 Ga0065704_10098008 3300005289 Bacteria 2368
21 Ga0065704_10222936 3300005289 Bacteria 1068
22 Ga0065712_10003363 3300005290 Bacteria 3779
23 Ga0070683_100098939 3300005329 Bacteria 2745
24 Ga0070670_100034614 3300005331 Bacteria 4346
25 Ga0070682_100029203 3300005337 Bacteria 3319
26 Ga0070689_100075032 3300005340 Bacteria 2647
27 Ga0070671_100112679 3300005355 Bacteria 2285
28 Ga0070688_100013086 3300005365 Bacteria 4670
29 Ga0070659_100118667 3300005366 Bacteria 2140
30 Ga0070667_100056722 3300005367 Bacteria 3310
31 Ga0070709_10003505 3300005434 Bacteria 8425
32 Ga0070714_100055792 3300005435 Bacteria 3377
33 Ga0070713_100004851 3300005436 Bacteria 9115
34 Ga0070713_100180645 3300005436 Bacteria 1896
35 Ga0070713_100199091 3300005436 Bacteria 1808
36 Ga0070713_100608241 3300005436 Bacteria 1039
37 Ga0070710_10002012 3300005437 Bacteria 9618
38 Ga0070711_100010930 3300005439 Bacteria 5627
39 Ga0070694_100022736 3300005444 Bacteria 4022
40 Ga0070663_100030959 3300005455 Bacteria 3672
41 Ga0070678_100034522 3300005456 Bacteria 3524
42 Ga0070662_100338561 3300005457 Bacteria 1230
43 Ga0070681_10057743 3300005458 Bacteria 3861
44 Ga0070685_10145974 3300005466 Bacteria 1495
45 Ga0070679_100050981 3300005530 Bacteria 4122
46 Ga0070697_100572695 3300005536 Bacteria 991
47 Ga0068853_100053311 3300005539 Bacteria 3483
48 Ga0070695_100005596 3300005545 Bacteria 7399
49 Ga0070665_100088128 3300005548 Bacteria 3109
50 Ga0070665_100106568 3300005548 Bacteria 2805
51 Ga0068855_100022819 3300005563 Bacteria 7499
52 Ga0070664_100009118 3300005564 Bacteria 8053
53 Ga0068857_100101065 3300005577 Bacteria 2587
54 Ga0068854_100393449 3300005578 Bacteria 1145
55 Ga0068859_100161848 3300005617 Bacteria 2317
56 Ga0068866_10035858 3300005718 Bacteria 2425
57 Ga0068861_100008454 3300005719 Bacteria 7089
58 Ga0068861_100096253 3300005719 Bacteria 2345
59 Ga0068861_100106711 3300005719 Bacteria 2238
60 Ga0068863_100058324 3300005841 Bacteria 3653
61 Ga0068858_100023351 3300005842 Bacteria 5761
62 Ga0068862_100008291 3300005844 Bacteria 8598
63 Ga0081455_10130165 3300005937 Bacteria 1969
64 Ga0081538_10097957 3300005981 Bacteria 1488
65 Ga0081540_1000080 3300005983 Bacteria 103320
66 Ga0081540_1000114 3300005983 Bacteria 85489
67 Ga0081540_1008986 3300005983 Bacteria 6912
68 Ga0081540_1029164 3300005983 Bacteria 3080
69 Ga0081539_10002321 3300005985 Bacteria 27418
70 Ga0070717_10006158 3300006028 Bacteria 8808
71 Ga0075365_10153162 3300006038 Bacteria 1604
72 Ga0075368_10011432 3300006042 Bacteria 3230
73 Ga0075363_100003699 3300006048 Bacteria 6577
74 Ga0075364_10003434 3300006051 Bacteria 9008
75 Ga0075364_10069802 3300006051 Bacteria 2312
76 Ga0070715_10001469 3300006163 Bacteria 6852
77 Ga0070715_10038430 3300006163 Bacteria 1987
78 Ga0070716_100007591 3300006173 Bacteria 5349
79 Ga0070712_100022128 3300006175 Bacteria 4183
80 Ga0075362_10060156 3300006177 Bacteria 1716
81 Ga0075369_10035938 3300006186 Bacteria 2107
82 Ga0075369_10052781 3300006186 Bacteria 1763
83 Ga0075366_10031043 3300006195 Bacteria 3143
84 Ga0097621_100011914 3300006237 Bacteria 6431
85 Ga0075433_10278847 3300006852 Bacteria 1481
86 Ga0075434_100247029 3300006871 Bacteria 1804
87 Ga0097620_100161847 3300006931 Bacteria 2317
88 Ga0079104_1000011 3300006946 Bacteria 359962
89 Ga0079104_1000044 3300006946 Bacteria 185367
90 Ga0099794_10072907 3300007265 Bacteria 1684
91 Ga0099795_10005699 3300007788 Bacteria 3338
92 Ga0099795_10013258 3300007788 Bacteria 2525
93 Ga0105250_10011799 3300009092 Bacteria 3621
94 Ga0111539_10000244 3300009094 Bacteria 65141
95 Ga0111539_10615801 3300009094 Bacteria 1264
96 Ga0105245_10027864 3300009098 Bacteria 4979
97 Ga0114129_10042279 3300009147 Bacteria 6417
98 Ga0114129_10095248 3300009147 Bacteria 4123
99 Ga0105243_10000661 3300009148 Bacteria 34076
100 Ga0105243_10048621 3300009148 Bacteria 3344
101 Ga0105241_10256269 3300009174 Bacteria 1485
102 Ga0105248_10062722 3300009177 Bacteria 4173
103 Ga0105237_10091606 3300009545 Bacteria 3030
104 Ga0105238_10003753 3300009551 Bacteria 15085
105 Ga0105238_10129024 3300009551 Bacteria 2507
106 Ga0105239_10637902 3300010375 Bacteria 1216
107 Ga0105246_10010435 3300011119 Bacteria 5748
108 Ga0157373_10007320 3300013100 Bacteria 8220
109 Ga0157370_10056781 3300013104 Bacteria 3725
110 Ga0157369_10000801 3300013105 Bacteria 40212
111 Ga0157369_10013180 3300013105 Bacteria 9355
112 Ga0171462_1038 3300013250 Bacteria 77485
113 Ga0157378_10014070 3300013297 Bacteria 7005
114 Ga0163162_10026365 3300013306 Bacteria 5744
115 Ga0163162_10209936 3300013306 Bacteria 2077
116 Ga0163162_10876046 3300013306 Bacteria 1012
117 Ga0157372_10110193 3300013307 Bacteria 3153
118 Ga0157375_10049410 3300013308 Bacteria 4121
119 Ga0163163_10051675 3300014325 Bacteria 4052
120 Ga0157380_10310806 3300014326 Bacteria 1456
121 Ga0182008_10066558 3300014497 Bacteria 1773
122 Ga0157379_10023040 3300014968 Bacteria 5520
123 Ga0157376_10020248 3300014969 Bacteria 5142
124 Ga0183361_10002 3300016635 Bacteria 907642
125 Ga0163161_10015050 3300017792 Bacteria 5391
126 Ga0206349_1584086 3300020075 Bacteria 5166
127 Ga0206351_10081535 3300020077 Bacteria 5225
128 Ga0206352_10921183 3300020078 Bacteria 1627
129 Ga0206350_10392259 3300020080 Bacteria 5265
130 Ga0154015_1119340 3300020610 Bacteria 2312
131 Ga0213872_10001065 3300021361 Bacteria 18985
132 Ga0213872_10018027 3300021361 Bacteria 3257
133 Ga0213876_10013098 3300021384 Bacteria 4406
134 Ga0213875_10006323 3300021388 Bacteria 6234
135 Ga0213875_10025939 3300021388 Bacteria 2789
136 Ga0213871_10009286 3300021441 Bacteria 2199
137 Ga0213871_10014233 3300021441 Bacteria 1884
138 Ga0224712_10001857 3300022467 Bacteria 5068
139 Ga0224712_10037198 3300022467 Bacteria 1810
140 Ga0209674_100165 3300025226 Bacteria 86006
141 Ga0209672_100015 3300025228 Bacteria 529352
142 Ga0209672_100329 3300025228 Bacteria 30814
143 Ga0209147_100016 3300025229 Bacteria 527606
144 Ga0209147_100102 3300025229 Bacteria 159415
145 Ga0209563_100137 3300025230 Bacteria 87321
146 Ga0209258_100026 3300025242 Bacteria 527606
147 Ga0209258_100131 3300025242 Bacteria 175316
148 Ga0209677_100124 3300025253 Bacteria 79576
149 Ga0209148_1000130 3300025254 Bacteria 175316
150 Ga0209759_1005773 3300025256 Bacteria 4259
151 Ga0209233_1005216 3300025261 Bacteria 4336
152 Ga0209565_1007238 3300025263 Bacteria 3013
153 Ga0209455_1000118 3300025272 Bacteria 175316
154 Ga0209455_1001611 3300025272 Bacteria 9901
155 Ga0209673_1000028 3300025273 Bacteria 358901
156 Ga0209673_1001486 3300025273 Bacteria 21871
157 Ga0209673_1004990 3300025273 Bacteria 6878
158 Ga0209675_1000344 3300025291 Bacteria 40566
159 Ga0209675_1007946 3300025291 Bacteria 3972
160 Ga0209676_1023870 3300025292 Bacteria 1993
161 Ga0209025_1000016 3300025294 Bacteria 770739
162 Ga0209025_1003251 3300025294 Bacteria 15657
163 Ga0209564_1000035 3300025295 Bacteria 442446
164 Ga0209564_1000075 3300025295 Bacteria 285760
165 Ga0209564_1000416 3300025295 Bacteria 74830
166 Ga0209564_1005738 3300025295 Bacteria 6936
167 Ga0209564_1006664 3300025295 Bacteria 6157
168 Ga0209758_1013592 3300025297 Bacteria 4419
169 Ga0209256_1000025 3300025299 Bacteria 442449
170 Ga0209256_1000550 3300025299 Bacteria 53839
171 Ga0209256_1000905 3300025299 Bacteria 36349
172 Ga0207426_1014878 3300025302 Bacteria 2843
173 Ga0207426_1039171 3300025302 Bacteria 1487
174 Ga0209051_1001060 3300025303 Bacteria 25669
175 Ga0209051_1024135 3300025303 Bacteria 2509
176 Ga0209051_1030890 3300025303 Bacteria 2071
177 Ga0209257_1031842 3300025304 Bacteria 1680
178 Ga0207696_1012840 3300025711 Bacteria 2946
179 Ga0207692_10002901 3300025898 Bacteria 6637
180 Ga0207642_10044013 3300025899 Bacteria 1973
181 Ga0207647_10011633 3300025904 Bacteria 6163
182 Ga0207647_10026393 3300025904 Bacteria 3802
183 Ga0207699_10000754 3300025906 Bacteria 15470
184 Ga0207705_10012230 3300025909 Bacteria 6201
185 Ga0207695_10002981 3300025913 Bacteria 24373
186 Ga0207671_10013869 3300025914 Bacteria 6400
187 Ga0207693_10009137 3300025915 Bacteria 8092
188 Ga0207663_10007888 3300025916 Bacteria 5552
189 Ga0207660_10151804 3300025917 Bacteria 1780
190 Ga0207657_10000119 3300025919 Bacteria 78609
191 Ga0207657_10008994 3300025919 Bacteria 10086
192 Ga0207649_10097855 3300025920 Bacteria 1935
193 Ga0207694_10005838 3300025924 Bacteria 9438
194 Ga0207694_10021382 3300025924 Bacteria 4903
195 Ga0207700_10001387 3300025928 Bacteria 13762
196 Ga0207644_10111691 3300025931 Bacteria 2067
197 Ga0207690_10000008 3300025932 Bacteria 366090
198 Ga0207686_10037878 3300025934 Bacteria 2913
199 Ga0207709_10000074 3300025935 Bacteria 174947
200 Ga0207709_10062653 3300025935 Bacteria 2328
201 Ga0207670_10255565 3300025936 Bacteria 1356
202 Ga0207665_10013874 3300025939 Bacteria 5299
203 Ga0207711_10026953 3300025941 Bacteria 4824
204 Ga0207689_10173613 3300025942 Bacteria 1777
205 Ga0207661_10178732 3300025944 Bacteria 1852
206 Ga0207667_10013144 3300025949 Bacteria 9496
207 Ga0207658_10071944 3300025986 Bacteria 2620
208 Ga0207703_10084652 3300026035 Bacteria 2652
209 Ga0207678_10000527 3300026067 Bacteria 34787
210 Ga0207678_10012566 3300026067 Bacteria 7440
211 Ga0207708_10186897 3300026075 Bacteria 1647
212 Ga0207702_10343650 3300026078 Bacteria 1426
213 Ga0207641_10010003 3300026088 Bacteria 7802
214 Ga0207676_10024053 3300026095 Bacteria 4503
215 Ga0207674_10210404 3300026116 Bacteria 1894
216 Ga0207675_100016350 3300026118 Bacteria 6925
217 Ga0207675_100036605 3300026118 Bacteria 4577
218 Ga0207675_100037536 3300026118 Bacteria 4519
219 Ga0207683_10011219 3300026121 Bacteria 7637
220 Ga0207698_10094294 3300026142 Bacteria 2460
221 Ga0209281_1000005 3300027111 Bacteria 1242284
222 Ga0209281_1000129 3300027111 Bacteria 194490
223 Ga0209281_1002284 3300027111 Bacteria 8068
224 Ga0209371_1000431 3300027312 Bacteria 42664
225 Ga0209813_10000617 3300027866 Bacteria 8297
226 Ga0207428_10000050 3300027907 Bacteria 177286
227 Ga0268266_10036319 3300028379 Bacteria 4193
228 Ga0268266_10093119 3300028379 Bacteria 2644
229 Ga0268264_10144969 3300028381 Bacteria 2122
230 Ga0268256_1000370 3300030500 Bacteria 42664
231 Ga0265332_10001024 3300031238 Bacteria 16483
232 Ga0265328_10000118 3300031239 Bacteria 37735
233 Ga0265328_10014711 3300031239 Bacteria 3076
234 Ga0265325_10000488 3300031241 Bacteria 28779
235 Ga0265325_10032012 3300031241 Bacteria 2811
236 Ga0265340_10027132 3300031247 Bacteria 2888
237 Ga0265339_10001333 3300031249 Bacteria 18457
238 Ga0265339_10002468 3300031249 Bacteria 13229
239 Ga0265331_10010642 3300031250 Bacteria 5077
240 Ga0265327_10000356 3300031251 Bacteria 87168
241 Ga0265327_10005102 3300031251 Bacteria 11167
242 Ga0265316_10019397 3300031344 Bacteria 5819
243 Ga0265316_10058419 3300031344 Bacteria 3005
244 Ga0265316_10148737 3300031344 Bacteria 1755
245 Ga0265316_10152977 3300031344 Bacteria 1728
246 Ga0265313_10001139 3300031595 Bacteria 25409
247 Ga0265313_10002551 3300031595 Bacteria 15587
248 Ga0265313_10059630 3300031595 Bacteria 1794
249 Ga0265313_10116192 3300031595 Bacteria 1171
250 Ga0265314_10129305 3300031711 Bacteria 1578
251 Ga0265342_10000039 3300031712 Bacteria 140091
252 Ga0307406_10019386 3300031901 Bacteria 3991
253 Ga0307414_10004415 3300032004 Bacteria 7640
254 Ga0373925_0128432 3300037068 Bacteria 1974
255 Ga0395899_0047668 3300037312 Bacteria 3189
256 Ga0395900_0076322 3300037418 Bacteria 3444
257 Ga0395898_0008192 3300037466 Bacteria 11056
258 Ga0436364_0222040 3300037853 Bacteria 3131
259 Ga0436364_1330136 3300037853 Bacteria 1911
260 Ga0436364_1508438 3300037853 Bacteria 17040
261 Ga0395901_0097857 3300038443 Bacteria 3076
262 Ga0395901_0170396 3300038443 Bacteria 2284
263 Ga0436365_0152513 3300039437 Bacteria 5120
264 Ga0436365_0760767 3300039437 Bacteria 27378
265 Ga0436365_1077690 3300039437 Bacteria 1805
266 Ga0436360_0369616 3300039438 Bacteria 1897
267 Ga0436360_0767206 3300039438 Bacteria 5870
268 Ga0436360_1297757 3300039438 Bacteria 1255
269 Ga0436361_0404369 3300039447 Bacteria 8973
270 Ga0436361_0651128 3300039447 Bacteria 3976
271 Ga0436361_1212122 3300039447 Bacteria 1180
272 Ga0436363_1337362 3300039450 Bacteria 1511
273 Ga0439436_0000063 3300041404 Bacteria 29794
274 Ga0439436_0003002 3300041404 Bacteria 5120
275 Ga0439438_004298 3300041405 Bacteria 5515
276 Ga0439447_003715 3300041407 Bacteria 5377
277 Ga0439466_0013734 3300041411 Bacteria 2962
278 Ga0439465_0000670 3300041413 Bacteria 10457
279 Ga0451802_0628774 3300041460 Bacteria 815
280 Ga0439432_000816 3300042006 Bacteria 11609
281 Ga0439432_045745 3300042006 Bacteria 1376
282 Ga0439434_0000608 3300042435 Bacteria 10307
283 Ga0439464_0000683 3300042439 Bacteria 7336
284 Ga0451577_0000194 3300042876 Bacteria 127614
285 Ga0453684_0000218 3300044712 Bacteria 250267
286 Ga0453684_0072013 3300044712 Bacteria 4366
287 Ga0466968_0056416 3300044735 Bacteria 1687
288 Ga0466960_0018190 3300044901 Bacteria 3076
289 Ga0451576_0088576 3300045051 Bacteria 3220
290 Ga0466967_0418783 3300045976 Bacteria 1305
291 Ga0495617_000304 3300046452 Bacteria 27738
292 Ga0495617_026219 3300046452 Bacteria 1962
293 Ga0495603_0010738 3300046455 Bacteria 5554
294 Ga0495590_0003022 3300046457 Bacteria 6894
295 Ga0495629_0023675 3300046459 Bacteria 4374
296 Ga0495638_0000543 3300046460 Bacteria 43505
297 Ga0495638_0041599 3300046460 Bacteria 2906
298 Ga0495638_0097684 3300046460 Bacteria 1760
299 Ga0495641_0105352 3300046461 Bacteria 1258
300 Ga0495651_0024083 3300046462 Bacteria 4736
301 Ga0495653_0001022 3300046463 Bacteria 21574
302 Ga0495653_0275462 3300046463 Bacteria 1106
303 Ga0495650_0000233 3300046471 Bacteria 113132
304 Ga0495580_0000974 3300046472 Bacteria 25086
305 Ga0495580_0003791 3300046472 Bacteria 12807
306 Ga0495580_0020079 3300046472 Bacteria 4952
307 Ga0495582_0010082 3300046473 Bacteria 5203
308 Ga0495605_0003199 3300046474 Bacteria 9823
309 Ga0495664_0008848 3300046477 Bacteria 5625
310 Ga0495596_0001934 3300046500 Bacteria 11460
311 Ga0495607_0034214 3300046501 Bacteria 3084
312 Ga0495606_0000333 3300046507 Bacteria 81527
313 Ga0495606_0000719 3300046507 Bacteria 51243
314 Ga0495606_0001577 3300046507 Bacteria 29881
315 Ga0495606_0015127 3300046507 Bacteria 5968
316 Ga0495606_0036569 3300046507 Bacteria 3342
317 Ga0495608_0228888 3300046511 Bacteria 1164
318 Ga0495610_0002695 3300046512 Bacteria 14636
319 Ga0495610_0021549 3300046512 Bacteria 3541
320 Ga0495616_0000001 3300046513 Bacteria 780061
321 Ga0495616_0124197 3300046513 Bacteria 1188
322 Ga0495618_0023790 3300046514 Bacteria 3792
323 Ga0495628_0000457 3300046516 Bacteria 37378
324 Ga0495630_0008398 3300046517 Bacteria 7405
325 Ga0495630_0009099 3300046517 Bacteria 7139
326 Ga0495630_0025307 3300046517 Bacteria 4387
327 Ga0495637_0041677 3300046520 Bacteria 1968
328 Ga0495643_0086119 3300046522 Bacteria 1628
329 Ga0495648_0005071 3300046524 Bacteria 11053
330 Ga0495648_0013506 3300046524 Bacteria 6031
331 Ga0495666_0000229 3300046526 Bacteria 23906
332 Ga0495642_0021528 3300046528 Bacteria 2536
333 Ga0495652_0032536 3300046529 Bacteria 4560
334 Ga0495652_0035435 3300046529 Bacteria 4343
335 Ga0495652_0181889 3300046529 Bacteria 1612
336 Ga0495654_0000757 3300046530 Bacteria 25005
337 Ga0495665_0000139 3300046531 Bacteria 35407
338 Ga0495640_0029472 3300046533 Bacteria 3941
339 Ga0495640_0036212 3300046533 Bacteria 3487
340 Ga0495640_0038965 3300046533 Bacteria 3339
341 Ga0495586_0000124 3300046535 Bacteria 47092
342 Ga0495587_0007614 3300046536 Bacteria 7009
343 Ga0495609_0006102 3300046538 Bacteria 6199
344 Ga0495597_0000065 3300046542 Bacteria 90745
345 Ga0495645_0024538 3300046543 Bacteria 4376
346 Ga0495622_0000286 3300046557 Bacteria 38555
347 Ga0495622_0084620 3300046557 Bacteria 1459
348 Ga0495656_0166196 3300046615 Bacteria 1075
349 Ga0495634_0006812 3300046642 Bacteria 8648
350 Ga0495611_0059974 3300046648 Bacteria 1728
351 Ga0495635_0050538 3300046663 Bacteria 2866
352 Ga0495635_0214034 3300046663 Bacteria 1305
353 Ga0495661_0021441 3300046665 Bacteria 4212
354 Ga0495657_0142180 3300046675 Bacteria 1495
355 Ga0495599_0018796 3300046678 Bacteria 4308
356 Ga0495599_0044958 3300046678 Bacteria 2768
357 Ga0495599_0090113 3300046678 Bacteria 1914
358 Ga0495623_0061820 3300046679 Bacteria 2348
359 Ga0495646_0053956 3300046680 Bacteria 2420
360 Ga0495613_0007348 3300046689 Bacteria 8208
361 Ga0495624_0001510 3300046690 Bacteria 18034
362 Ga0495624_0102119 3300046690 Bacteria 1765
363 Ga0495649_0029721 3300046694 Bacteria 3020
364 Ga0495649_0101146 3300046694 Bacteria 1532
365 Ga0495589_0000999 3300046794 Bacteria 17183
366 Ga0495589_0003525 3300046794 Bacteria 8464
367 Ga0495660_0000009 3300046810 Bacteria 427395
368 Ga0495581_0065243 3300047315 Bacteria 2105
369 Ga0495604_0017449 3300047317 Bacteria 5746
370 Ga0495636_0114764 3300047318 Bacteria 1187
371 Ga0495674_0035238 3300047319 Bacteria 4516
372 Ga0495674_0053430 3300047319 Bacteria 3551
373 Ga0495674_0087965 3300047319 Bacteria 2658
374 Ga0495674_0198903 3300047319 Bacteria 1663
375 Ga0495672_0002041 3300047320 Bacteria 19000
376 Ga0495672_0003022 3300047320 Bacteria 14796
377 Ga0495672_0080585 3300047320 Bacteria 1815
378 Ga0495672_0083748 3300047320 Bacteria 1770
379 Ga0495676_0025328 3300047321 Bacteria 5124
380 Ga0495680_0001071 3300047322 Bacteria 30324
381 Ga0495680_0045674 3300047322 Bacteria 3458
382 Ga0495683_0029742 3300047323 Bacteria 2790
383 Ga0495683_0068638 3300047323 Bacteria 1743
384 Ga0495675_0072040 3300047444 Bacteria 2180
385 Ga0495675_0075569 3300047444 Bacteria 2123
386 Ga0495679_000001 3300047446 Bacteria 1607568
387 Ga0495679_000269 3300047446 Bacteria 43503
388 Ga0495673_0000001 3300047469 Bacteria 1630730
389 Ga0495673_0000089 3300047469 Bacteria 188744
390 Ga0495681_0145019 3300047470 Bacteria 1000
391 Ga0495684_0051601 3300047471 Bacteria 3139
392 Ga0495684_0227409 3300047471 Bacteria 1365
393 Ga0495686_0000045 3300047472 Bacteria 284761
394 Ga0495686_0000321 3300047472 Bacteria 79813
395 Ga0495602_0000446 3300048088 Bacteria 38693
396 Ga0495602_0267021 3300048088 Bacteria 1266
397 Ga0495614_0000125 3300048089 Bacteria 26649
398 Ga0495614_0056469 3300048089 Bacteria 1685
399 Ga0496100_0013286 3300048903 Bacteria 4743
400 Ga0496101_0051174 3300048904 Bacteria 2975
401 Ga0496102_0135761 3300048905 Bacteria 2305
402 Ga0496102_0568263 3300048905 Bacteria 1057
403 Ga0496103_0025457 3300048906 Bacteria 3576
404 Ga0496104_0000509 3300048907 Bacteria 33320
405 Ga0496104_0010540 3300048907 Bacteria 8255
406 Ga0496104_0010728 3300048907 Bacteria 8193
407 Ga0496104_0060641 3300048907 Bacteria 3584
408 Ga0496105_0000091 3300048908 Bacteria 63179
409 Ga0496105_0000906 3300048908 Bacteria 20196
410 Ga0496105_0003091 3300048908 Bacteria 12242
411 Ga0496105_0010403 3300048908 Bacteria 7316
412 Ga0496106_0124069 3300048909 Bacteria 2021
413 Ga0496108_0012799 3300048911 Bacteria 6831
414 Ga0496109_0008764 3300048912 Bacteria 8612
415 Ga0496110_0007154 3300048913 Bacteria 8885
416 Ga0496110_0072664 3300048913 Bacteria 3052
417 Ga0496111_0003166 3300048914 Bacteria 10136
418 Ga0496112_0020333 3300048915 Bacteria 6290
419 Ga0496112_0059720 3300048915 Bacteria 3757
420 Ga0496113_0019272 3300048916 Bacteria 4769
421 Ga0496114_0004934 3300048917 Bacteria 10398
422 Ga0496114_0504277 3300048917 Bacteria 1070
423 Ga0496115_0069522 3300048918 Bacteria 2852
424 Ga0496116_0001200 3300048919 Bacteria 30339
425 Ga0496116_0005406 3300048919 Bacteria 11880
426 Ga0496116_0007420 3300048919 Bacteria 9732
427 Ga0496117_0009484 3300048920 Bacteria 9048
428 Ga0496117_0013937 3300048920 Bacteria 6967
429 Ga0496117_0115524 3300048920 Bacteria 1661
430 Ga0496118_0001748 3300048921 Bacteria 31538
431 Ga0496118_0015654 3300048921 Bacteria 7005
432 Ga0496118_0017892 3300048921 Bacteria 6429
433 Ga0496119_0001353 3300048922 Bacteria 29962
434 Ga0496119_0001827 3300048922 Bacteria 24654
435 Ga0496119_0002209 3300048922 Bacteria 21740
436 Ga0496119_0018135 3300048922 Bacteria 5256
437 Ga0496119_0259249 3300048922 Bacteria 873
438 Ga0496121_0001280 3300048924 Bacteria 43316
439 Ga0496121_0024603 3300048924 Bacteria 5751
440 Ga0496121_0032632 3300048924 Bacteria 4730
441 Ga0496122_0018190 3300048925 Bacteria 6507
442 Ga0496122_0192354 3300048925 Bacteria 1202
443 Ga0496123_0000625 3300048926 Bacteria 59349
444 Ga0496123_0015321 3300048926 Bacteria 6296
445 Ga0496123_0072936 3300048926 Bacteria 2132
446 Ga0496124_0005319 3300048927 Bacteria 14551
447 Ga0496125_0002186 3300048928 Bacteria 26107
448 Ga0496125_0004081 3300048928 Bacteria 17082
449 Ga0496125_0043289 3300048928 Bacteria 3824
450 Ga0496125_0045080 3300048928 Bacteria 3717
451 Ga0496125_0110937 3300048928 Bacteria 1987
452 Ga0496126_0019890 3300048929 Bacteria 6601
453 Ga0496126_0201790 3300048929 Bacteria 1679
454 Ga0496126_0240291 3300048929 Bacteria 1513
455 Ga0495678_000023 3300049459 Bacteria 233463
456 Ga0495678_070942 3300049459 Bacteria 1277
457 Ga0495682_0007907 3300049460 Bacteria 4206
458 Ga0501032_0028255 3300049569 Bacteria 3854
459 Ga0501033_0018284 3300049570 Bacteria 5296
460 Ga0501034_0090764 3300049571 Bacteria 3052
461 Ga0501037_0174627 3300049573 Bacteria 1526
462 Ga0501038_0027633 3300049574 Bacteria 5046
463 Ga0501039_0239208 3300049575 Bacteria 1428
464 Ga0501042_0028477 3300049578 Bacteria 3936
465 Ga0501043_0028881 3300049579 Bacteria 4353
466 Ga0501047_0006980 3300049581 Bacteria 10603
467 Ga0501067_0035046 3300049583 Bacteria 2786
468 Ga0501070_0104901 3300049586 Bacteria 2337
469 Ga0501073_0009227 3300049589 Bacteria 7273
470 Ga0501076_0015016 3300049592 Bacteria 5848
471 Ga0501238_005774 3300049671 Bacteria 1579
472 Ga0501249_011278 3300049679 Bacteria 1874
473 Ga0501080_0095752 3300049742 Bacteria 2756
474 Ga0501269_000055 3300049766 Bacteria 34934
475 Ga0501035_0008241 3300049822 Bacteria 9710
476 Ga0501044_0041463 3300049823 Bacteria 4792
477 Ga0501044_0295134 3300049823 Bacteria 1551
478 nmdc:mga03683_10012_c1 3300050489 Bacteria 3388
479 nmdc:mga03n38_1083_c1 3300050490 Bacteria 7512
480 nmdc:mga00v17_240_c1 3300050491 Bacteria 32452
481 nmdc:mga00v17_48410_c1 3300050491 Bacteria 2577
482 nmdc:mga0k408_16176_c1 3300050493 Bacteria 4136
483 nmdc:mga06z11_32565_c1 3300050494 Bacteria 2047
484 nmdc:mga06z11_43415_c1 3300050494 Bacteria 2262
485 nmdc:mga07m45_87811_c1 3300050496 Bacteria 1779
486 nmdc:mga08y16_554145_c1 3300050511 Bacteria 1163
487 nmdc:mga08y16_56_c1 3300050511 Bacteria 99587
488 nmdc:mga0sz30_10525_c1 3300050516 Bacteria 3549
489 nmdc:mga0sz30_50820_c1 3300050516 Bacteria 1758
490 nmdc:mga0sz30_88842_c1 3300050516 Bacteria 1343
491 Ga0500643_000002 3300053087 Bacteria 1277657
492 Ga0500643_007159 3300053087 Bacteria 4559
493 Ga0500644_0000829 3300053088 Bacteria 10425
494 Ga0500651_0033392 3300053093 Bacteria 3245
495 Ga0500556_0000327 3300053104 Bacteria 35744
496 Ga0500562_003035 3300053108 Bacteria 4194
497 Ga0500595_000078 3300053119 Bacteria 68089
498 Ga0500642_0000005 3300053130 Bacteria 422725
499 Ga0500652_001106 3300053131 Bacteria 8687
500 Ga0500652_016222 3300053131 Bacteria 2706
501 Ga0500652_020783 3300053131 Bacteria 2462
502 Ga0500574_000170 3300053141 Bacteria 7649
503 Ga0500616_0000006 3300053153 Bacteria 944738
504 Ga0500645_000486 3300053730 Bacteria 26878
505 Ga0500645_006022 3300053730 Bacteria 4377
506 Ga0500645_014691 3300053730 Bacteria 2491
507 Ga0587082_002216 3300059504 Bacteria 2159
508 Ga0587085_002115 3300059506 Bacteria 1986
509 Ga0530510_0202180 3300061734 Bacteria 1476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041460 Ga0451802_0628774 Ga0451802_0628774_22_780 248
2 3300046460 Ga0495638_0041599 Ga0495638_0041599_43_831 250
3 3300046517 Ga0495630_0009099 Ga0495630_0009099_44_832 250
4 3300048905 Ga0496102_0568263 Ga0496102_0568263_224_988 250
5 3300048920 Ga0496117_0115524 Ga0496117_0115524_34_789 250
6 3300048922 Ga0496119_0259249 Ga0496119_0259249_97_852 250
7 3300048924 Ga0496121_0024603 Ga0496121_0024603_2195_3028 250
8 3300049573 Ga0501037_0174627 Ga0501037_0174627_731_1510 254
9 3300046501 Ga0495607_0034214 Ga0495607_0034214_2279_3058 256
10 3300046615 Ga0495656_0166196 Ga0495656_0166196_257_1036 256
11 3300047318 Ga0495636_0114764 Ga0495636_0114764_20_808 256
12 3300050516 nmdc:mga0sz30_88842_c1 nmdc:mga0sz30_88842_c1_17_877 257
13 3300007788 Ga0099795_10005699 Ga0099795_100056992 264
14 3300039438 Ga0436360_1297757 Ga0436360_1297757_319_1158 266
15 3300050494 nmdc:mga06z11_32565_c1 nmdc:mga06z11_32565_c1_43_858 266
16 3300025303 Ga0209051_1024135 Ga0209051_10241352 269
17 3300050511 nmdc:mga08y16_554145_c1 nmdc:mga08y16_554145_c1_309_1139 271
18 3300047471 Ga0495684_0227409 Ga0495684_0227409_15_887 272
19 3300003790 Ga0055528_1013940 Ga0055528_10139403 275
20 3300025273 Ga0209673_1001486 Ga0209673_100148611 275
21 3300025295 Ga0209564_1000416 Ga0209564_100041637 275
22 3300025299 Ga0209256_1000550 Ga0209256_100055013 275
23 3300048907 Ga0496104_0010540 Ga0496104_0010540_4061_5035 275
24 3300048908 Ga0496105_0000906 Ga0496105_0000906_14656_15630 275
25 3300048909 Ga0496106_0124069 Ga0496106_0124069_846_1820 275
26 3300048913 Ga0496110_0007154 Ga0496110_0007154_7145_8119 275
27 3300048919 Ga0496116_0007420 Ga0496116_0007420_7883_8857 275
28 3300048922 Ga0496119_0002209 Ga0496119_0002209_7117_8091 275
29 3300048928 Ga0496125_0002186 Ga0496125_0002186_16128_17102 275
30 3300049592 Ga0501076_0015016 Ga0501076_0015016_4983_5822 275
31 3300005331 Ga0070670_100034614 Ga0070670_1000346144 276
32 3300005337 Ga0070682_100029203 Ga0070682_1000292033 276
33 3300005340 Ga0070689_100075032 Ga0070689_1000750323 276
34 3300005355 Ga0070671_100112679 Ga0070671_1001126793 276
35 3300005365 Ga0070688_100013086 Ga0070688_1000130863 276
36 3300005367 Ga0070667_100056722 Ga0070667_1000567223 276
37 3300005455 Ga0070663_100030959 Ga0070663_1000309592 276
38 3300005456 Ga0070678_100034522 Ga0070678_1000345222 276
39 3300005548 Ga0070665_100088128 Ga0070665_1000881284 276
40 3300005617 Ga0068859_100161848 Ga0068859_1001618482 276
41 3300005842 Ga0068858_100023351 Ga0068858_1000233513 276
42 3300006186 Ga0075369_10035938 Ga0075369_100359382 276
43 3300006931 Ga0097620_100161847 Ga0097620_1001618472 276
44 3300009098 Ga0105245_10027864 Ga0105245_100278643 276
45 3300009148 Ga0105243_10048621 Ga0105243_100486212 276
46 3300009551 Ga0105238_10129024 Ga0105238_101290243 276
47 3300013306 Ga0163162_10026365 Ga0163162_100263653 276
48 3300013308 Ga0157375_10049410 Ga0157375_100494103 276
49 3300021384 Ga0213876_10013098 Ga0213876_100130981 276
50 3300025935 Ga0207709_10062653 Ga0207709_100626532 276
51 3300025936 Ga0207670_10255565 Ga0207670_102555652 276
52 3300025942 Ga0207689_10173613 Ga0207689_101736133 276
53 3300025986 Ga0207658_10071944 Ga0207658_100719443 276
54 3300026035 Ga0207703_10084652 Ga0207703_100846522 276
55 3300026067 Ga0207678_10012566 Ga0207678_100125662 276
56 3300026078 Ga0207702_10343650 Ga0207702_103436502 276
57 3300026121 Ga0207683_10011219 Ga0207683_100112193 276
58 3300028379 Ga0268266_10036319 Ga0268266_100363194 276
59 3300028381 Ga0268264_10144969 Ga0268264_101449692 276
60 3300013306 Ga0163162_10876046 Ga0163162_108760461 277
61 3300039437 Ga0436365_0760767 Ga0436365_0760767_13937_14836 277
62 3300046507 Ga0495606_0015127 Ga0495606_0015127_1569_2540 277
63 3300047470 Ga0495681_0145019 Ga0495681_0145019_126_968 277
64 3300046463 Ga0495653_0275462 Ga0495653_0275462_26_898 278
65 3300046528 Ga0495642_0021528 Ga0495642_0021528_1633_2505 278
66 3300005434 Ga0070709_10003505 Ga0070709_100035051 279
67 3300005435 Ga0070714_100055792 Ga0070714_1000557921 279
68 3300005436 Ga0070713_100004851 Ga0070713_1000048514 279
69 3300005437 Ga0070710_10002012 Ga0070710_100020127 279
70 3300005439 Ga0070711_100010930 Ga0070711_1000109304 279
71 3300005564 Ga0070664_100009118 Ga0070664_1000091183 279
72 3300005841 Ga0068863_100058324 Ga0068863_1000583242 279
73 3300006028 Ga0070717_10006158 Ga0070717_100061586 279
74 3300006163 Ga0070715_10001469 Ga0070715_100014695 279
75 3300006173 Ga0070716_100007591 Ga0070716_1000075912 279
76 3300006175 Ga0070712_100022128 Ga0070712_1000221284 279
77 3300006237 Ga0097621_100011914 Ga0097621_1000119144 279
78 3300009174 Ga0105241_10256269 Ga0105241_102562692 279
79 3300009177 Ga0105248_10062722 Ga0105248_100627222 279
80 3300010375 Ga0105239_10637902 Ga0105239_106379021 279
81 3300011119 Ga0105246_10010435 Ga0105246_100104353 279
82 3300013297 Ga0157378_10014070 Ga0157378_100140704 279
83 3300014325 Ga0163163_10051675 Ga0163163_100516752 279
84 3300014968 Ga0157379_10023040 Ga0157379_100230404 279
85 3300014969 Ga0157376_10020248 Ga0157376_100202484 279
86 3300025898 Ga0207692_10002901 Ga0207692_100029015 279
87 3300025906 Ga0207699_10000754 Ga0207699_100007549 279
88 3300025915 Ga0207693_10009137 Ga0207693_100091376 279
89 3300025916 Ga0207663_10007888 Ga0207663_100078883 279
90 3300025920 Ga0207649_10097855 Ga0207649_100978552 279
91 3300025928 Ga0207700_10001387 Ga0207700_100013873 279
92 3300025931 Ga0207644_10111691 Ga0207644_101116912 279
93 3300025934 Ga0207686_10037878 Ga0207686_100378783 279
94 3300025939 Ga0207665_10013874 Ga0207665_100138742 279
95 3300025941 Ga0207711_10026953 Ga0207711_100269533 279
96 3300026088 Ga0207641_10010003 Ga0207641_100100033 279
97 3300026095 Ga0207676_10024053 Ga0207676_100240534 279
98 3300048903 Ga0496100_0013286 Ga0496100_0013286_1920_2867 279
99 3300048904 Ga0496101_0051174 Ga0496101_0051174_825_1772 279
100 3300048906 Ga0496103_0025457 Ga0496103_0025457_825_1772 279
101 3300048907 Ga0496104_0010728 Ga0496104_0010728_7233_8180 279
102 3300048908 Ga0496105_0003091 Ga0496105_0003091_3235_4182 279
103 3300048911 Ga0496108_0012799 Ga0496108_0012799_2650_3597 279
104 3300048912 Ga0496109_0008764 Ga0496109_0008764_3177_4124 279
105 3300048913 Ga0496110_0072664 Ga0496110_0072664_729_1676 279
106 3300048914 Ga0496111_0003166 Ga0496111_0003166_3423_4370 279
107 3300048915 Ga0496112_0020333 Ga0496112_0020333_2109_3056 279
108 3300048917 Ga0496114_0004934 Ga0496114_0004934_156_1103 279
109 3300049578 Ga0501042_0028477 Ga0501042_0028477_2723_3616 279
110 3300038443 Ga0395901_0097857 Ga0395901_0097857_2099_3055 280
111 3300044712 Ga0453684_0072013 Ga0453684_0072013_96_983 280
112 3300046524 Ga0495648_0005071 Ga0495648_0005071_4575_5516 280
113 3300039447 Ga0436361_1212122 Ga0436361_1212122_40_900 281
114 iso_pu_bacteria 2842918807 2842920561 281
115 3300013104 Ga0157370_10056781 Ga0157370_100567812 282
116 3300013105 Ga0157369_10000801 Ga0157369_1000080131 282
117 3300046452 Ga0495617_000304 Ga0495617_000304_21848_22714 282
118 3300046460 Ga0495638_0000543 Ga0495638_0000543_32705_33571 282
119 3300046513 Ga0495616_0124197 Ga0495616_0124197_13_879 282
120 3300046520 Ga0495637_0041677 Ga0495637_0041677_456_1322 282
121 3300046794 Ga0495589_0000999 Ga0495589_0000999_7361_8227 282
122 3300046810 Ga0495660_0000009 Ga0495660_0000009_92774_93640 282
123 3300047446 Ga0495679_000001 Ga0495679_000001_549498_550364 282
124 3300047469 Ga0495673_0000001 Ga0495673_0000001_927062_927928 282
125 3300047469 Ga0495673_0000089 Ga0495673_0000089_155149_156015 282
126 3300048920 Ga0496117_0013937 Ga0496117_0013937_1066_1935 282
127 3300048921 Ga0496118_0001748 Ga0496118_0001748_25549_26418 282
128 3300048928 Ga0496125_0043289 Ga0496125_0043289_2747_3616 282
129 3300049459 Ga0495678_000023 Ga0495678_000023_203310_204176 282
130 3300049460 Ga0495682_0007907 Ga0495682_0007907_3039_3905 282
131 3300053087 Ga0500643_000002 Ga0500643_000002_758719_759585 282
132 3300053131 Ga0500652_020783 Ga0500652_020783_157_1023 282
133 3300021388 Ga0213875_10025939 Ga0213875_100259392 283
134 3300037853 Ga0436364_0222040 Ga0436364_0222040_750_1682 283
135 3300039437 Ga0436365_1077690 Ga0436365_1077690_494_1426 283
136 3300046472 Ga0495580_0003791 Ga0495580_0003791_4087_4950 283
137 3300046507 Ga0495606_0000333 Ga0495606_0000333_6277_7146 283
138 3300046513 Ga0495616_0000001 Ga0495616_0000001_161808_162677 283
139 3300046529 Ga0495652_0032536 Ga0495652_0032536_128_991 283
140 3300048089 Ga0495614_0056469 Ga0495614_0056469_527_1390 283
141 3300048924 Ga0496121_0001280 Ga0496121_0001280_31840_32709 283
142 3300048925 Ga0496122_0192354 Ga0496122_0192354_153_1016 283
143 3300048929 Ga0496126_0240291 Ga0496126_0240291_178_1041 283
144 3300005578 Ga0068854_100393449 Ga0068854_1003934492 284
145 3300005983 Ga0081540_1008986 Ga0081540_10089865 284
146 3300006038 Ga0075365_10153162 Ga0075365_101531622 284
147 3300006177 Ga0075362_10060156 Ga0075362_100601562 284
148 3300006195 Ga0075366_10031043 Ga0075366_100310433 284
149 3300014497 Ga0182008_10066558 Ga0182008_100665582 284
150 3300025302 Ga0207426_1039171 Ga0207426_10391712 284
151 3300050489 nmdc:mga03683_10012_c1 nmdc:mga03683_10012_c1_1663_2568 284
152 3300050493 nmdc:mga0k408_16176_c1 nmdc:mga0k408_16176_c1_2435_3340 284
153 3300005436 Ga0070713_100608241 Ga0070713_1006082411 285
154 3300041404 Ga0439436_0000063 Ga0439436_0000063_22010_22888 285
155 3300041413 Ga0439465_0000670 Ga0439465_0000670_3206_4084 285
156 3300042006 Ga0439432_045745 Ga0439432_045745_47_967 285
157 3300046694 Ga0495649_0029721 Ga0495649_0029721_488_1366 285
158 3300048922 Ga0496119_0018135 Ga0496119_0018135_2660_3538 285
159 3300047472 Ga0495686_0000045 Ga0495686_0000045_167863_168786 287
160 3300048917 Ga0496114_0504277 Ga0496114_0504277_29_907 287
161 3300031239 Ga0265328_10014711 Ga0265328_100147112 288
162 3300031250 Ga0265331_10010642 Ga0265331_100106425 288
163 3300031251 Ga0265327_10005102 Ga0265327_100051027 288
164 3300031344 Ga0265316_10148737 Ga0265316_101487372 288
165 3300037312 Ga0395899_0047668 Ga0395899_0047668_2062_2967 288
166 3300037466 Ga0395898_0008192 Ga0395898_0008192_6675_7580 288
167 3300038443 Ga0395901_0170396 Ga0395901_0170396_730_1635 288
168 3300045051 Ga0451576_0088576 Ga0451576_0088576_1485_2399 288
169 3300046542 Ga0495597_0000065 Ga0495597_0000065_1215_2156 288
170 3300047320 Ga0495672_0080585 Ga0495672_0080585_693_1598 289
171 3300003752 Ga0055539_1000180 Ga0055539_100018027 291
172 3300003756 Ga0055533_1000169 Ga0055533_100016917 291
173 3300003759 Ga0055525_1000526 Ga0055525_10005263 291
174 3300006946 Ga0079104_1000044 Ga0079104_100004497 291
175 3300021361 Ga0213872_10018027 Ga0213872_100180272 291
176 3300025226 Ga0209674_100165 Ga0209674_10016535 291
177 3300025230 Ga0209563_100137 Ga0209563_10013735 291
178 3300025253 Ga0209677_100124 Ga0209677_10012452 291
179 3300027111 Ga0209281_1000129 Ga0209281_100012975 291
180 3300039447 Ga0436361_0404369 Ga0436361_0404369_2086_3060 291
181 3300048924 Ga0496121_0032632 Ga0496121_0032632_322_1302 291
182 3300049459 Ga0495678_070942 Ga0495678_070942_284_1213 291
183 iso_pu_bacteria 2891633521 2891635126 291
184 3300005329 Ga0070683_100098939 Ga0070683_1000989392 292
185 3300005366 Ga0070659_100118667 Ga0070659_1001186672 292
186 3300005457 Ga0070662_100338561 Ga0070662_1003385612 292
187 3300005458 Ga0070681_10057743 Ga0070681_100577433 292
188 3300005530 Ga0070679_100050981 Ga0070679_1000509812 292
189 3300005539 Ga0068853_100053311 Ga0068853_1000533113 292
190 3300005563 Ga0068855_100022819 Ga0068855_1000228194 292
191 3300005577 Ga0068857_100101065 Ga0068857_1001010652 292
192 3300005983 Ga0081540_1000114 Ga0081540_100011446 292
193 3300013100 Ga0157373_10007320 Ga0157373_100073204 292
194 3300013105 Ga0157369_10013180 Ga0157369_100131807 292
195 3300025297 Ga0209758_1013592 Ga0209758_10135922 292
196 3300025302 Ga0207426_1014878 Ga0207426_10148782 292
197 3300025904 Ga0207647_10026393 Ga0207647_100263932 292
198 3300025909 Ga0207705_10012230 Ga0207705_100122303 292
199 3300025917 Ga0207660_10151804 Ga0207660_101518042 292
200 3300025919 Ga0207657_10008994 Ga0207657_100089947 292
201 3300025944 Ga0207661_10178732 Ga0207661_101787322 292
202 3300026116 Ga0207674_10210404 Ga0207674_102104042 292
203 3300041404 Ga0439436_0003002 Ga0439436_0003002_3815_4741 292
204 3300041405 Ga0439438_004298 Ga0439438_004298_1932_2858 292
205 3300041407 Ga0439447_003715 Ga0439447_003715_2678_3604 292
206 3300042006 Ga0439432_000816 Ga0439432_000816_7130_8056 292
207 3300042435 Ga0439434_0000608 Ga0439434_0000608_4364_5290 292
208 3300045976 Ga0466967_0418783 Ga0466967_0418783_394_1293 292
209 3300046462 Ga0495651_0024083 Ga0495651_0024083_3627_4559 292
210 3300046472 Ga0495580_0000974 Ga0495580_0000974_1815_2747 292
211 3300046517 Ga0495630_0008398 Ga0495630_0008398_184_1116 292
212 3300046529 Ga0495652_0181889 Ga0495652_0181889_592_1524 292
213 3300046675 Ga0495657_0142180 Ga0495657_0142180_282_1214 292
214 3300046678 Ga0495599_0044958 Ga0495599_0044958_157_1089 292
215 3300046690 Ga0495624_0001510 Ga0495624_0001510_1665_2597 292
216 3300047322 Ga0495680_0045674 Ga0495680_0045674_946_1878 292
217 3300047444 Ga0495675_0075569 Ga0495675_0075569_430_1362 292
218 3300048088 Ga0495602_0267021 Ga0495602_0267021_184_1116 292
219 3300053131 Ga0500652_016222 Ga0500652_016222_1224_2162 292
220 3300059506 Ga0587085_002115 Ga0587085_002115_272_1174 292
221 3300004799 Ga0058863_11912999 Ga0058863_119129992 293
222 3300004801 Ga0058860_11973371 Ga0058860_119733712 293
223 3300005289 Ga0065704_10222936 Ga0065704_102229361 293
224 3300005290 Ga0065712_10003363 Ga0065712_100033633 293
225 3300005436 Ga0070713_100199091 Ga0070713_1001990912 293
226 3300005444 Ga0070694_100022736 Ga0070694_1000227363 293
227 3300005466 Ga0070685_10145974 Ga0070685_101459742 293
228 3300005536 Ga0070697_100572695 Ga0070697_1005726951 293
229 3300005545 Ga0070695_100005596 Ga0070695_1000055964 293
230 3300005548 Ga0070665_100106568 Ga0070665_1001065684 293
231 3300005719 Ga0068861_100008454 Ga0068861_1000084544 293
232 3300005719 Ga0068861_100106711 Ga0068861_1001067113 293
233 3300005844 Ga0068862_100008291 Ga0068862_1000082912 293
234 3300005983 Ga0081540_1000080 Ga0081540_100008023 293
235 3300005983 Ga0081540_1029164 Ga0081540_10291642 293
236 3300006042 Ga0075368_10011432 Ga0075368_100114324 293
237 3300006048 Ga0075363_100003699 Ga0075363_1000036995 293
238 3300006871 Ga0075434_100247029 Ga0075434_1002470292 293
239 3300009147 Ga0114129_10042279 Ga0114129_100422792 293
240 3300009551 Ga0105238_10003753 Ga0105238_1000375317 293
241 3300013306 Ga0163162_10209936 Ga0163162_102099363 293
242 3300013307 Ga0157372_10110193 Ga0157372_101101933 293
243 3300014326 Ga0157380_10310806 Ga0157380_103108062 293
244 3300017792 Ga0163161_10015050 Ga0163161_100150504 293
245 3300020078 Ga0206352_10921183 Ga0206352_109211831 293
246 3300021441 Ga0213871_10009286 Ga0213871_100092862 293
247 3300022467 Ga0224712_10037198 Ga0224712_100371982 293
248 3300025261 Ga0209233_1005216 Ga0209233_10052162 293
249 3300025924 Ga0207694_10021382 Ga0207694_100213823 293
250 3300026075 Ga0207708_10186897 Ga0207708_101868972 293
251 3300026118 Ga0207675_100016350 Ga0207675_1000163504 293
252 3300026118 Ga0207675_100037536 Ga0207675_1000375362 293
253 3300027866 Ga0209813_10000617 Ga0209813_100006176 293
254 3300028379 Ga0268266_10093119 Ga0268266_100931192 293
255 3300031238 Ga0265332_10001024 Ga0265332_1000102415 293
256 3300031241 Ga0265325_10032012 Ga0265325_100320122 293
257 3300031247 Ga0265340_10027132 Ga0265340_100271322 293
258 3300031249 Ga0265339_10002468 Ga0265339_100024683 293
259 3300031595 Ga0265313_10116192 Ga0265313_101161922 293
260 3300031711 Ga0265314_10129305 Ga0265314_101293052 293
261 3300031712 Ga0265342_10000039 Ga0265342_1000003943 293
262 3300039438 Ga0436360_0767206 Ga0436360_0767206_1377_2315 293
263 3300039447 Ga0436361_0651128 Ga0436361_0651128_1622_2581 293
264 3300046522 Ga0495643_0086119 Ga0495643_0086119_577_1521 293
265 3300047320 Ga0495672_0083748 Ga0495672_0083748_457_1398 293
266 3300049586 Ga0501070_0104901 Ga0501070_0104901_452_1390 293
267 3300049671 Ga0501238_005774 Ga0501238_005774_239_1219 293
268 3300049822 Ga0501035_0008241 Ga0501035_0008241_1517_2455 293
269 3300049823 Ga0501044_0295134 Ga0501044_0295134_336_1274 293
270 3300050490 nmdc:mga03n38_1083_c1 nmdc:mga03n38_1083_c1_231_1169 293
271 3300050494 nmdc:mga06z11_43415_c1 nmdc:mga06z11_43415_c1_188_1126 293
272 3300053730 Ga0500645_006022 Ga0500645_006022_618_1562 293
273 3300061734 Ga0530510_0202180 Ga0530510_0202180_407_1351 293
274 iso_pu_bacteria 2513237104 2513723436 293
275 iso_pu_bacteria 2643221547 2643754810 293
276 iso_pu_bacteria 2818991467 2819717751 293
277 3300003578 Ga0006562J51391_1005875 Ga0006562J51391_10058753 294
278 3300005937 Ga0081455_10130165 Ga0081455_101301652 294
279 3300006051 Ga0075364_10003434 Ga0075364_100034344 294
280 3300020075 Ga0206349_1584086 Ga0206349_15840863 294
281 3300020077 Ga0206351_10081535 Ga0206351_100815353 294
282 3300020080 Ga0206350_10392259 Ga0206350_103922593 294
283 3300020610 Ga0154015_1119340 Ga0154015_11193402 294
284 3300021388 Ga0213875_10006323 Ga0213875_100063233 294
285 3300022467 Ga0224712_10001857 Ga0224712_100018573 294
286 3300025295 Ga0209564_1005738 Ga0209564_10057385 294
287 3300031239 Ga0265328_10000118 Ga0265328_100001186 294
288 3300031249 Ga0265339_10001333 Ga0265339_1000133310 294
289 3300031251 Ga0265327_10000356 Ga0265327_1000035631 294
290 3300031344 Ga0265316_10019397 Ga0265316_100193974 294
291 3300031344 Ga0265316_10058419 Ga0265316_100584192 294
292 3300031344 Ga0265316_10152977 Ga0265316_101529772 294
293 3300031595 Ga0265313_10001139 Ga0265313_100011396 294
294 3300031595 Ga0265313_10059630 Ga0265313_100596302 294
295 3300037068 Ga0373925_0128432 Ga0373925_0128432_462_1367 294
296 3300037853 Ga0436364_1508438 Ga0436364_1508438_12264_13229 294
297 3300039437 Ga0436365_0152513 Ga0436365_0152513_1159_2106 294
298 3300044735 Ga0466968_0056416 Ga0466968_0056416_216_1154 294
299 3300046511 Ga0495608_0228888 Ga0495608_0228888_228_1133 294
300 3300046512 Ga0495610_0021549 Ga0495610_0021549_1498_2442 294
301 3300046533 Ga0495640_0029472 Ga0495640_0029472_2897_3802 294
302 3300046694 Ga0495649_0101146 Ga0495649_0101146_467_1411 294
303 3300047319 Ga0495674_0053430 Ga0495674_0053430_585_1490 294
304 3300048907 Ga0496104_0000509 Ga0496104_0000509_8557_9498 294
305 3300048907 Ga0496104_0060641 Ga0496104_0060641_1968_2909 294
306 3300048908 Ga0496105_0000091 Ga0496105_0000091_53493_54434 294
307 3300048908 Ga0496105_0010403 Ga0496105_0010403_3052_3993 294
308 3300048915 Ga0496112_0059720 Ga0496112_0059720_1255_2196 294
309 3300048916 Ga0496113_0019272 Ga0496113_0019272_276_1217 294
310 3300048918 Ga0496115_0069522 Ga0496115_0069522_11_952 294
311 3300048919 Ga0496116_0005406 Ga0496116_0005406_3514_4455 294
312 3300048920 Ga0496117_0009484 Ga0496117_0009484_6060_7001 294
313 3300048921 Ga0496118_0017892 Ga0496118_0017892_178_1119 294
314 3300048922 Ga0496119_0001353 Ga0496119_0001353_1796_2740 294
315 3300048922 Ga0496119_0001827 Ga0496119_0001827_11010_11951 294
316 3300048928 Ga0496125_0004081 Ga0496125_0004081_8357_9298 294
317 3300048929 Ga0496126_0201790 Ga0496126_0201790_271_1212 294
318 3300049679 Ga0501249_011278 Ga0501249_011278_745_1638 294
319 3300049766 Ga0501269_000055 Ga0501269_000055_3216_4109 294
320 3300050491 nmdc:mga00v17_48410_c1 nmdc:mga00v17_48410_c1_930_1871 294
321 3300050516 nmdc:mga0sz30_10525_c1 nmdc:mga0sz30_10525_c1_1830_2771 294
322 3300053087 Ga0500643_007159 Ga0500643_007159_2122_3063 294
323 3300053088 Ga0500644_0000829 Ga0500644_0000829_3387_4328 294
324 3300053093 Ga0500651_0033392 Ga0500651_0033392_2170_3111 294
325 3300053104 Ga0500556_0000327 Ga0500556_0000327_25159_26103 294
326 3300053108 Ga0500562_003035 Ga0500562_003035_1208_2149 294
327 3300053119 Ga0500595_000078 Ga0500595_000078_20330_21271 294
328 3300053130 Ga0500642_0000005 Ga0500642_0000005_112682_113623 294
329 3300053131 Ga0500652_001106 Ga0500652_001106_6138_7079 294
330 3300053153 Ga0500616_0000006 Ga0500616_0000006_86124_87065 294
331 3300053730 Ga0500645_000486 Ga0500645_000486_17508_18449 294
332 3300053730 Ga0500645_014691 Ga0500645_014691_181_1149 294
333 iso_pu_bacteria 2508501114 2509075831 294
334 iso_pu_bacteria 2513237087 2513590838 294
335 iso_pu_bacteria 2602042107 2603862063 294
336 iso_pu_bacteria 2828305725 2828307013 294
337 iso_pu_bacteria 2835312727 2835319004 294
338 iso_pu_bacteria 2854911287 2854914771 294
339 iso_pu_bacteria 2883354860 2883356348 294
340 iso_pu_bacteria 2915650412 2915654520 294
341 iso_pu_bacteria 2917699015 2917700940 294
342 3300005436 Ga0070713_100180645 Ga0070713_1001806452 295
343 3300007265 Ga0099794_10072907 Ga0099794_100729072 295
344 3300042439 Ga0439464_0000683 Ga0439464_0000683_4803_5729 295
345 3300046460 Ga0495638_0097684 Ga0495638_0097684_348_1292 295
346 3300048926 Ga0496123_0000625 Ga0496123_0000625_12443_13390 295
347 iso_pu_bacteria 2510065053 2510284258 295
348 iso_pu_bacteria 2510065055 2510293058 295
349 iso_pu_bacteria 2554235132 2554817825 295
350 iso_pu_bacteria 2595698237 2596374952 295
351 iso_pu_bacteria 2606217733 2608380852 295
352 iso_pu_bacteria 2811994881 2812369009 295
353 iso_pu_bacteria 2823421272 2823425289 295
354 iso_pu_bacteria 2839138175 2839140247 295
355 iso_pu_bacteria 2889306138 2889306488 295
356 iso_pu_bacteria 2902405164 2902411420 295
357 iso_pu_bacteria 2919404418 2919405641 295
358 iso_pu_bacteria 2923519811 2923523089 295
359 3300005718 Ga0068866_10035858 Ga0068866_100358582 296
360 3300005719 Ga0068861_100096253 Ga0068861_1000962533 296
361 3300005981 Ga0081538_10097957 Ga0081538_100979572 296
362 3300006163 Ga0070715_10038430 Ga0070715_100384302 296
363 3300006852 Ga0075433_10278847 Ga0075433_102788471 296
364 3300009094 Ga0111539_10000244 Ga0111539_100002442 296
365 3300009094 Ga0111539_10615801 Ga0111539_106158012 296
366 3300009147 Ga0114129_10095248 Ga0114129_100952482 296
367 3300025899 Ga0207642_10044013 Ga0207642_100440133 296
368 3300026118 Ga0207675_100036605 Ga0207675_1000366052 296
369 3300027907 Ga0207428_10000050 Ga0207428_100000506 296
370 3300037853 Ga0436364_1330136 Ga0436364_1330136_480_1415 296
371 3300039450 Ga0436363_1337362 Ga0436363_1337362_109_1044 296
372 3300049569 Ga0501032_0028255 Ga0501032_0028255_436_1383 296
373 3300049570 Ga0501033_0018284 Ga0501033_0018284_3837_4784 296
374 3300049571 Ga0501034_0090764 Ga0501034_0090764_394_1341 296
375 3300049574 Ga0501038_0027633 Ga0501038_0027633_2897_3844 296
376 3300049575 Ga0501039_0239208 Ga0501039_0239208_404_1351 296
377 3300049579 Ga0501043_0028881 Ga0501043_0028881_1326_2273 296
378 3300049581 Ga0501047_0006980 Ga0501047_0006980_5685_6632 296
379 3300049583 Ga0501067_0035046 Ga0501067_0035046_1056_2003 296
380 3300049589 Ga0501073_0009227 Ga0501073_0009227_3451_4398 296
381 3300049742 Ga0501080_0095752 Ga0501080_0095752_94_1041 296
382 3300049823 Ga0501044_0041463 Ga0501044_0041463_799_1746 296
383 3300050511 nmdc:mga08y16_56_c1 nmdc:mga08y16_56_c1_97127_98074 296
384 iso_pu_bacteria 2551306089 2551713236 296
385 iso_pu_bacteria 2687453129 2687578660 296
386 3300003187 JGI25151J46595_10000056 JGI25151J46595_10000056136 297
387 3300003771 Ga0055526_1003873 Ga0055526_10038732 297
388 3300003771 Ga0055526_1008399 Ga0055526_10083992 297
389 3300003775 Ga0055524_1000089 Ga0055524_1000089100 297
390 3300005985 Ga0081539_10002321 Ga0081539_100023219 297
391 3300006186 Ga0075369_10052781 Ga0075369_100527812 297
392 3300013250 Ga0171462_1038 Ga0171462_103873 297
393 3300025273 Ga0209673_1004990 Ga0209673_10049903 297
394 3300025291 Ga0209675_1000344 Ga0209675_100034428 297
395 3300025292 Ga0209676_1023870 Ga0209676_10238702 297
396 3300025294 Ga0209025_1000016 Ga0209025_1000016356 297
397 3300025295 Ga0209564_1000035 Ga0209564_1000035102 297
398 3300025295 Ga0209564_1000075 Ga0209564_1000075126 297
399 3300025299 Ga0209256_1000025 Ga0209256_1000025344 297
400 3300025304 Ga0209257_1031842 Ga0209257_10318422 297
401 3300031901 Ga0307406_10019386 Ga0307406_100193864 297
402 3300037418 Ga0395900_0076322 Ga0395900_0076322_797_1753 297
403 3300046678 Ga0495599_0090113 Ga0495599_0090113_284_1234 297
404 3300048921 Ga0496118_0015654 Ga0496118_0015654_2379_3284 297
405 3300048925 Ga0496122_0018190 Ga0496122_0018190_2355_3272 297
406 3300048926 Ga0496123_0015321 Ga0496123_0015321_4809_5726 297
407 3300048926 Ga0496123_0072936 Ga0496123_0072936_571_1488 297
408 3300048928 Ga0496125_0110937 Ga0496125_0110937_409_1326 297
409 3300050496 nmdc:mga07m45_87811_c1 nmdc:mga07m45_87811_c1_287_1204 297
410 3300050516 nmdc:mga0sz30_50820_c1 nmdc:mga0sz30_50820_c1_239_1159 297
411 iso_pu_bacteria 2599185301 2599941078 297
412 iso_pu_bacteria 2643221637 2644206858 297
413 iso_pu_bacteria 2643221718 2644650506 297
414 iso_pu_bacteria 2871495908 2871501626 297
415 iso_pu_bacteria 2874123672 2874123968 297
416 iso_pu_bacteria 2878760144 2878765563 297
417 iso_pu_bacteria 2878767105 2878772753 297
418 iso_pu_bacteria 2881147464 2881151070 297
419 iso_pu_bacteria 2885305155 2885306070 297
420 iso_pu_bacteria 2885326080 2885332228 297
421 iso_pu_bacteria 2885334103 2885338026 297
422 iso_pu_bacteria 2903540706 2903546442 297
423 iso_pu_bacteria 2937994558 2938000303 297
424 iso_pu_bacteria 2958165035 2958170735 297
425 iso_pu_bacteria 2961163497 2961169185 297
426 iso_pu_bacteria 2965018300 2965019132 297
427 iso_pu_bacteria 2968171901 2968177568 297
428 iso_pu_bacteria 2970554993 2970560414 297
429 iso_pu_bacteria 2977864932 2977871510 297
430 iso_pu_bacteria 2987659509 2987665251 297
431 iso_pu_bacteria 3004188549 3004194304 297
432 3300031241 Ga0265325_10000488 Ga0265325_1000048818 298
433 3300031595 Ga0265313_10002551 Ga0265313_100025519 298
434 3300046457 Ga0495590_0003022 Ga0495590_0003022_2718_3650 298
435 3300048919 Ga0496116_0001200 Ga0496116_0001200_12969_13895 298
436 3300048928 Ga0496125_0045080 Ga0496125_0045080_930_1856 298
437 iso_pu_bacteria 2834578030 2834580915 298
438 iso_pu_bacteria 2863421361 2863426104 298
439 iso_pu_bacteria 2894023352 2894027117 298
440 iso_pu_bacteria 2904564687 2904565299 298
441 iso_pu_bacteria 2904571731 2904572005 298
442 iso_pu_bacteria 2928163908 2928165279 298
443 iso_pu_bacteria 2928536128 2928537324 298
444 iso_pu_bacteria 8057132660 8057134691 298
445 3300006051 Ga0075364_10069802 Ga0075364_100698022 299
446 3300009148 Ga0105243_10000661 Ga0105243_100006619 299
447 3300025303 Ga0209051_1030890 Ga0209051_10308902 299
448 3300032004 Ga0307414_10004415 Ga0307414_100044152 299
449 3300046530 Ga0495654_0000757 Ga0495654_0000757_4129_5109 299
450 3300050491 nmdc:mga00v17_240_c1 nmdc:mga00v17_240_c1_1444_2436 299
451 iso_pu_bacteria 2511231052 2511499194 299
452 iso_pu_bacteria 2512047086 2512530479 299
453 iso_pu_bacteria 2524023207 2524451608 299
454 iso_pu_bacteria 2534681796 2535518079 299
455 iso_pu_bacteria 2551306092 2551733427 299
456 iso_pu_bacteria 2599185236 2599720725 299
457 iso_pu_bacteria 2643221618 2644108188 299
458 iso_pu_bacteria 2643221626 2644145885 299
459 iso_pu_bacteria 2643221655 2644307364 299
460 iso_pu_bacteria 2643221659 2644331380 299
461 iso_pu_bacteria 2643221698 2644541396 299
462 iso_pu_bacteria 2643221712 2644613453 299
463 iso_pu_bacteria 2721755523 2722883980 299
464 iso_pu_bacteria 2818991461 2819686733 299
465 iso_pu_bacteria 2821123053 2821127262 299
466 iso_pu_bacteria 2838736955 2838740594 299
467 iso_pu_bacteria 2841840854 2841844435 299
468 iso_pu_bacteria 2842140634 2842144497 299
469 iso_pu_bacteria 2844163670 2844166961 299
470 iso_pu_bacteria 2855825444 2855829899 299
471 iso_pu_bacteria 2857531043 2857534757 299
472 iso_pu_bacteria 2894817345 2894817670 299
473 iso_pu_bacteria 2915993759 2915999148 299
474 iso_pu_bacteria 2916007675 2916011956 299
475 iso_pu_bacteria 2916014648 2916017835 299
476 iso_pu_bacteria 2916028427 2916032342 299
477 iso_pu_bacteria 2916035215 2916035509 299
478 iso_pu_bacteria 2916055098 2916056502 299
479 iso_pu_bacteria 2921237296 2921238396 299
480 iso_pu_bacteria 2921263974 2921265531 299
481 iso_pu_bacteria 2921296804 2921302712 299
482 iso_pu_bacteria 2924150972 2924153506 299
483 iso_pu_bacteria 2924158325 2924162734 299
484 iso_pu_bacteria 2924172951 2924174047 299
485 iso_pu_bacteria 2924207177 2924208622 299
486 iso_pu_bacteria 2924214083 2924220798 299
487 iso_pu_bacteria 2924221636 2924224882 299
488 iso_pu_bacteria 2924228884 2924234772 299
489 iso_pu_bacteria 2932422444 2932425430 299
490 iso_pu_bacteria 2937002841 2937008813 299
491 iso_pu_bacteria 2937016420 2937021231 299
492 iso_pu_bacteria 2937042894 2937047112 299
493 iso_pu_bacteria 2937049772 2937049828 299
494 iso_pu_bacteria 2937056579 2937056737 299
495 iso_pu_bacteria 2937071275 2937075510 299
496 iso_pu_bacteria 2937091812 2937091857 299
497 iso_pu_bacteria 2937098957 2937103229 299
498 iso_pu_bacteria 2937126314 2937126420 299
499 iso_pu_bacteria 2941499720 2941502869 299
500 iso_pu_bacteria 2957415311 2957415866 299
501 iso_pu_bacteria 2957422303 2957423124 299
502 iso_pu_bacteria 2957430029 2957432381 299
503 iso_pu_bacteria 2957443900 2957448149 299
504 iso_pu_bacteria 2957471148 2957474101 299
505 iso_pu_bacteria 2957478035 2957478098 299
506 iso_pu_bacteria 2957498199 2957498252 299
507 iso_pu_bacteria 2960603979 2960606082 299
508 iso_pu_bacteria 2960617483 2960620656 299
509 iso_pu_bacteria 2960624210 2960629491 299
510 iso_pu_bacteria 2960637947 2960639332 299
511 iso_pu_bacteria 2960652885 2960658281 299
512 iso_pu_bacteria 2960660292 2960665967 299
513 iso_pu_bacteria 2964607997 2964608037 299
514 iso_pu_bacteria 2964628898 2964629587 299
515 iso_pu_bacteria 2964649959 2964654667 299
516 iso_pu_bacteria 2964656573 2964660858 299
517 iso_pu_bacteria 2964663802 2964664553 299
518 iso_pu_bacteria 2964678106 2964683819 299
519 iso_pu_bacteria 2964705432 2964705538 299
520 iso_pu_bacteria 2964719344 2964720920 299
521 iso_pu_bacteria 2967671571 2967678098 299
522 iso_pu_bacteria 2967678726 2967682837 299
523 iso_pu_bacteria 2967693043 2967693891 299
524 iso_pu_bacteria 2967706974 2967708716 299
525 iso_pu_bacteria 2967714385 2967719722 299
526 iso_pu_bacteria 2967721400 2967726735 299
527 iso_pu_bacteria 2967742019 2967747310 299
528 iso_pu_bacteria 2967762386 2967765623 299
529 iso_pu_bacteria 2967775926 2967780981 299
530 iso_pu_bacteria 2970019648 2970025447 299
531 iso_pu_bacteria 2970040964 2970043699 299
532 iso_pu_bacteria 2970047711 2970047931 299
533 iso_pu_bacteria 2970061556 2970061609 299
534 iso_pu_bacteria 2970088815 2970088868 299
535 iso_pu_bacteria 2970109326 2970113264 299
536 iso_pu_bacteria 2970116247 2970117205 299
537 iso_pu_bacteria 2970129317 2970130666 299
538 iso_pu_bacteria 2970136068 2970139091 299
539 iso_pu_bacteria 2970149975 2970156547 299
540 iso_pu_bacteria 2970170962 2970172561 299
541 iso_pu_bacteria 2970184632 2970185195 299
542 iso_pu_bacteria 2977523885 2977529621 299
543 iso_pu_bacteria 2977537788 2977541887 299
544 iso_pu_bacteria 2977551784 2977555147 299
545 iso_pu_bacteria 2977572785 2977578577 299
546 iso_pu_bacteria 2977579622 2977581358 299
547 iso_pu_bacteria 8005542996 8005548961 299
548 3300002075 JGI24738J21930_10000095 JGI24738J21930_1000009516 300
549 3300007788 Ga0099795_10013258 Ga0099795_100132582 300
550 3300044901 Ga0466960_0018190 Ga0466960_0018190_1407_2381 300
551 3300046512 Ga0495610_0002695 Ga0495610_0002695_4178_5104 300
552 3300059504 Ga0587082_002216 Ga0587082_002216_309_1283 300
553 iso_pu_bacteria 2501025502 2501084245 300
554 iso_pu_bacteria 2510917013 2511088669 300
555 iso_pu_bacteria 2513237083 2513564583 300
556 iso_pu_bacteria 2515154189 2516021049 300
557 iso_pu_bacteria 2519103095 2519461960 300
558 iso_pu_bacteria 2582581311 2585290223 300
559 iso_pu_bacteria 2599185240 2599748583 300
560 iso_pu_bacteria 2599185355 2600210429 300
561 iso_pu_bacteria 2675903129 2676746674 300
562 iso_pu_bacteria 2728369097 2729145507 300
563 iso_pu_bacteria 2808606384 2808967885 300
564 iso_pu_bacteria 2816332253 2817258815 300
565 iso_pu_bacteria 2816332256 2817280752 300
566 iso_pu_bacteria 2816332286 2817454740 300
567 iso_pu_bacteria 2842324504 2842325908 300
568 iso_pu_bacteria 2870068957 2870075061 300
569 iso_pu_bacteria 2928157003 2928157465 300
570 iso_pu_bacteria 8003955200 8003960125 300
571 iso_pu_bacteria 8018845410 8018846490 300
572 iso_pu_bacteria 8020807995 8020808479 300
573 iso_pu_bacteria 8020945358 8020948605 300
574 iso_pu_bacteria 8040167225 8040168172 300
575 iso_pu_bacteria 8040173305 8040174437 300
576 3300002774 JGI25150J39212_1002960 JGI25150J39212_10029602 301
577 3300003771 Ga0055526_1000114 Ga0055526_100011440 301
578 3300025303 Ga0209051_1001060 Ga0209051_100106015 301
579 3300027111 Ga0209281_1002284 Ga0209281_10022843 301
580 3300041411 Ga0439466_0013734 Ga0439466_0013734_591_1526 301
581 3300046452 Ga0495617_026219 Ga0495617_026219_794_1708 301
582 3300046507 Ga0495606_0000719 Ga0495606_0000719_39119_40033 301
583 3300046507 Ga0495606_0001577 Ga0495606_0001577_17065_17979 301
584 3300046533 Ga0495640_0038965 Ga0495640_0038965_784_1716 301
585 3300046557 Ga0495622_0000286 Ga0495622_0000286_10912_11826 301
586 3300046663 Ga0495635_0214034 Ga0495635_0214034_212_1144 301
587 3300047319 Ga0495674_0087965 Ga0495674_0087965_614_1546 301
588 3300047323 Ga0495683_0068638 Ga0495683_0068638_793_1707 301
589 iso_pu_bacteria 2510065057 2510304815 301
590 iso_pu_bacteria 2513237086 2513585140 301
591 iso_pu_bacteria 2513237091 2513616035 301
592 iso_pu_bacteria 2513237140 2513883320 301
593 iso_pu_bacteria 2513237143 2513902774 301
594 iso_pu_bacteria 2516653046 2516898047 301
595 iso_pu_bacteria 2551306084 2551679153 301
596 iso_pu_bacteria 2551306084 2551680979 301
597 iso_pu_bacteria 2551306085 2551686056 301
598 iso_pu_bacteria 2551306090 2551717062 301
599 iso_pu_bacteria 2671180139 2671695293 301
600 iso_pu_bacteria 2842718218 2842718443 301
601 iso_pu_bacteria 2855839649 2855846180 301
602 iso_pu_bacteria 2858800743 2858804814 301
603 iso_pu_bacteria 2883577096 2883577858 301
604 iso_pu_bacteria 2915986958 2915989604 301
605 iso_pu_bacteria 2916000859 2916001086 301
606 iso_pu_bacteria 2916021584 2916025607 301
607 iso_pu_bacteria 2916041962 2916043178 301
608 iso_pu_bacteria 2916048683 2916049410 301
609 iso_pu_bacteria 2916068649 2916071080 301
610 iso_pu_bacteria 2916076590 2916076632 301
611 iso_pu_bacteria 2921201388 2921206511 301
612 iso_pu_bacteria 2921208531 2921208619 301
613 iso_pu_bacteria 2921244191 2921249963 301
614 iso_pu_bacteria 2921257292 2921259691 301
615 iso_pu_bacteria 2921282425 2921289188 301
616 iso_pu_bacteria 2921289301 2921292488 301
617 iso_pu_bacteria 2924144063 2924150267 301
618 iso_pu_bacteria 2924165586 2924168988 301
619 iso_pu_bacteria 2924179722 2924184841 301
620 iso_pu_bacteria 2924186466 2924189297 301
621 iso_pu_bacteria 2924193448 2924198073 301
622 iso_pu_bacteria 2924200457 2924206380 301
623 iso_pu_bacteria 2937009748 2937012340 301
624 iso_pu_bacteria 2937023124 2937026277 301
625 iso_pu_bacteria 2937063883 2937068106 301
626 iso_pu_bacteria 2937106411 2937110621 301
627 iso_pu_bacteria 2937113482 2937113799 301
628 iso_pu_bacteria 2937119839 2937121271 301
629 iso_pu_bacteria 2957382221 2957384024 301
630 iso_pu_bacteria 2957388812 2957390954 301
631 iso_pu_bacteria 2957395598 2957396363 301
632 iso_pu_bacteria 2957402308 2957405365 301
633 iso_pu_bacteria 2957408893 2957412724 301
634 iso_pu_bacteria 2957450854 2957454166 301
635 iso_pu_bacteria 2957457609 2957462328 301
636 iso_pu_bacteria 2957464669 2957470357 301
637 iso_pu_bacteria 2957484790 2957487996 301
638 iso_pu_bacteria 2957491536 2957493529 301
639 iso_pu_bacteria 2957505466 2957508385 301
640 iso_pu_bacteria 2960584000 2960585479 301
641 iso_pu_bacteria 2960597568 2960598975 301
642 iso_pu_bacteria 2960610863 2960611513 301
643 iso_pu_bacteria 2960645483 2960651705 301
644 iso_pu_bacteria 2960667422 2960673624 301
645 iso_pu_bacteria 2960674078 2960679978 301
646 iso_pu_bacteria 2960687367 2960691254 301
647 iso_pu_bacteria 2964615318 2964617670 301
648 iso_pu_bacteria 2964621998 2964628678 301
649 iso_pu_bacteria 2964636051 2964638726 301
650 iso_pu_bacteria 2964643177 2964644673 301
651 iso_pu_bacteria 2964670856 2964674673 301
652 iso_pu_bacteria 2964685014 2964691514 301
653 iso_pu_bacteria 2964691889 2964694460 301
654 iso_pu_bacteria 2964698721 2964701091 301
655 iso_pu_bacteria 2964712639 2964718262 301
656 iso_pu_bacteria 2967664464 2967665011 301
657 iso_pu_bacteria 2967699805 2967706311 301
658 iso_pu_bacteria 2967735183 2967738051 301
659 iso_pu_bacteria 2967748971 2967753194 301
660 iso_pu_bacteria 2967755722 2967756821 301
661 iso_pu_bacteria 2967769361 2967775123 301
662 iso_pu_bacteria 2970033650 2970036595 301
663 iso_pu_bacteria 2970054988 2970056350 301
664 iso_pu_bacteria 2970068827 2970072220 301
665 iso_pu_bacteria 2970076120 2970079916 301
666 iso_pu_bacteria 2970082768 2970085513 301
667 iso_pu_bacteria 2970095765 2970098198 301
668 iso_pu_bacteria 2970102677 2970106281 301
669 iso_pu_bacteria 2970156795 2970156812 301
670 iso_pu_bacteria 2970164137 2970164247 301
671 iso_pu_bacteria 2970177841 2970182658 301
672 iso_pu_bacteria 2970191845 2970193205 301
673 iso_pu_bacteria 2977516862 2977517533 301
674 iso_pu_bacteria 2977558990 2977565691 301
675 iso_pu_bacteria 2977565890 2977567806 301
676 iso_pu_bacteria 648276728 648736280 301
677 iso_pu_bacteria 8003992118 8003998641 301
678 3300005289 Ga0065704_10079656 Ga0065704_100796562 302
679 3300005289 Ga0065704_10098008 Ga0065704_100980082 302
680 3300006946 Ga0079104_1000011 Ga0079104_100001193 302
681 3300009092 Ga0105250_10011799 Ga0105250_100117992 302
682 3300025711 Ga0207696_1012840 Ga0207696_10128402 302
683 3300025935 Ga0207709_10000074 Ga0207709_1000007416 302
684 3300027111 Ga0209281_1000005 Ga0209281_1000005845 302
685 3300039438 Ga0436360_0369616 Ga0436360_0369616_533_1507 302
686 3300042876 Ga0451577_0000194 Ga0451577_0000194_82674_83603 302
687 3300044712 Ga0453684_0000218 Ga0453684_0000218_75082_76011 302
688 3300021441 Ga0213871_10014233 Ga0213871_100142332 303
689 3300046455 Ga0495603_0010738 Ga0495603_0010738_4557_5480 303
690 3300046459 Ga0495629_0023675 Ga0495629_0023675_74_997 303
691 3300046461 Ga0495641_0105352 Ga0495641_0105352_272_1195 303
692 3300046463 Ga0495653_0001022 Ga0495653_0001022_1419_2342 303
693 3300046472 Ga0495580_0020079 Ga0495580_0020079_2272_3195 303
694 3300046473 Ga0495582_0010082 Ga0495582_0010082_2202_3125 303
695 3300046477 Ga0495664_0008848 Ga0495664_0008848_1308_2231 303
696 3300046514 Ga0495618_0023790 Ga0495618_0023790_2816_3739 303
697 3300046516 Ga0495628_0000457 Ga0495628_0000457_3402_4325 303
698 3300046517 Ga0495630_0025307 Ga0495630_0025307_2705_3628 303
699 3300046526 Ga0495666_0000229 Ga0495666_0000229_19093_20016 303
700 3300046529 Ga0495652_0035435 Ga0495652_0035435_3346_4269 303
701 3300046531 Ga0495665_0000139 Ga0495665_0000139_31136_32059 303
702 3300046533 Ga0495640_0036212 Ga0495640_0036212_1613_2536 303
703 3300046535 Ga0495586_0000124 Ga0495586_0000124_44255_45178 303
704 3300046536 Ga0495587_0007614 Ga0495587_0007614_5277_6200 303
705 3300046543 Ga0495645_0024538 Ga0495645_0024538_3262_4185 303
706 3300046642 Ga0495634_0006812 Ga0495634_0006812_3295_4218 303
707 3300046648 Ga0495611_0059974 Ga0495611_0059974_394_1317 303
708 3300046663 Ga0495635_0050538 Ga0495635_0050538_945_1868 303
709 3300046665 Ga0495661_0021441 Ga0495661_0021441_3092_4015 303
710 3300046678 Ga0495599_0018796 Ga0495599_0018796_154_1077 303
711 3300046679 Ga0495623_0061820 Ga0495623_0061820_1415_2338 303
712 3300046680 Ga0495646_0053956 Ga0495646_0053956_932_1855 303
713 3300046689 Ga0495613_0007348 Ga0495613_0007348_1920_2843 303
714 3300046690 Ga0495624_0102119 Ga0495624_0102119_651_1574 303
715 3300047315 Ga0495581_0065243 Ga0495581_0065243_991_1914 303
716 3300047317 Ga0495604_0017449 Ga0495604_0017449_2059_2982 303
717 3300047319 Ga0495674_0035238 Ga0495674_0035238_3402_4325 303
718 3300047319 Ga0495674_0198903 Ga0495674_0198903_391_1314 303
719 3300047320 Ga0495672_0002041 Ga0495672_0002041_10379_11302 303
720 3300047321 Ga0495676_0025328 Ga0495676_0025328_3024_3947 303
721 3300047322 Ga0495680_0001071 Ga0495680_0001071_26169_27092 303
722 3300047444 Ga0495675_0072040 Ga0495675_0072040_1068_1991 303
723 3300047446 Ga0495679_000269 Ga0495679_000269_39194_40117 303
724 3300047471 Ga0495684_0051601 Ga0495684_0051601_560_1483 303
725 3300048088 Ga0495602_0000446 Ga0495602_0000446_3245_4168 303
726 3300048089 Ga0495614_0000125 Ga0495614_0000125_3414_4337 303
727 3300048905 Ga0496102_0135761 Ga0496102_0135761_223_1149 303
728 3300001989 JGI24739J22299_10012955 JGI24739J22299_100129552 304
729 3300002705 JGI25156J39149_1000311 JGI25156J39149_100031114 304
730 3300003763 Ga0055529_1000290 Ga0055529_10002902 304
731 3300003790 Ga0055528_1004510 Ga0055528_10045104 304
732 3300009545 Ga0105237_10091606 Ga0105237_100916062 304
733 3300016635 Ga0183361_10002 Ga0183361_10002605 304
734 3300021361 Ga0213872_10001065 Ga0213872_1000106514 304
735 3300025228 Ga0209672_100015 Ga0209672_100015411 304
736 3300025228 Ga0209672_100329 Ga0209672_1003297 304
737 3300025229 Ga0209147_100016 Ga0209147_10001652 304
738 3300025229 Ga0209147_100102 Ga0209147_10010220 304
739 3300025242 Ga0209258_100026 Ga0209258_100026411 304
740 3300025242 Ga0209258_100131 Ga0209258_10013120 304
741 3300025254 Ga0209148_1000130 Ga0209148_100013020 304
742 3300025256 Ga0209759_1005773 Ga0209759_10057734 304
743 3300025263 Ga0209565_1007238 Ga0209565_10072383 304
744 3300025272 Ga0209455_1000118 Ga0209455_1000118134 304
745 3300025272 Ga0209455_1001611 Ga0209455_10016112 304
746 3300025273 Ga0209673_1000028 Ga0209673_1000028163 304
747 3300025291 Ga0209675_1007946 Ga0209675_10079462 304
748 3300025294 Ga0209025_1003251 Ga0209025_100325113 304
749 3300025295 Ga0209564_1006664 Ga0209564_10066645 304
750 3300025299 Ga0209256_1000905 Ga0209256_10009055 304
751 3300025904 Ga0207647_10011633 Ga0207647_100116335 304
752 3300025913 Ga0207695_10002981 Ga0207695_100029812 304
753 3300025914 Ga0207671_10013869 Ga0207671_100138693 304
754 3300025919 Ga0207657_10000119 Ga0207657_1000011949 304
755 3300025924 Ga0207694_10005838 Ga0207694_100058386 304
756 3300025932 Ga0207690_10000008 Ga0207690_1000000850 304
757 3300025949 Ga0207667_10013144 Ga0207667_100131442 304
758 3300026067 Ga0207678_10000527 Ga0207678_100005276 304
759 3300026142 Ga0207698_10094294 Ga0207698_100942942 304
760 3300027312 Ga0209371_1000431 Ga0209371_100043120 304
761 3300030500 Ga0268256_1000370 Ga0268256_100037020 304
762 3300046471 Ga0495650_0000233 Ga0495650_0000233_46773_47705 304
763 3300046474 Ga0495605_0003199 Ga0495605_0003199_7014_7946 304
764 3300046500 Ga0495596_0001934 Ga0495596_0001934_5654_6586 304
765 3300046507 Ga0495606_0036569 Ga0495606_0036569_259_1182 304
766 3300046524 Ga0495648_0013506 Ga0495648_0013506_2166_3098 304
767 3300046538 Ga0495609_0006102 Ga0495609_0006102_1005_1937 304
768 3300046557 Ga0495622_0084620 Ga0495622_0084620_245_1168 304
769 3300046794 Ga0495589_0003525 Ga0495589_0003525_3912_4844 304
770 3300047320 Ga0495672_0003022 Ga0495672_0003022_11558_12490 304
771 3300047323 Ga0495683_0029742 Ga0495683_0029742_467_1399 304
772 3300047472 Ga0495686_0000321 Ga0495686_0000321_27531_28454 304
773 3300048927 Ga0496124_0005319 Ga0496124_0005319_9553_10485 304
774 3300048929 Ga0496126_0019890 Ga0496126_0019890_1989_2945 304
775 3300053141 Ga0500574_000170 Ga0500574_000170_2423_3385 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09163

Form-deh_trans

Formate dehydrogenase N, transmembrane

266

309

0.99

PF13247

Fer4_11

4Fe-4S dicluster domain

111

209

0.95

PF00037

Fer4

4Fe-4S binding domain

146

169

0.88

PF12837

Fer4_6

4Fe-4S binding domain

145

168

0.88

PF13237

Fer4_10

4Fe-4S dicluster domain

112

164

0.88

PF12838

Fer4_7

4Fe-4S dicluster domain

56

137

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.8432 28 238
1h0h-assembly2.cif.gz_L tungsten containing formate dehydrogenase from desulfovibrio gigas 0.8357 28 238
1kqf-assembly1.cif.gz_B formate dehydrogenase n from e. coli 0.8321 2 289
1kqf-assembly1.cif.gz_B formate dehydrogenase n from e. coli 0.8267 2 289
8bqk-assembly1.cif.gz_B w-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 22 min 0.8254 28 238
ID Description Score Start End Superfamily
1kqgB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9209 99 162 3.30.70.20
1kqgB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8935 27 228 3.30.70.20
1kqgB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8875 27 228 3.30.70.20
af_Q86I95_32_170_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8682 79 97 1.20.1280.290
af_D4A2T2_39_180_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8607 79 97 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A378EHB2-F1-model_v4 deleted 0.9467 101 255
AF-A0A316XKB8-F1-model_v4 deleted 0.9411 86 246
AF-A0A377LQA2-F1-model_v4 Formate dehydrogenase subunit beta (EC 1.17.1.9) 0.9389 80 230 GO:0008863
GO:0030313
GO:0046872
GO:0051539
AF-A0A378EHB2-F1-model_v4 deleted 0.9351 101 255
AF-A0A6N6X763-F1-model_v4 deleted 0.9305 75 238

Feature Viewer

pLDDT pTM Quality
85.06 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map