F480146

General Info

Members Datasets Scaffolds Average Seq Length
772 359 768 175

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8008558824|8008562467
Length 217
Sequence PVTVGFGDRTVTISSDLRPLTVRPGPIHGRYTWCVYLVCTVVLMSIGHTLLGLLESGPRHGYDLKRAFDEKFGHDRPLHYGQVYSTMSRLLKNGLVEVDGIEPGGGPERKRYAITEAGITDVQRWLATPEKPEPYLQSTLYTKVVLALLTDRNAADILDTQRSEHLRMMRILTDRKRKGDLADQLICDHALFHLEADLRWLELTAARLGKLAEAVTR

Samples

Sample ID Description Type Environment
1 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
2 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
3 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
67 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
116 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
117 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
146 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
147 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
150 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
151 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
159 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
162 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
163 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
164 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
165 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
166 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
167 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
168 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
185 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
203 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
204 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
236 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
240 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
258 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
283 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
311 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
328 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
329 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
330 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
331 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
332 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
333 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
334 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
337 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
338 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
342 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
343 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
344 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
345 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
346 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
347 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
351 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
352 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
353 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
359 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0.13
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.87
Nodule 0.26
Rhizoplane 3.63
Rhizosphere 81.99
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005676 3300001989 Bacteria 4728
2 JGI24737J22298_10036687 3300001990 Bacteria 1513
3 JGI25406J46586_10010577 3300003203 Bacteria 4090
4 rootH1_10034127 3300003316 Bacteria 13161
5 rootH2_10080827 3300003320 Bacteria 1475
6 JGI25160J50197_1010101 3300003354 Bacteria 3441
7 JGI25160J50197_1034468 3300003354 Bacteria 1256
8 Ga0070683_100083517 3300005329 Bacteria 2991
9 Ga0070683_100860236 3300005329 Bacteria 870
10 Ga0070690_100025937 3300005330 Bacteria 3611
11 Ga0070660_100873306 3300005339 Bacteria 758
12 Ga0070661_100419672 3300005344 Bacteria 1060
13 Ga0070661_100610961 3300005344 Unclassified 882
14 Ga0070668_100003878 3300005347 Bacteria 11042
15 Ga0070675_100748090 3300005354 Bacteria 892
16 Ga0070671_100628646 3300005355 Bacteria 929
17 Ga0070674_100024269 3300005356 Bacteria 3934
18 Ga0070674_100118821 3300005356 Bacteria 1954
19 Ga0070659_100879752 3300005366 Bacteria 782
20 Ga0070667_101154676 3300005367 Bacteria 724
21 Ga0070709_10822967 3300005434 Bacteria 730
22 Ga0070713_100506843 3300005436 Bacteria 1139
23 Ga0070713_100766211 3300005436 Bacteria 924
24 Ga0070710_10000158 3300005437 Bacteria 31424
25 Ga0070663_100000450 3300005455 Bacteria 21744
26 Ga0070663_100010974 3300005455 Bacteria 5667
27 Ga0070663_100830547 3300005455 Bacteria 794
28 Ga0070678_100630777 3300005456 Bacteria 959
29 Ga0070678_100815706 3300005456 Bacteria 848
30 Ga0070681_11083702 3300005458 Unclassified 722
31 Ga0068867_100672415 3300005459 Bacteria 911
32 Ga0070685_10000870 3300005466 Bacteria 16346
33 Ga0070679_100454802 3300005530 Bacteria 1225
34 Ga0070684_100024815 3300005535 Bacteria 5032
35 Ga0070684_100121900 3300005535 Bacteria 2346
36 Ga0070684_100159679 3300005535 Bacteria 2044
37 Ga0070684_100459058 3300005535 Bacteria 1178
38 Ga0070684_100633499 3300005535 Bacteria 995
39 Ga0068853_100010969 3300005539 Bacteria 7343
40 Ga0068853_100125636 3300005539 Bacteria 2291
41 Ga0068853_101775563 3300005539 Bacteria 598
42 Ga0070665_100040185 3300005548 Bacteria 4702
43 Ga0070665_100232242 3300005548 Bacteria 1845
44 Ga0068855_100861886 3300005563 Bacteria 959
45 Ga0070664_100057265 3300005564 Bacteria 3313
46 Ga0068857_100139912 3300005577 Bacteria 2187
47 Ga0068854_100913560 3300005578 Bacteria 772
48 Ga0068856_100239250 3300005614 Bacteria 1831
49 Ga0068856_100938836 3300005614 Bacteria 884
50 Ga0068852_100542870 3300005616 Bacteria 1162
51 Ga0068852_101279811 3300005616 Bacteria 755
52 Ga0068864_100012137 3300005618 Bacteria 7118
53 Ga0068861_100424784 3300005719 Bacteria 1185
54 Ga0068863_100193177 3300005841 Bacteria 1956
55 Ga0068863_101494873 3300005841 Bacteria 684
56 Ga0068858_100253821 3300005842 Bacteria 1671
57 Ga0081455_10339733 3300005937 Bacteria 1063
58 Ga0081538_10001098 3300005981 Bacteria 28674
59 Ga0081540_1086172 3300005983 Bacteria 1396
60 Ga0081539_10000173 3300005985 Bacteria 151356
61 Ga0070717_10188534 3300006028 Bacteria 1801
62 Ga0070717_10382673 3300006028 Bacteria 1262
63 Ga0075368_10019948 3300006042 Bacteria 2534
64 Ga0075363_100024448 3300006048 Bacteria 3071
65 Ga0070716_100257080 3300006173 Bacteria 1193
66 Ga0075367_10001478 3300006178 Bacteria 10147
67 Ga0068871_100911839 3300006358 Bacteria 815
68 Ga0075428_100687618 3300006844 Bacteria 1090
69 Ga0075431_100385224 3300006847 Bacteria 1405
70 Ga0075429_100001872 3300006880 Bacteria 17427
71 Ga0075429_100079501 3300006880 Bacteria 2858
72 Ga0099826_10050777 3300006948 Bacteria 2787
73 Ga0105251_10008794 3300009011 Bacteria 6054
74 Ga0111539_11815165 3300009094 Bacteria 707
75 Ga0105245_10369678 3300009098 Bacteria 1425
76 Ga0105245_10513312 3300009098 Bacteria 1216
77 Ga0105247_10179591 3300009101 Bacteria 1412
78 Ga0114129_12618001 3300009147 Bacteria 602
79 Ga0105243_10572832 3300009148 Bacteria 1082
80 Ga0105248_10034305 3300009177 Bacteria 5673
81 Ga0105248_10614652 3300009177 Bacteria 1226
82 Ga0105238_10057832 3300009551 Bacteria 3887
83 Ga0105238_10607689 3300009551 Bacteria 1102
84 Ga0105238_10745308 3300009551 Bacteria 993
85 Ga0105249_10222611 3300009553 Bacteria 1857
86 Ga0105246_10002882 3300011119 Bacteria 10405
87 Ga0105246_10537800 3300011119 Bacteria 999
88 Ga0157322_1008915 3300012490 Bacteria 778
89 Ga0157313_1001614 3300012503 Bacteria 1243
90 Ga0157369_10062288 3300013105 Bacteria 4020
91 Ga0157374_11129171 3300013296 Bacteria 804
92 Ga0163162_11845321 3300013306 Bacteria 691
93 Ga0157372_10077506 3300013307 Bacteria 3754
94 Ga0157375_10361097 3300013308 Bacteria 1619
95 Ga0163163_10002986 3300014325 Bacteria 14314
96 Ga0163163_10044342 3300014325 Bacteria 4363
97 Ga0163163_11036005 3300014325 Bacteria 884
98 Ga0157380_12074321 3300014326 Bacteria 631
99 Ga0182008_10008823 3300014497 Bacteria 5474
100 Ga0157377_10737251 3300014745 Bacteria 719
101 Ga0157379_10078837 3300014968 Bacteria 2950
102 Ga0157379_10305055 3300014968 Bacteria 1451
103 Ga0157376_11861728 3300014969 Bacteria 638
104 Ga0182006_1013159 3300015261 Bacteria 3597
105 Ga0182007_10000817 3300015262 Bacteria 17355
106 Ga0183367_1002 3300015688 Bacteria 1101531
107 Ga0213875_10002957 3300021388 Bacteria 9903
108 Ga0209758_1014489 3300025297 Bacteria 4187
109 Ga0207426_1001306 3300025302 Bacteria 21312
110 Ga0207426_1001848 3300025302 Bacteria 15553
111 Ga0207426_1002757 3300025302 Bacteria 10624
112 Ga0207426_1010918 3300025302 Bacteria 3493
113 Ga0207713_1032563 3300025735 Bacteria 2287
114 Ga0207692_10009605 3300025898 Bacteria 4047
115 Ga0207647_10003438 3300025904 Bacteria 11884
116 Ga0207699_10151302 3300025906 Bacteria 1536
117 Ga0207707_10279892 3300025912 Bacteria 1445
118 Ga0207707_10646139 3300025912 Bacteria 892
119 Ga0207663_10347687 3300025916 Bacteria 1122
120 Ga0207649_11294285 3300025920 Unclassified 577
121 Ga0207694_10620977 3300025924 Bacteria 909
122 Ga0207694_10621337 3300025924 Bacteria 909
123 Ga0207687_10293450 3300025927 Bacteria 1307
124 Ga0207700_10438357 3300025928 Bacteria 1150
125 Ga0207700_10873607 3300025928 Bacteria 805
126 Ga0207664_10005716 3300025929 Bacteria 8502
127 Ga0207686_10477905 3300025934 Bacteria 963
128 Ga0207669_10016652 3300025937 Bacteria 3742
129 Ga0207669_10080358 3300025937 Bacteria 2085
130 Ga0207711_10098123 3300025941 Bacteria 2588
131 Ga0207661_10815200 3300025944 Bacteria 859
132 Ga0207679_10106311 3300025945 Bacteria 2206
133 Ga0207667_10671126 3300025949 Bacteria 1041
134 Ga0207640_10372940 3300025981 Bacteria 1154
135 Ga0207639_10456527 3300026041 Bacteria 1161
136 Ga0207702_11503955 3300026078 Bacteria 667
137 Ga0207683_11377686 3300026121 Bacteria 652
138 Ga0207698_11024681 3300026142 Bacteria 837
139 Ga0209813_10005391 3300027866 Bacteria 3102
140 Ga0268266_10012541 3300028379 Bacteria 7324
141 Ga0268266_10478045 3300028379 Bacteria 1187
142 Ga0268266_10505727 3300028379 Bacteria 1154
143 Ga0268265_10000008 3300028380 Bacteria 417328
144 Ga0307517_10001976 3300028786 Bacteria 33403
145 Ga0307517_10010759 3300028786 Bacteria 12754
146 Ga0307515_10000573 3300028794 Bacteria 86907
147 Ga0307515_10056033 3300028794 Bacteria 5740
148 Ga0307515_10409932 3300028794 Bacteria 978
149 Ga0268256_1047276 3300030500 Bacteria 927
150 Ga0307511_10002078 3300030521 Bacteria 20966
151 Ga0307511_10019025 3300030521 Bacteria 6544
152 Ga0307512_10046279 3300030522 Bacteria 3549
153 Ga0307512_10060881 3300030522 Bacteria 2914
154 Ga0316176_1044666 3300030732 Bacteria 1081
155 Ga0316176_1221328 3300030732 Bacteria 973
156 Ga0314311_1107895 3300030733 Bacteria 2912
157 Ga0316182_1181641 3300030745 Bacteria 762
158 Ga0307513_10020470 3300031456 Bacteria 7846
159 Ga0307513_10281300 3300031456 Bacteria 1441
160 Ga0307509_10148111 3300031507 Bacteria 2269
161 Ga0307509_10227715 3300031507 Bacteria 1670
162 Ga0307509_10228616 3300031507 Bacteria 1665
163 Ga0307508_10009182 3300031616 Bacteria 9107
164 Ga0307508_10012239 3300031616 Bacteria 7844
165 Ga0307508_10012977 3300031616 Bacteria 7618
166 Ga0307508_10036728 3300031616 Bacteria 4410
167 Ga0307508_10037736 3300031616 Bacteria 4344
168 Ga0307508_10131454 3300031616 Bacteria 2106
169 Ga0307508_10348546 3300031616 Bacteria 1072
170 Ga0307514_10002934 3300031649 Bacteria 16969
171 Ga0307514_10100336 3300031649 Bacteria 2081
172 Ga0307514_10138027 3300031649 Bacteria 1664
173 Ga0307516_10011280 3300031730 Bacteria 9737
174 Ga0307516_10075768 3300031730 Bacteria 3218
175 Ga0307516_10181201 3300031730 Bacteria 1840
176 Ga0307516_10216060 3300031730 Bacteria 1629
177 Ga0307516_10422406 3300031730 Bacteria 991
178 Ga0307413_10483676 3300031824 Bacteria 990
179 Ga0307413_10489999 3300031824 Bacteria 985
180 Ga0307518_10000112 3300031838 Bacteria 56876
181 Ga0307518_10033606 3300031838 Bacteria 3721
182 Ga0307410_10218052 3300031852 Bacteria 1466
183 Ga0307406_10608627 3300031901 Bacteria 902
184 Ga0307407_10176598 3300031903 Bacteria 1412
185 Ga0307407_10622535 3300031903 Bacteria 806
186 Ga0307409_100473179 3300031995 Bacteria 1214
187 Ga0307416_100031544 3300032002 Bacteria 3991
188 Ga0307416_100387891 3300032002 Bacteria 1430
189 Ga0307416_100549642 3300032002 Bacteria 1228
190 Ga0307414_11666137 3300032004 Bacteria 595
191 Ga0307415_100459996 3300032126 Bacteria 1102
192 Ga0307507_10017829 3300033179 Bacteria 8122
193 Ga0307507_10053956 3300033179 Bacteria 3833
194 Ga0307510_10023073 3300033180 Bacteria 7218
195 Ga0307510_10031752 3300033180 Bacteria 5958
196 Ga0373960_0049582 3300035121 Bacteria 1242
197 Ga0373962_0015607 3300035242 Bacteria 1949
198 Ga0395900_0092122 3300037418 Bacteria 3114
199 Ga0395900_0831748 3300037418 Bacteria 850
200 Ga0395898_0003080 3300037466 Bacteria 18879
201 Ga0395898_0014340 3300037466 Bacteria 8145
202 Ga0395898_0106436 3300037466 Bacteria 2690
203 Ga0395898_1132737 3300037466 Bacteria 715
204 Ga0395905_0355780 3300037471 Bacteria 1357
205 Ga0436364_0645566 3300037853 Bacteria 17181
206 Ga0395901_0249537 3300038443 Bacteria 1849
207 Ga0400483_122074 3300039062 Bacteria 27519
208 Ga0400483_274169 3300039062 Bacteria 27465
209 Ga0439436_0000677 3300041404 Bacteria 9155
210 Ga0439436_0007726 3300041404 Bacteria 3307
211 Ga0439439_0029023 3300041406 Bacteria 1403
212 Ga0451789_0910477 3300041443 Bacteria 586
213 Ga0451791_1040063 3300041451 Bacteria 933
214 Ga0451791_1317664 3300041451 Bacteria 953
215 Ga0451800_1683482 3300041459 Bacteria 981
216 Ga0451802_0027211 3300041460 Bacteria 734
217 Ga0451807_1611693 3300041486 Bacteria 1382
218 Ga0451833_1440405 3300041491 Bacteria 913
219 Ga0451837_0144890 3300041494 Bacteria 2239
220 Ga0451841_0490569 3300041498 Bacteria 617
221 Ga0451849_0309245 3300041505 Bacteria 918
222 Ga0451843_1509281 3300041509 Bacteria 815
223 Ga0451853_0021657 3300041512 Bacteria 2352
224 Ga0451853_0041685 3300041512 Bacteria 1363
225 Ga0451853_1547161 3300041512 Bacteria 667
226 Ga0451853_1597759 3300041512 Bacteria 5102
227 Ga0451853_3661833 3300041512 Bacteria 1854
228 Ga0439433_0001648 3300041999 Bacteria 4653
229 Ga0439433_0089217 3300041999 Bacteria 756
230 Ga0439442_035026 3300042002 Bacteria 1049
231 Ga0439449_0003496 3300042007 Bacteria 6103
232 Ga0439449_0041644 3300042007 Bacteria 1708
233 Ga0439449_0043178 3300042007 Bacteria 1674
234 Ga0439449_0072607 3300042007 Bacteria 1268
235 Ga0439450_068271 3300042008 Bacteria 869
236 Ga0439457_000892 3300042014 Bacteria 9007
237 Ga0439457_001325 3300042014 Bacteria 7422
238 Ga0439462_0127561 3300042015 Bacteria 709
239 Ga0450894_000106 3300042131 Bacteria 14208
240 Ga0450895_000619 3300042132 Bacteria 2137
241 Ga0450896_007236 3300042133 Bacteria 1529
242 Ga0450898_001267 3300042134 Bacteria 3286
243 Ga0450898_048962 3300042134 Bacteria 813
244 Ga0450899_008909 3300042135 Bacteria 1102
245 Ga0450903_002366 3300042138 Bacteria 3365
246 Ga0450906_000159 3300042145 Bacteria 12639
247 Ga0450908_019491 3300042184 Bacteria 1193
248 Ga0466969_0000546 3300044656 Bacteria 20630
249 Ga0466969_0007921 3300044656 Bacteria 5639
250 Ga0466969_0013369 3300044656 Bacteria 4322
251 Ga0466969_0099970 3300044656 Bacteria 1366
252 Ga0466972_0000424 3300044658 Bacteria 21937
253 Ga0466972_0003320 3300044658 Bacteria 7982
254 Ga0466972_0006802 3300044658 Bacteria 5738
255 Ga0466972_0030090 3300044658 Bacteria 2673
256 Ga0466972_0447947 3300044658 Bacteria 606
257 Ga0466965_0002362 3300044683 Bacteria 7992
258 Ga0466965_0004621 3300044683 Bacteria 6131
259 Ga0466965_0005701 3300044683 Bacteria 5616
260 Ga0466965_0090357 3300044683 Bacteria 1557
261 Ga0466965_0112090 3300044683 Bacteria 1402
262 Ga0466965_0150114 3300044683 Bacteria 1218
263 Ga0466966_0000750 3300044684 Bacteria 20552
264 Ga0466966_0001055 3300044684 Bacteria 17604
265 Ga0466966_0013928 3300044684 Bacteria 5324
266 Ga0466966_0128861 3300044684 Bacteria 1550
267 Ga0466966_0274554 3300044684 Bacteria 1014
268 Ga0466961_0005280 3300044693 Bacteria 8130
269 Ga0466961_0010876 3300044693 Bacteria 5813
270 Ga0466961_0027274 3300044693 Bacteria 3672
271 Ga0466961_0084577 3300044693 Bacteria 2006
272 Ga0466961_0155146 3300044693 Bacteria 1428
273 Ga0466961_0404633 3300044693 Bacteria 828
274 Ga0466963_0000109 3300044694 Bacteria 30106
275 Ga0466963_0151396 3300044694 Bacteria 1611
276 Ga0466963_0277979 3300044694 Bacteria 1176
277 Ga0466963_0408738 3300044694 Bacteria 957
278 Ga0466964_0001669 3300044706 Bacteria 7682
279 Ga0466964_0125668 3300044706 Bacteria 1161
280 Ga0466971_0016182 3300044719 Bacteria 3286
281 Ga0466971_0017608 3300044719 Bacteria 3162
282 Ga0466971_0066555 3300044719 Bacteria 1633
283 Ga0466968_0021293 3300044735 Bacteria 2624
284 Ga0466968_0110904 3300044735 Bacteria 1233
285 Ga0466968_0379167 3300044735 Bacteria 690
286 Ga0466970_0000171 3300044765 Bacteria 30809
287 Ga0466970_0004913 3300044765 Bacteria 6600
288 Ga0466970_0077392 3300044765 Bacteria 1793
289 Ga0466970_0216566 3300044765 Bacteria 1068
290 Ga0466957_0000581 3300044842 Bacteria 18492
291 Ga0466957_0069417 3300044842 Bacteria 2177
292 Ga0466957_0077421 3300044842 Bacteria 2066
293 Ga0466957_0631325 3300044842 Bacteria 752
294 Ga0466957_0809202 3300044842 Bacteria 666
295 Ga0466960_0006669 3300044901 Bacteria 4644
296 Ga0466960_0255114 3300044901 Bacteria 975
297 Ga0466959_0001913 3300045049 Bacteria 13101
298 Ga0466959_0003244 3300045049 Bacteria 10585
299 Ga0466959_0006999 3300045049 Bacteria 7881
300 Ga0466959_0059373 3300045049 Bacteria 2785
301 Ga0466959_0329448 3300045049 Bacteria 1043
302 Ga0466958_0001612 3300045836 Bacteria 10858
303 Ga0466958_0318575 3300045836 Bacteria 999
304 Ga0466958_0780162 3300045836 Bacteria 623
305 Ga0466967_0014568 3300045976 Bacteria 6131
306 Ga0466967_0031279 3300045976 Bacteria 4478
307 Ga0466967_0078324 3300045976 Bacteria 2977
308 Ga0466967_0510713 3300045976 Bacteria 1180
309 Ga0466967_0794383 3300045976 Bacteria 940
310 Ga0466967_1210674 3300045976 Bacteria 752
311 Ga0495617_030958 3300046452 Bacteria 1798
312 Ga0495592_0006815 3300046454 Bacteria 8528
313 Ga0495592_0030209 3300046454 Bacteria 4099
314 Ga0495592_0040645 3300046454 Bacteria 3489
315 Ga0495603_0010390 3300046455 Bacteria 5637
316 Ga0495603_0012587 3300046455 Bacteria 5119
317 Ga0495603_0014790 3300046455 Bacteria 4720
318 Ga0495603_0017423 3300046455 Bacteria 4346
319 Ga0495603_0027719 3300046455 Bacteria 3417
320 Ga0495603_0029220 3300046455 Bacteria 3324
321 Ga0495603_0130513 3300046455 Bacteria 1463
322 Ga0495603_0182794 3300046455 Bacteria 1213
323 Ga0495603_0287175 3300046455 Bacteria 945
324 Ga0495603_0335267 3300046455 Bacteria 868
325 Ga0495590_0025435 3300046457 Bacteria 2081
326 Ga0495590_0085351 3300046457 Bacteria 1114
327 Ga0495629_0000763 3300046459 Bacteria 25923
328 Ga0495629_0001125 3300046459 Bacteria 21193
329 Ga0495629_0002352 3300046459 Bacteria 14569
330 Ga0495629_0018204 3300046459 Bacteria 5032
331 Ga0495629_0020001 3300046459 Bacteria 4778
332 Ga0495629_0022998 3300046459 Bacteria 4442
333 Ga0495629_0056039 3300046459 Bacteria 2756
334 Ga0495629_0066640 3300046459 Bacteria 2513
335 Ga0495629_0212322 3300046459 Bacteria 1336
336 Ga0495638_0017645 3300046460 Bacteria 4753
337 Ga0495638_0022169 3300046460 Bacteria 4172
338 Ga0495638_0030766 3300046460 Bacteria 3452
339 Ga0495638_0139546 3300046460 Bacteria 1416
340 Ga0495638_0298877 3300046460 Bacteria 868
341 Ga0495651_0003297 3300046462 Bacteria 12391
342 Ga0495651_0019425 3300046462 Bacteria 5268
343 Ga0495651_0064616 3300046462 Bacteria 2796
344 Ga0495653_0110578 3300046463 Bacteria 1975
345 Ga0495650_0275559 3300046471 Bacteria 567
346 Ga0495580_0050828 3300046472 Bacteria 2930
347 Ga0495580_0065688 3300046472 Bacteria 2541
348 Ga0495582_0019872 3300046473 Bacteria 3674
349 Ga0495582_0217620 3300046473 Bacteria 1092
350 Ga0495605_0010491 3300046474 Bacteria 5181
351 Ga0495639_0010276 3300046475 Bacteria 4027
352 Ga0495639_0578428 3300046475 Bacteria 577
353 Ga0495662_0001181 3300046476 Bacteria 12890
354 Ga0495662_0008465 3300046476 Bacteria 5059
355 Ga0495662_0033850 3300046476 Bacteria 2468
356 Ga0495662_0034895 3300046476 Bacteria 2428
357 Ga0495662_0050710 3300046476 Bacteria 2003
358 Ga0495664_0003330 3300046477 Bacteria 8730
359 Ga0495585_0018249 3300046492 Bacteria 4049
360 Ga0495585_0027318 3300046492 Bacteria 3257
361 Ga0495585_0084813 3300046492 Bacteria 1712
362 Ga0495585_0145086 3300046492 Bacteria 1241
363 Ga0495594_0001243 3300046499 Bacteria 13345
364 Ga0495594_0002889 3300046499 Bacteria 8936
365 Ga0495594_0042434 3300046499 Bacteria 2491
366 Ga0495594_0080283 3300046499 Bacteria 1821
367 Ga0495594_0110520 3300046499 Bacteria 1550
368 Ga0495594_0240583 3300046499 Bacteria 1032
369 Ga0495594_0315758 3300046499 Bacteria 890
370 Ga0495594_0393696 3300046499 Bacteria 788
371 Ga0495596_0262456 3300046500 Bacteria 670
372 Ga0495607_0102582 3300046501 Bacteria 1529
373 Ga0495607_0108428 3300046501 Bacteria 1475
374 Ga0495583_0018225 3300046506 Bacteria 3700
375 Ga0495610_0025019 3300046512 Bacteria 3214
376 Ga0495610_0187904 3300046512 Bacteria 855
377 Ga0495616_0005671 3300046513 Bacteria 7645
378 Ga0495618_0020075 3300046514 Bacteria 4113
379 Ga0495618_0060256 3300046514 Bacteria 2406
380 Ga0495618_0150237 3300046514 Bacteria 1488
381 Ga0495618_0265684 3300046514 Bacteria 1073
382 Ga0495618_0480857 3300046514 Bacteria 751
383 Ga0495620_0009255 3300046515 Bacteria 5245
384 Ga0495620_0122193 3300046515 Bacteria 1025
385 Ga0495620_0154646 3300046515 Bacteria 893
386 Ga0495628_0023674 3300046516 Bacteria 5038
387 Ga0495628_0033610 3300046516 Bacteria 4131
388 Ga0495628_0164216 3300046516 Bacteria 1686
389 Ga0495630_0014351 3300046517 Bacteria 5770
390 Ga0495630_0091961 3300046517 Bacteria 2293
391 Ga0495631_0004895 3300046518 Bacteria 7052
392 Ga0495631_0016807 3300046518 Bacteria 3477
393 Ga0495631_0076072 3300046518 Bacteria 1449
394 Ga0495631_0139758 3300046518 Bacteria 1040
395 Ga0495632_0104096 3300046519 Bacteria 1336
396 Ga0495632_0250828 3300046519 Bacteria 794
397 Ga0495637_0019143 3300046520 Bacteria 3167
398 Ga0495637_0067543 3300046520 Bacteria 1451
399 Ga0495643_0010503 3300046522 Bacteria 5693
400 Ga0495643_0017035 3300046522 Bacteria 4258
401 Ga0495644_0082260 3300046523 Bacteria 1214
402 Ga0495648_0042870 3300046524 Bacteria 2843
403 Ga0495648_0416711 3300046524 Bacteria 596
404 Ga0495666_0063697 3300046526 Bacteria 1760
405 Ga0495666_0086849 3300046526 Bacteria 1477
406 Ga0495666_0146317 3300046526 Bacteria 1100
407 Ga0495642_0038500 3300046528 Bacteria 1938
408 Ga0495642_0082571 3300046528 Bacteria 1355
409 Ga0495652_0056978 3300046529 Bacteria 3316
410 Ga0495652_0071477 3300046529 Bacteria 2896
411 Ga0495652_0249963 3300046529 Bacteria 1314
412 Ga0495654_0032227 3300046530 Bacteria 2657
413 Ga0495640_0024612 3300046533 Bacteria 4378
414 Ga0495640_0070088 3300046533 Bacteria 2357
415 Ga0495640_0126053 3300046533 Bacteria 1661
416 Ga0495640_0280615 3300046533 Bacteria 1037
417 Ga0495586_0141856 3300046535 Bacteria 1349
418 Ga0495587_0004720 3300046536 Bacteria 8941
419 Ga0495587_0173569 3300046536 Bacteria 1224
420 Ga0495609_0044503 3300046538 Bacteria 1990
421 Ga0495609_0158395 3300046538 Bacteria 961
422 Ga0495597_0013132 3300046542 Bacteria 3975
423 Ga0495597_0162826 3300046542 Bacteria 909
424 Ga0495645_0007723 3300046543 Bacteria 7485
425 Ga0495645_0071573 3300046543 Bacteria 2500
426 Ga0495622_0002791 3300046557 Bacteria 8335
427 Ga0495622_0004580 3300046557 Bacteria 6402
428 Ga0495622_0028023 3300046557 Bacteria 2629
429 Ga0495622_0046673 3300046557 Bacteria 2012
430 Ga0495622_0105813 3300046557 Bacteria 1289
431 Ga0495633_0029911 3300046558 Bacteria 2648
432 Ga0495633_0041208 3300046558 Bacteria 2196
433 Ga0495633_0189048 3300046558 Bacteria 947
434 Ga0495667_0110411 3300046559 Bacteria 1777
435 Ga0495667_0157225 3300046559 Bacteria 1462
436 Ga0495656_0067028 3300046615 Bacteria 1583
437 Ga0495668_0010761 3300046616 Bacteria 5524
438 Ga0495668_0030260 3300046616 Bacteria 3057
439 Ga0495634_0001501 3300046642 Bacteria 20644
440 Ga0495634_0017681 3300046642 Bacteria 5084
441 Ga0495634_0025000 3300046642 Bacteria 4186
442 Ga0495611_0060854 3300046648 Bacteria 1715
443 Ga0495611_0070334 3300046648 Bacteria 1599
444 Ga0495625_0017036 3300046660 Bacteria 5695
445 Ga0495625_0043102 3300046660 Bacteria 3274
446 Ga0495625_0057998 3300046660 Bacteria 2751
447 Ga0495625_0087206 3300046660 Bacteria 2164
448 Ga0495625_0109924 3300046660 Bacteria 1885
449 Ga0495625_0111415 3300046660 Bacteria 1870
450 Ga0495635_0000408 3300046663 Bacteria 27373
451 Ga0495635_0132749 3300046663 Bacteria 1697
452 Ga0495661_0337974 3300046665 Bacteria 744
453 Ga0495588_0005045 3300046674 Bacteria 5861
454 Ga0495588_0012624 3300046674 Bacteria 3999
455 Ga0495588_0014145 3300046674 Bacteria 3815
456 Ga0495588_0044079 3300046674 Bacteria 2284
457 Ga0495588_0116761 3300046674 Bacteria 1406
458 Ga0495588_0287815 3300046674 Bacteria 866
459 Ga0495588_0358947 3300046674 Bacteria 765
460 Ga0495657_0002188 3300046675 Bacteria 16568
461 Ga0495657_0011272 3300046675 Bacteria 6694
462 Ga0495657_0025880 3300046675 Bacteria 4162
463 Ga0495657_0026757 3300046675 Bacteria 4081
464 Ga0495657_0065452 3300046675 Bacteria 2390
465 Ga0495599_0122941 3300046678 Bacteria 1613
466 Ga0495623_0023158 3300046679 Bacteria 4008
467 Ga0495646_0003363 3300046680 Bacteria 9948
468 Ga0495658_0029706 3300046683 Bacteria 2962
469 Ga0495613_0008645 3300046689 Bacteria 7555
470 Ga0495613_0017345 3300046689 Bacteria 5365
471 Ga0495613_0028766 3300046689 Bacteria 4133
472 Ga0495613_0041397 3300046689 Bacteria 3412
473 Ga0495613_0051375 3300046689 Bacteria 3038
474 Ga0495613_0089073 3300046689 Bacteria 2235
475 Ga0495613_0107579 3300046689 Bacteria 2011
476 Ga0495613_0124730 3300046689 Bacteria 1847
477 Ga0495613_0133584 3300046689 Bacteria 1776
478 Ga0495613_0342453 3300046689 Bacteria 1028
479 Ga0495624_0022326 3300046690 Bacteria 4185
480 Ga0495624_0028651 3300046690 Bacteria 3637
481 Ga0495624_0571539 3300046690 Bacteria 674
482 Ga0495670_0004511 3300046691 Bacteria 6824
483 Ga0495670_0248746 3300046691 Bacteria 947
484 Ga0495671_0016068 3300046692 Bacteria 4002
485 Ga0495649_0008303 3300046694 Bacteria 6251
486 Ga0495649_0031689 3300046694 Bacteria 2914
487 Ga0495649_0077038 3300046694 Bacteria 1785
488 Ga0495649_0103838 3300046694 Bacteria 1509
489 Ga0495589_0009354 3300046794 Bacteria 5096
490 Ga0495589_0009504 3300046794 Bacteria 5054
491 Ga0495589_0013267 3300046794 Bacteria 4253
492 Ga0495589_0040584 3300046794 Bacteria 2324
493 Ga0495589_0144959 3300046794 Bacteria 1136
494 Ga0495600_0089362 3300046809 Bacteria 2009
495 Ga0495600_0209504 3300046809 Bacteria 1249
496 Ga0495600_0344517 3300046809 Bacteria 934
497 Ga0495660_0001994 3300046810 Bacteria 13286
498 Ga0495660_0042850 3300046810 Bacteria 2499
499 Ga0495660_0058955 3300046810 Bacteria 2065
500 Ga0495660_0132463 3300046810 Bacteria 1249
501 Ga0495581_0012417 3300047315 Bacteria 4935
502 Ga0495581_0037683 3300047315 Bacteria 2799
503 Ga0495581_0151060 3300047315 Bacteria 1356
504 Ga0495581_0178098 3300047315 Bacteria 1243
505 Ga0495604_0000920 3300047317 Bacteria 24512
506 Ga0495604_0129623 3300047317 Bacteria 1814
507 Ga0495636_0003117 3300047318 Bacteria 6427
508 Ga0495636_0003438 3300047318 Bacteria 6142
509 Ga0495636_0018273 3300047318 Bacteria 2812
510 Ga0495636_0035038 3300047318 Bacteria 2067
511 Ga0495636_0048625 3300047318 Bacteria 1773
512 Ga0495636_0053817 3300047318 Bacteria 1690
513 Ga0495636_0062567 3300047318 Bacteria 1575
514 Ga0495636_0129732 3300047318 Bacteria 1121
515 Ga0495636_0254890 3300047318 Bacteria 812
516 Ga0495674_0070014 3300047319 Bacteria 3032
517 Ga0495674_0084831 3300047319 Bacteria 2714
518 Ga0495672_0038501 3300047320 Bacteria 2916
519 Ga0495676_0009717 3300047321 Bacteria 8746
520 Ga0495676_0017221 3300047321 Bacteria 6395
521 Ga0495676_0028759 3300047321 Bacteria 4742
522 Ga0495676_0031605 3300047321 Bacteria 4474
523 Ga0495676_0035387 3300047321 Bacteria 4177
524 Ga0495676_0214560 3300047321 Bacteria 1329
525 Ga0495676_0266427 3300047321 Bacteria 1164
526 Ga0495676_0798823 3300047321 Bacteria 607
527 Ga0495680_0131788 3300047322 Bacteria 1836
528 Ga0495683_0035929 3300047323 Bacteria 2517
529 Ga0495683_0053053 3300047323 Bacteria 2022
530 Ga0495683_0189676 3300047323 Bacteria 933
531 Ga0495687_002642 3300047443 Bacteria 14003
532 Ga0495687_008731 3300047443 Bacteria 5754
533 Ga0495687_029870 3300047443 Bacteria 2515
534 Ga0495675_0012817 3300047444 Bacteria 5282
535 Ga0495675_0014026 3300047444 Bacteria 5066
536 Ga0495675_0042456 3300047444 Bacteria 2897
537 Ga0495677_0105235 3300047445 Bacteria 1070
538 Ga0495677_0191451 3300047445 Bacteria 794
539 Ga0495677_0253913 3300047445 Bacteria 688
540 Ga0495685_000133 3300047447 Bacteria 25839
541 Ga0495685_007228 3300047447 Bacteria 3660
542 Ga0495685_038711 3300047447 Bacteria 1633
543 Ga0495685_065688 3300047447 Bacteria 1219
544 Ga0495685_066139 3300047447 Bacteria 1215
545 Ga0495681_0009498 3300047470 Bacteria 5983
546 Ga0495681_0012112 3300047470 Bacteria 5082
547 Ga0495681_0051621 3300047470 Bacteria 1933
548 Ga0495681_0247800 3300047470 Bacteria 704
549 Ga0495684_0272521 3300047471 Bacteria 1224
550 Ga0495684_0447525 3300047471 Bacteria 898
551 Ga0495686_0004762 3300047472 Bacteria 10979
552 Ga0495686_0059871 3300047472 Bacteria 2369
553 Ga0495686_0118841 3300047472 Bacteria 1578
554 Ga0495686_0177322 3300047472 Bacteria 1236
555 Ga0495593_0005290 3300047673 Bacteria 7625
556 Ga0495593_0026491 3300047673 Bacteria 3200
557 Ga0495593_0075975 3300047673 Bacteria 1741
558 Ga0495593_0102829 3300047673 Bacteria 1464
559 Ga0495593_0170585 3300047673 Bacteria 1097
560 Ga0495593_0215536 3300047673 Bacteria 964
561 Ga0495593_0515481 3300047673 Bacteria 599
562 Ga0495602_0016998 3300048088 Bacteria 7299
563 Ga0495614_0000594 3300048089 Bacteria 15141
564 Ga0495614_0003174 3300048089 Bacteria 7339
565 Ga0495626_0010193 3300048091 Bacteria 5038
566 Ga0496102_0445276 3300048905 Bacteria 1215
567 Ga0496103_0354133 3300048906 Bacteria 944
568 Ga0496104_0079888 3300048907 Bacteria 3117
569 Ga0496104_0474666 3300048907 Bacteria 1162
570 Ga0496105_0085955 3300048908 Bacteria 2599
571 Ga0496106_0542662 3300048909 Bacteria 933
572 Ga0496107_0689181 3300048910 Bacteria 752
573 Ga0496108_0145469 3300048911 Bacteria 2043
574 Ga0496108_0469500 3300048911 Bacteria 1099
575 Ga0496108_0849829 3300048911 Bacteria 785
576 Ga0496109_0029382 3300048912 Bacteria 4923
577 Ga0496109_0063537 3300048912 Bacteria 3377
578 Ga0496109_0325928 3300048912 Bacteria 1450
579 Ga0496110_0295898 3300048913 Bacteria 1474
580 Ga0496110_1098724 3300048913 Bacteria 703
581 Ga0496110_1228932 3300048913 Bacteria 658
582 Ga0496111_0017686 3300048914 Bacteria 4930
583 Ga0496112_0289441 3300048915 Bacteria 1584
584 Ga0496112_0568319 3300048915 Bacteria 1067
585 Ga0496112_0613296 3300048915 Unclassified 1019
586 Ga0496113_0002493 3300048916 Bacteria 10722
587 Ga0496115_0488535 3300048918 Bacteria 991
588 Ga0496119_0347025 3300048922 Bacteria 720
589 Ga0496123_0220181 3300048926 Bacteria 958
590 Ga0496124_0068026 3300048927 Bacteria 2962
591 Ga0496126_0052554 3300048929 Bacteria 3702
592 Ga0495678_076067 3300049459 Bacteria 1217
593 Ga0501031_0005905 3300049568 Bacteria 7978
594 Ga0501031_0010593 3300049568 Bacteria 6002
595 Ga0501031_0054865 3300049568 Bacteria 2596
596 Ga0501031_0072552 3300049568 Bacteria 2241
597 Ga0501031_0259044 3300049568 Bacteria 1130
598 Ga0501032_0002976 3300049569 Bacteria 13151
599 Ga0501032_0012268 3300049569 Bacteria 6132
600 Ga0501032_0095318 3300049569 Bacteria 1973
601 Ga0501032_0450669 3300049569 Bacteria 824
602 Ga0501033_0001682 3300049570 Bacteria 19357
603 Ga0501033_0003976 3300049570 Bacteria 11979
604 Ga0501033_0010783 3300049570 Bacteria 7008
605 Ga0501033_0014812 3300049570 Bacteria 5921
606 Ga0501033_0081610 3300049570 Bacteria 2371
607 Ga0501033_0084519 3300049570 Bacteria 2326
608 Ga0501033_0130248 3300049570 Bacteria 1823
609 Ga0501033_0154730 3300049570 Bacteria 1652
610 Ga0501034_0020902 3300049571 Bacteria 6681
611 Ga0501034_0024322 3300049571 Bacteria 6160
612 Ga0501034_0031003 3300049571 Bacteria 5434
613 Ga0501034_0031323 3300049571 Bacteria 5402
614 Ga0501034_0088988 3300049571 Bacteria 3085
615 Ga0501034_0149082 3300049571 Bacteria 2315
616 Ga0501034_0158505 3300049571 Bacteria 2236
617 Ga0501034_0615871 3300049571 Bacteria 990
618 Ga0501034_1196162 3300049571 Bacteria 639
619 Ga0501036_0000603 3300049572 Bacteria 26056
620 Ga0501036_0004107 3300049572 Bacteria 11716
621 Ga0501036_0006344 3300049572 Bacteria 9596
622 Ga0501036_0020231 3300049572 Bacteria 5589
623 Ga0501036_0037289 3300049572 Bacteria 4113
624 Ga0501036_0117598 3300049572 Bacteria 2245
625 Ga0501036_0672406 3300049572 Bacteria 856
626 Ga0501037_0000832 3300049573 Bacteria 23045
627 Ga0501037_0012131 3300049573 Bacteria 6345
628 Ga0501037_0025200 3300049573 Bacteria 4395
629 Ga0501037_0237019 3300049573 Bacteria 1280
630 Ga0501037_0320433 3300049573 Bacteria 1073
631 Ga0501038_0000231 3300049574 Bacteria 47327
632 Ga0501038_0009979 3300049574 Bacteria 8695
633 Ga0501038_0112289 3300049574 Bacteria 2256
634 Ga0501038_0124225 3300049574 Bacteria 2125
635 Ga0501038_0151604 3300049574 Bacteria 1889
636 Ga0501038_0197042 3300049574 Bacteria 1618
637 Ga0501039_0003296 3300049575 Bacteria 12069
638 Ga0501039_0011475 3300049575 Bacteria 6742
639 Ga0501039_0267645 3300049575 Bacteria 1343
640 Ga0501039_0611561 3300049575 Bacteria 854
641 Ga0501040_0005861 3300049576 Bacteria 7953
642 Ga0501042_0015032 3300049578 Bacteria 5293
643 Ga0501042_0402132 3300049578 Bacteria 992
644 Ga0501043_0002088 3300049579 Bacteria 17067
645 Ga0501043_0002774 3300049579 Bacteria 14645
646 Ga0501043_0004088 3300049579 Bacteria 11922
647 Ga0501043_0043971 3300049579 Bacteria 3511
648 Ga0501043_0168484 3300049579 Bacteria 1709
649 Ga0501043_0287753 3300049579 Bacteria 1258
650 Ga0501043_0335673 3300049579 Bacteria 1150
651 Ga0501046_0003833 3300049580 Bacteria 13759
652 Ga0501046_0009593 3300049580 Bacteria 8351
653 Ga0501046_0041476 3300049580 Bacteria 3672
654 Ga0501046_0157102 3300049580 Bacteria 1712
655 Ga0501047_0008070 3300049581 Bacteria 9932
656 Ga0501047_0012570 3300049581 Bacteria 8018
657 Ga0501047_0032534 3300049581 Bacteria 5035
658 Ga0501047_0036474 3300049581 Bacteria 4751
659 Ga0501047_0039284 3300049581 Bacteria 4577
660 Ga0501047_0061622 3300049581 Bacteria 3619
661 Ga0501047_0192917 3300049581 Bacteria 1900
662 Ga0501047_0226469 3300049581 Bacteria 1724
663 Ga0501047_0251957 3300049581 Bacteria 1614
664 Ga0501047_0562311 3300049581 Bacteria 964
665 Ga0501048_0003964 3300049582 Bacteria 11246
666 Ga0501048_0017476 3300049582 Bacteria 5281
667 Ga0501048_0060025 3300049582 Bacteria 2695
668 Ga0501048_0070219 3300049582 Bacteria 2474
669 Ga0501048_0215026 3300049582 Bacteria 1363
670 Ga0501068_0006308 3300049584 Bacteria 6532
671 Ga0501068_0481735 3300049584 Bacteria 804
672 Ga0501069_0003540 3300049585 Bacteria 8037
673 Ga0501070_0015281 3300049586 Bacteria 6459
674 Ga0501070_0307453 3300049586 Bacteria 1291
675 Ga0501070_0511826 3300049586 Bacteria 964
676 Ga0501070_0770181 3300049586 Bacteria 757
677 Ga0501070_0830601 3300049586 Bacteria 724
678 Ga0501070_1126472 3300049586 Bacteria 604
679 Ga0501071_0005287 3300049587 Bacteria 8282
680 Ga0501072_0002025 3300049588 Bacteria 15080
681 Ga0501072_1066324 3300049588 Bacteria 629
682 Ga0501073_0122461 3300049589 Bacteria 1802
683 Ga0501073_0317574 3300049589 Bacteria 1075
684 Ga0501074_0006619 3300049590 Bacteria 8378
685 Ga0501074_0221398 3300049590 Bacteria 1347
686 Ga0501074_0606561 3300049590 Bacteria 774
687 Ga0501076_0210350 3300049592 Bacteria 1589
688 Ga0501077_0009138 3300049593 Bacteria 6154
689 Ga0501223_069603 3300049663 Bacteria 694
690 Ga0501235_050762 3300049669 Bacteria 961
691 Ga0501079_0007274 3300049741 Bacteria 8358
692 Ga0501080_0275758 3300049742 Bacteria 1530
693 Ga0501080_0319627 3300049742 Bacteria 1405
694 Ga0501080_0815672 3300049742 Bacteria 817
695 Ga0501083_0000743 3300049744 Bacteria 21288
696 Ga0501083_0333833 3300049744 Bacteria 986
697 Ga0501282_002532 3300049778 Bacteria 1982
698 Ga0501035_0004966 3300049822 Bacteria 12612
699 Ga0501035_0026001 3300049822 Bacteria 5362
700 Ga0501035_0036046 3300049822 Bacteria 4485
701 Ga0501035_0057671 3300049822 Bacteria 3461
702 Ga0501035_0082275 3300049822 Bacteria 2841
703 Ga0501035_0097265 3300049822 Bacteria 2585
704 Ga0501035_0198038 3300049822 Bacteria 1724
705 Ga0501035_0308221 3300049822 Bacteria 1332
706 Ga0501035_0762469 3300049822 Bacteria 776
707 Ga0501044_0004352 3300049823 Bacteria 15862
708 Ga0501044_0005219 3300049823 Bacteria 14455
709 Ga0501044_0005493 3300049823 Bacteria 14083
710 Ga0501044_0012492 3300049823 Bacteria 9195
711 Ga0501044_0016519 3300049823 Bacteria 7921
712 Ga0501044_0053364 3300049823 Bacteria 4159
713 Ga0501044_0117849 3300049823 Bacteria 2659
714 Ga0501044_0304081 3300049823 Bacteria 1523
715 Ga0501044_0470222 3300049823 Bacteria 1161
716 Ga0501044_0578692 3300049823 Bacteria 1017
717 Ga0501044_0825538 3300049823 Bacteria 805
718 Ga0501045_0381768 3300049824 Bacteria 1049
719 nmdc:mga03683_377297_c1 3300050489 Bacteria 674
720 nmdc:mga03n38_83388_c1 3300050490 Bacteria 1507
721 nmdc:mga06z11_127060_c1 3300050494 Bacteria 1428
722 nmdc:mga04h51_6120_c1 3300050495 Bacteria 3102
723 nmdc:mga07m45_77589_c1 3300050496 Bacteria 1895
724 Ga0495619_0242673 3300053085 Bacteria 1248
725 Ga0500578_0114814 3300053086 Bacteria 1695
726 Ga0500578_0322575 3300053086 Bacteria 910
727 Ga0500644_0010133 3300053088 Bacteria 2543
728 Ga0500644_0023261 3300053088 Bacteria 1880
729 Ga0500646_0000359 3300053090 Bacteria 13745
730 Ga0500646_0052212 3300053090 Bacteria 1183
731 Ga0500583_0246741 3300053092 Bacteria 882
732 Ga0500640_011796 3300053095 Bacteria 3570
733 Ga0500654_063823 3300053099 Bacteria 1860
734 Ga0500553_077472 3300053101 Bacteria 1508
735 Ga0500560_010149 3300053107 Bacteria 2346
736 Ga0500560_024191 3300053107 Bacteria 1770
737 Ga0500569_003921 3300053109 Bacteria 3086
738 Ga0500572_006235 3300053111 Bacteria 2727
739 Ga0500594_0128135 3300053118 Bacteria 802
740 Ga0500617_112577 3300053124 Bacteria 1135
741 Ga0500628_002210 3300053129 Bacteria 3250
742 Ga0500652_003648 3300053131 Bacteria 4683
743 Ga0500658_0001635 3300053134 Bacteria 8933
744 Ga0500559_0003914 3300053136 Bacteria 7190
745 Ga0500561_0002416 3300053137 Bacteria 3142
746 Ga0500568_0140902 3300053139 Bacteria 894
747 Ga0500573_0037191 3300053140 Bacteria 2812
748 Ga0500573_0089299 3300053140 Bacteria 1743
749 Ga0500577_0014784 3300053142 Bacteria 2422
750 Ga0500577_0111670 3300053142 Bacteria 1129
751 Ga0500579_087240 3300053143 Bacteria 1707
752 Ga0500588_0002851 3300053146 Bacteria 3584
753 Ga0500588_0277734 3300053146 Bacteria 632
754 Ga0500600_0019800 3300053149 Bacteria 4049
755 Ga0500616_0336230 3300053153 Bacteria 618
756 Ga0500622_0235644 3300053156 Bacteria 812
757 Ga0500633_0038105 3300053160 Bacteria 1599
758 Ga0500634_0009835 3300053161 Bacteria 4862
759 Ga0500634_0177886 3300053161 Bacteria 961
760 Ga0500656_000596 3300053732 Bacteria 2767
761 Ga0500587_002964 3300053739 Bacteria 2403
762 Ga0501084_0100963 3300054114 Bacteria 2423
763 Ga0587122_011395 3300059628 Bacteria 854
764 Ga0501082_0051593 3300060353 Bacteria 3545
765 Ga0466962_0000168 3300061719 Bacteria 27818
766 Ga0466962_0110057 3300061719 Bacteria 1326
767 Ga0466962_0192325 3300061719 Bacteria 996
768 Ga0530510_0148368 3300061734 Bacteria 1730

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041509 Ga0451843_1509281 Ga0451843_1509281_183_743 158
2 3300044658 Ga0466972_0447947 Ga0466972_0447947_14_538 160
3 3300044765 Ga0466970_0077392 Ga0466970_0077392_880_1404 160
4 3300045049 Ga0466959_0059373 Ga0466959_0059373_1770_2294 160
5 3300048927 Ga0496124_0068026 Ga0496124_0068026_2267_2791 160
6 3300049588 Ga0501072_1066324 Ga0501072_1066324_112_615 164
7 3300005436 Ga0070713_100766211 Ga0070713_1007662111 167
8 3300006844 Ga0075428_100687618 Ga0075428_1006876182 172
9 3300005347 Ga0070668_100003878 Ga0070668_1000038787 173
10 3300005367 Ga0070667_101154676 Ga0070667_1011546762 173
11 3300005455 Ga0070663_100000450 Ga0070663_1000004502 173
12 3300005455 Ga0070663_100010974 Ga0070663_1000109741 173
13 3300031852 Ga0307410_10218052 Ga0307410_102180523 173
14 3300032002 Ga0307416_100031544 Ga0307416_1000315443 173
15 3300046455 Ga0495603_0027719 Ga0495603_0027719_500_1024 173
16 3300046459 Ga0495629_0000763 Ga0495629_0000763_5015_5539 173
17 3300046499 Ga0495594_0393696 Ga0495594_0393696_103_627 173
18 3300046689 Ga0495613_0124730 Ga0495613_0124730_1267_1791 173
19 3300047321 Ga0495676_0028759 Ga0495676_0028759_122_646 173
20 3300047673 Ga0495593_0170585 Ga0495593_0170585_116_640 173
21 3300048089 Ga0495614_0000594 Ga0495614_0000594_5686_6210 173
22 3300003203 JGI25406J46586_10010577 JGI25406J46586_100105772 174
23 3300003316 rootH1_10034127 rootH1_100341277 174
24 3300003320 rootH2_10080827 rootH2_100808271 174
25 3300003354 JGI25160J50197_1010101 JGI25160J50197_10101013 174
26 3300003354 JGI25160J50197_1034468 JGI25160J50197_10344682 174
27 3300005329 Ga0070683_100083517 Ga0070683_1000835173 174
28 3300005329 Ga0070683_100860236 Ga0070683_1008602361 174
29 3300005339 Ga0070660_100873306 Ga0070660_1008733062 174
30 3300005344 Ga0070661_100419672 Ga0070661_1004196722 174
31 3300005344 Ga0070661_100610961 Ga0070661_1006109612 174
32 3300005354 Ga0070675_100748090 Ga0070675_1007480901 174
33 3300005355 Ga0070671_100628646 Ga0070671_1006286462 174
34 3300005356 Ga0070674_100024269 Ga0070674_1000242693 174
35 3300005356 Ga0070674_100118821 Ga0070674_1001188211 174
36 3300005366 Ga0070659_100879752 Ga0070659_1008797522 174
37 3300005434 Ga0070709_10822967 Ga0070709_108229671 174
38 3300005436 Ga0070713_100506843 Ga0070713_1005068432 174
39 3300005437 Ga0070710_10000158 Ga0070710_1000015825 174
40 3300005455 Ga0070663_100830547 Ga0070663_1008305471 174
41 3300005456 Ga0070678_100630777 Ga0070678_1006307772 174
42 3300005456 Ga0070678_100815706 Ga0070678_1008157062 174
43 3300005458 Ga0070681_11083702 Ga0070681_110837021 174
44 3300005459 Ga0068867_100672415 Ga0068867_1006724152 174
45 3300005466 Ga0070685_10000870 Ga0070685_1000087011 174
46 3300005530 Ga0070679_100454802 Ga0070679_1004548022 174
47 3300005535 Ga0070684_100024815 Ga0070684_1000248153 174
48 3300005535 Ga0070684_100121900 Ga0070684_1001219003 174
49 3300005535 Ga0070684_100159679 Ga0070684_1001596792 174
50 3300005535 Ga0070684_100459058 Ga0070684_1004590582 174
51 3300005535 Ga0070684_100633499 Ga0070684_1006334991 174
52 3300005539 Ga0068853_100010969 Ga0068853_1000109697 174
53 3300005539 Ga0068853_100125636 Ga0068853_1001256361 174
54 3300005539 Ga0068853_101775563 Ga0068853_1017755631 174
55 3300005548 Ga0070665_100040185 Ga0070665_1000401852 174
56 3300005548 Ga0070665_100232242 Ga0070665_1002322424 174
57 3300005564 Ga0070664_100057265 Ga0070664_1000572653 174
58 3300005577 Ga0068857_100139912 Ga0068857_1001399123 174
59 3300005578 Ga0068854_100913560 Ga0068854_1009135602 174
60 3300005614 Ga0068856_100239250 Ga0068856_1002392503 174
61 3300005616 Ga0068852_100542870 Ga0068852_1005428702 174
62 3300005616 Ga0068852_101279811 Ga0068852_1012798112 174
63 3300005618 Ga0068864_100012137 Ga0068864_1000121373 174
64 3300005719 Ga0068861_100424784 Ga0068861_1004247841 174
65 3300005841 Ga0068863_100193177 Ga0068863_1001931771 174
66 3300005841 Ga0068863_101494873 Ga0068863_1014948731 174
67 3300005842 Ga0068858_100253821 Ga0068858_1002538212 174
68 3300005937 Ga0081455_10339733 Ga0081455_103397332 174
69 3300005981 Ga0081538_10001098 Ga0081538_1000109820 174
70 3300005983 Ga0081540_1086172 Ga0081540_10861722 174
71 3300005985 Ga0081539_10000173 Ga0081539_1000017355 174
72 3300006028 Ga0070717_10188534 Ga0070717_101885342 174
73 3300006028 Ga0070717_10382673 Ga0070717_103826731 174
74 3300006042 Ga0075368_10019948 Ga0075368_100199482 174
75 3300006048 Ga0075363_100024448 Ga0075363_1000244483 174
76 3300006173 Ga0070716_100257080 Ga0070716_1002570802 174
77 3300006178 Ga0075367_10001478 Ga0075367_100014787 174
78 3300006358 Ga0068871_100911839 Ga0068871_1009118392 174
79 3300006847 Ga0075431_100385224 Ga0075431_1003852242 174
80 3300006880 Ga0075429_100001872 Ga0075429_10000187210 174
81 3300006880 Ga0075429_100079501 Ga0075429_1000795013 174
82 3300006948 Ga0099826_10050777 Ga0099826_100507771 174
83 3300009011 Ga0105251_10008794 Ga0105251_100087943 174
84 3300009094 Ga0111539_11815165 Ga0111539_118151651 174
85 3300009098 Ga0105245_10369678 Ga0105245_103696782 174
86 3300009098 Ga0105245_10513312 Ga0105245_105133121 174
87 3300009101 Ga0105247_10179591 Ga0105247_101795912 174
88 3300009147 Ga0114129_12618001 Ga0114129_126180011 174
89 3300009148 Ga0105243_10572832 Ga0105243_105728322 174
90 3300009177 Ga0105248_10034305 Ga0105248_100343054 174
91 3300009177 Ga0105248_10614652 Ga0105248_106146522 174
92 3300009551 Ga0105238_10607689 Ga0105238_106076892 174
93 3300009551 Ga0105238_10745308 Ga0105238_107453082 174
94 3300009553 Ga0105249_10222611 Ga0105249_102226111 174
95 3300011119 Ga0105246_10002882 Ga0105246_100028823 174
96 3300011119 Ga0105246_10537800 Ga0105246_105378002 174
97 3300012490 Ga0157322_1008915 Ga0157322_10089152 174
98 3300012503 Ga0157313_1001614 Ga0157313_10016142 174
99 3300013105 Ga0157369_10062288 Ga0157369_100622883 174
100 3300013296 Ga0157374_11129171 Ga0157374_111291712 174
101 3300013306 Ga0163162_11845321 Ga0163162_118453211 174
102 3300013307 Ga0157372_10077506 Ga0157372_100775064 174
103 3300013308 Ga0157375_10361097 Ga0157375_103610972 174
104 3300014325 Ga0163163_10002986 Ga0163163_100029867 174
105 3300014325 Ga0163163_10044342 Ga0163163_100443424 174
106 3300014325 Ga0163163_11036005 Ga0163163_110360052 174
107 3300014326 Ga0157380_12074321 Ga0157380_120743211 174
108 3300014497 Ga0182008_10008823 Ga0182008_100088232 174
109 3300014745 Ga0157377_10737251 Ga0157377_107372511 174
110 3300014968 Ga0157379_10078837 Ga0157379_100788372 174
111 3300014968 Ga0157379_10305055 Ga0157379_103050552 174
112 3300014969 Ga0157376_11861728 Ga0157376_118617281 174
113 3300015261 Ga0182006_1013159 Ga0182006_10131592 174
114 3300015262 Ga0182007_10000817 Ga0182007_100008173 174
115 3300015688 Ga0183367_1002 Ga0183367_1002376 174
116 3300021388 Ga0213875_10002957 Ga0213875_100029577 174
117 3300025297 Ga0209758_1014489 Ga0209758_10144893 174
118 3300025302 Ga0207426_1001306 Ga0207426_100130613 174
119 3300025302 Ga0207426_1001848 Ga0207426_10018486 174
120 3300025302 Ga0207426_1002757 Ga0207426_10027575 174
121 3300025302 Ga0207426_1010918 Ga0207426_10109184 174
122 3300025735 Ga0207713_1032563 Ga0207713_10325633 174
123 3300025898 Ga0207692_10009605 Ga0207692_100096053 174
124 3300025906 Ga0207699_10151302 Ga0207699_101513022 174
125 3300025912 Ga0207707_10646139 Ga0207707_106461392 174
126 3300025916 Ga0207663_10347687 Ga0207663_103476871 174
127 3300025920 Ga0207649_11294285 Ga0207649_112942851 174
128 3300025924 Ga0207694_10620977 Ga0207694_106209772 174
129 3300025924 Ga0207694_10621337 Ga0207694_106213371 174
130 3300025927 Ga0207687_10293450 Ga0207687_102934501 174
131 3300025928 Ga0207700_10438357 Ga0207700_104383571 174
132 3300025928 Ga0207700_10873607 Ga0207700_108736071 174
133 3300025929 Ga0207664_10005716 Ga0207664_100057162 174
134 3300025934 Ga0207686_10477905 Ga0207686_104779051 174
135 3300025937 Ga0207669_10016652 Ga0207669_100166523 174
136 3300025937 Ga0207669_10080358 Ga0207669_100803583 174
137 3300025941 Ga0207711_10098123 Ga0207711_100981233 174
138 3300025945 Ga0207679_10106311 Ga0207679_101063112 174
139 3300025981 Ga0207640_10372940 Ga0207640_103729402 174
140 3300026041 Ga0207639_10456527 Ga0207639_104565271 174
141 3300026078 Ga0207702_11503955 Ga0207702_115039551 174
142 3300026121 Ga0207683_11377686 Ga0207683_113776862 174
143 3300026142 Ga0207698_11024681 Ga0207698_110246811 174
144 3300027866 Ga0209813_10005391 Ga0209813_100053912 174
145 3300028379 Ga0268266_10012541 Ga0268266_100125412 174
146 3300028379 Ga0268266_10478045 Ga0268266_104780452 174
147 3300028379 Ga0268266_10505727 Ga0268266_105057272 174
148 3300028380 Ga0268265_10000008 Ga0268265_10000008201 174
149 3300028786 Ga0307517_10001976 Ga0307517_1000197637 174
150 3300028786 Ga0307517_10010759 Ga0307517_100107596 174
151 3300028794 Ga0307515_10000573 Ga0307515_100005739 174
152 3300028794 Ga0307515_10056033 Ga0307515_100560333 174
153 3300028794 Ga0307515_10409932 Ga0307515_104099322 174
154 3300030521 Ga0307511_10002078 Ga0307511_1000207814 174
155 3300030521 Ga0307511_10019025 Ga0307511_100190251 174
156 3300030522 Ga0307512_10046279 Ga0307512_100462792 174
157 3300030522 Ga0307512_10060881 Ga0307512_100608812 174
158 3300030745 Ga0316182_1181641 Ga0316182_11816411 174
159 3300031456 Ga0307513_10020470 Ga0307513_100204703 174
160 3300031507 Ga0307509_10227715 Ga0307509_102277152 174
161 3300031507 Ga0307509_10228616 Ga0307509_102286163 174
162 3300031616 Ga0307508_10012239 Ga0307508_100122393 174
163 3300031616 Ga0307508_10012977 Ga0307508_100129774 174
164 3300031616 Ga0307508_10036728 Ga0307508_100367285 174
165 3300031616 Ga0307508_10037736 Ga0307508_100377364 174
166 3300031616 Ga0307508_10131454 Ga0307508_101314543 174
167 3300031616 Ga0307508_10348546 Ga0307508_103485462 174
168 3300031649 Ga0307514_10002934 Ga0307514_100029343 174
169 3300031649 Ga0307514_10100336 Ga0307514_101003363 174
170 3300031649 Ga0307514_10138027 Ga0307514_101380271 174
171 3300031730 Ga0307516_10011280 Ga0307516_100112804 174
172 3300031730 Ga0307516_10075768 Ga0307516_100757683 174
173 3300031730 Ga0307516_10181201 Ga0307516_101812013 174
174 3300031730 Ga0307516_10216060 Ga0307516_102160602 174
175 3300031730 Ga0307516_10422406 Ga0307516_104224061 174
176 3300031824 Ga0307413_10483676 Ga0307413_104836762 174
177 3300031824 Ga0307413_10489999 Ga0307413_104899992 174
178 3300031838 Ga0307518_10000112 Ga0307518_1000011235 174
179 3300031838 Ga0307518_10033606 Ga0307518_100336062 174
180 3300031901 Ga0307406_10608627 Ga0307406_106086272 174
181 3300031903 Ga0307407_10176598 Ga0307407_101765982 174
182 3300031903 Ga0307407_10622535 Ga0307407_106225352 174
183 3300031995 Ga0307409_100473179 Ga0307409_1004731792 174
184 3300032002 Ga0307416_100387891 Ga0307416_1003878912 174
185 3300032002 Ga0307416_100549642 Ga0307416_1005496422 174
186 3300032004 Ga0307414_11666137 Ga0307414_116661371 174
187 3300032126 Ga0307415_100459996 Ga0307415_1004599962 174
188 3300033179 Ga0307507_10017829 Ga0307507_100178293 174
189 3300033179 Ga0307507_10053956 Ga0307507_100539563 174
190 3300033180 Ga0307510_10023073 Ga0307510_100230733 174
191 3300033180 Ga0307510_10031752 Ga0307510_100317524 174
192 3300035121 Ga0373960_0049582 Ga0373960_0049582_156_683 174
193 3300035242 Ga0373962_0015607 Ga0373962_0015607_1014_1541 174
194 3300037418 Ga0395900_0092122 Ga0395900_0092122_203_727 174
195 3300037418 Ga0395900_0831748 Ga0395900_0831748_111_635 174
196 3300037466 Ga0395898_0003080 Ga0395898_0003080_15535_16059 174
197 3300037466 Ga0395898_0014340 Ga0395898_0014340_4157_4681 174
198 3300037466 Ga0395898_0106436 Ga0395898_0106436_2102_2626 174
199 3300037466 Ga0395898_1132737 Ga0395898_1132737_10_534 174
200 3300037471 Ga0395905_0355780 Ga0395905_0355780_415_939 174
201 3300037853 Ga0436364_0645566 Ga0436364_0645566_11322_11846 174
202 3300038443 Ga0395901_0249537 Ga0395901_0249537_474_998 174
203 3300039062 Ga0400483_122074 Ga0400483_122074_12455_12988 174
204 3300039062 Ga0400483_274169 Ga0400483_274169_14574_15107 174
205 3300041404 Ga0439436_0000677 Ga0439436_0000677_54_578 174
206 3300041404 Ga0439436_0007726 Ga0439436_0007726_546_1070 174
207 3300041406 Ga0439439_0029023 Ga0439439_0029023_98_625 174
208 3300041443 Ga0451789_0910477 Ga0451789_0910477_17_541 174
209 3300041451 Ga0451791_1040063 Ga0451791_1040063_146_673 174
210 3300041451 Ga0451791_1317664 Ga0451791_1317664_133_657 174
211 3300041459 Ga0451800_1683482 Ga0451800_1683482_371_895 174
212 3300041460 Ga0451802_0027211 Ga0451802_0027211_37_564 174
213 3300041486 Ga0451807_1611693 Ga0451807_1611693_437_964 174
214 3300041491 Ga0451833_1440405 Ga0451833_1440405_265_789 174
215 3300041494 Ga0451837_0144890 Ga0451837_0144890_847_1371 174
216 3300041498 Ga0451841_0490569 Ga0451841_0490569_20_544 174
217 3300041505 Ga0451849_0309245 Ga0451849_0309245_372_896 174
218 3300041512 Ga0451853_0021657 Ga0451853_0021657_1363_1890 174
219 3300041512 Ga0451853_0041685 Ga0451853_0041685_350_874 174
220 3300041512 Ga0451853_1547161 Ga0451853_1547161_11_535 174
221 3300041512 Ga0451853_1597759 Ga0451853_1597759_4231_4755 174
222 3300041512 Ga0451853_3661833 Ga0451853_3661833_338_865 174
223 3300041999 Ga0439433_0001648 Ga0439433_0001648_3719_4243 174
224 3300041999 Ga0439433_0089217 Ga0439433_0089217_170_694 174
225 3300042002 Ga0439442_035026 Ga0439442_035026_508_1032 174
226 3300042007 Ga0439449_0003496 Ga0439449_0003496_3220_3744 174
227 3300042007 Ga0439449_0041644 Ga0439449_0041644_1066_1590 174
228 3300042007 Ga0439449_0043178 Ga0439449_0043178_1025_1549 174
229 3300042007 Ga0439449_0072607 Ga0439449_0072607_165_689 174
230 3300042014 Ga0439457_000892 Ga0439457_000892_7581_8105 174
231 3300042014 Ga0439457_001325 Ga0439457_001325_1466_1990 174
232 3300042015 Ga0439462_0127561 Ga0439462_0127561_148_672 174
233 3300042131 Ga0450894_000106 Ga0450894_000106_10842_11369 174
234 3300042132 Ga0450895_000619 Ga0450895_000619_346_873 174
235 3300042133 Ga0450896_007236 Ga0450896_007236_922_1449 174
236 3300042134 Ga0450898_001267 Ga0450898_001267_2682_3209 174
237 3300042134 Ga0450898_048962 Ga0450898_048962_39_563 174
238 3300042135 Ga0450899_008909 Ga0450899_008909_401_928 174
239 3300042138 Ga0450903_002366 Ga0450903_002366_1729_2253 174
240 3300042145 Ga0450906_000159 Ga0450906_000159_489_1016 174
241 3300042184 Ga0450908_019491 Ga0450908_019491_630_1157 174
242 3300044656 Ga0466969_0000546 Ga0466969_0000546_7143_7670 174
243 3300044656 Ga0466969_0007921 Ga0466969_0007921_4320_4844 174
244 3300044656 Ga0466969_0013369 Ga0466969_0013369_3452_3976 174
245 3300044658 Ga0466972_0000424 Ga0466972_0000424_4298_4822 174
246 3300044658 Ga0466972_0003320 Ga0466972_0003320_235_759 174
247 3300044658 Ga0466972_0006802 Ga0466972_0006802_4446_4973 174
248 3300044658 Ga0466972_0030090 Ga0466972_0030090_43_567 174
249 3300044683 Ga0466965_0002362 Ga0466965_0002362_4927_5451 174
250 3300044683 Ga0466965_0004621 Ga0466965_0004621_177_701 174
251 3300044683 Ga0466965_0005701 Ga0466965_0005701_1770_2294 174
252 3300044683 Ga0466965_0090357 Ga0466965_0090357_870_1394 174
253 3300044683 Ga0466965_0112090 Ga0466965_0112090_766_1290 174
254 3300044683 Ga0466965_0150114 Ga0466965_0150114_643_1167 174
255 3300044684 Ga0466966_0000750 Ga0466966_0000750_10126_10650 174
256 3300044684 Ga0466966_0001055 Ga0466966_0001055_5804_6328 174
257 3300044684 Ga0466966_0013928 Ga0466966_0013928_139_666 174
258 3300044684 Ga0466966_0128861 Ga0466966_0128861_741_1265 174
259 3300044684 Ga0466966_0274554 Ga0466966_0274554_111_635 174
260 3300044693 Ga0466961_0005280 Ga0466961_0005280_1997_2521 174
261 3300044693 Ga0466961_0010876 Ga0466961_0010876_5196_5723 174
262 3300044693 Ga0466961_0027274 Ga0466961_0027274_592_1116 174
263 3300044693 Ga0466961_0084577 Ga0466961_0084577_82_609 174
264 3300044693 Ga0466961_0155146 Ga0466961_0155146_564_1088 174
265 3300044693 Ga0466961_0404633 Ga0466961_0404633_281_805 174
266 3300044694 Ga0466963_0000109 Ga0466963_0000109_10670_11194 174
267 3300044694 Ga0466963_0151396 Ga0466963_0151396_271_795 174
268 3300044694 Ga0466963_0277979 Ga0466963_0277979_362_886 174
269 3300044694 Ga0466963_0408738 Ga0466963_0408738_287_811 174
270 3300044706 Ga0466964_0001669 Ga0466964_0001669_6658_7182 174
271 3300044706 Ga0466964_0125668 Ga0466964_0125668_219_743 174
272 3300044719 Ga0466971_0016182 Ga0466971_0016182_1082_1606 174
273 3300044719 Ga0466971_0017608 Ga0466971_0017608_2230_2754 174
274 3300044719 Ga0466971_0066555 Ga0466971_0066555_454_978 174
275 3300044735 Ga0466968_0021293 Ga0466968_0021293_1377_1901 174
276 3300044735 Ga0466968_0110904 Ga0466968_0110904_214_738 174
277 3300044735 Ga0466968_0379167 Ga0466968_0379167_24_548 174
278 3300044765 Ga0466970_0000171 Ga0466970_0000171_21837_22361 174
279 3300044765 Ga0466970_0004913 Ga0466970_0004913_921_1445 174
280 3300044765 Ga0466970_0216566 Ga0466970_0216566_342_869 174
281 3300044842 Ga0466957_0000581 Ga0466957_0000581_17517_18041 174
282 3300044842 Ga0466957_0069417 Ga0466957_0069417_907_1467 174
283 3300044842 Ga0466957_0077421 Ga0466957_0077421_332_856 174
284 3300044842 Ga0466957_0631325 Ga0466957_0631325_162_686 174
285 3300044842 Ga0466957_0809202 Ga0466957_0809202_124_648 174
286 3300044901 Ga0466960_0006669 Ga0466960_0006669_1924_2448 174
287 3300044901 Ga0466960_0255114 Ga0466960_0255114_204_731 174
288 3300045049 Ga0466959_0001913 Ga0466959_0001913_4606_5130 174
289 3300045049 Ga0466959_0003244 Ga0466959_0003244_1733_2260 174
290 3300045049 Ga0466959_0006999 Ga0466959_0006999_5605_6129 174
291 3300045049 Ga0466959_0329448 Ga0466959_0329448_344_868 174
292 3300045836 Ga0466958_0001612 Ga0466958_0001612_208_732 174
293 3300045836 Ga0466958_0318575 Ga0466958_0318575_91_615 174
294 3300045836 Ga0466958_0780162 Ga0466958_0780162_25_549 174
295 3300045976 Ga0466967_0014568 Ga0466967_0014568_2495_3019 174
296 3300045976 Ga0466967_0031279 Ga0466967_0031279_1262_1786 174
297 3300045976 Ga0466967_0078324 Ga0466967_0078324_2137_2661 174
298 3300045976 Ga0466967_0510713 Ga0466967_0510713_581_1105 174
299 3300045976 Ga0466967_0794383 Ga0466967_0794383_358_882 174
300 3300045976 Ga0466967_1210674 Ga0466967_1210674_185_709 174
301 3300046452 Ga0495617_030958 Ga0495617_030958_941_1465 174
302 3300046454 Ga0495592_0006815 Ga0495592_0006815_4366_4890 174
303 3300046454 Ga0495592_0030209 Ga0495592_0030209_1028_1552 174
304 3300046454 Ga0495592_0040645 Ga0495592_0040645_601_1125 174
305 3300046455 Ga0495603_0010390 Ga0495603_0010390_503_1030 174
306 3300046455 Ga0495603_0012587 Ga0495603_0012587_3929_4456 174
307 3300046455 Ga0495603_0014790 Ga0495603_0014790_1680_2207 174
308 3300046455 Ga0495603_0017423 Ga0495603_0017423_1126_1650 174
309 3300046455 Ga0495603_0029220 Ga0495603_0029220_1733_2257 174
310 3300046455 Ga0495603_0130513 Ga0495603_0130513_186_710 174
311 3300046455 Ga0495603_0182794 Ga0495603_0182794_558_1082 174
312 3300046455 Ga0495603_0287175 Ga0495603_0287175_288_812 174
313 3300046455 Ga0495603_0335267 Ga0495603_0335267_334_858 174
314 3300046457 Ga0495590_0085351 Ga0495590_0085351_223_747 174
315 3300046459 Ga0495629_0001125 Ga0495629_0001125_6620_7144 174
316 3300046459 Ga0495629_0002352 Ga0495629_0002352_3690_4214 174
317 3300046459 Ga0495629_0018204 Ga0495629_0018204_1793_2317 174
318 3300046459 Ga0495629_0020001 Ga0495629_0020001_3090_3617 174
319 3300046459 Ga0495629_0022998 Ga0495629_0022998_1681_2205 174
320 3300046459 Ga0495629_0056039 Ga0495629_0056039_422_946 174
321 3300046459 Ga0495629_0066640 Ga0495629_0066640_300_824 174
322 3300046459 Ga0495629_0212322 Ga0495629_0212322_449_973 174
323 3300046460 Ga0495638_0017645 Ga0495638_0017645_978_1502 174
324 3300046460 Ga0495638_0022169 Ga0495638_0022169_594_1118 174
325 3300046460 Ga0495638_0030766 Ga0495638_0030766_2735_3259 174
326 3300046460 Ga0495638_0139546 Ga0495638_0139546_496_1023 174
327 3300046460 Ga0495638_0298877 Ga0495638_0298877_297_821 174
328 3300046462 Ga0495651_0003297 Ga0495651_0003297_3047_3571 174
329 3300046462 Ga0495651_0019425 Ga0495651_0019425_208_732 174
330 3300046462 Ga0495651_0064616 Ga0495651_0064616_360_884 174
331 3300046463 Ga0495653_0110578 Ga0495653_0110578_469_993 174
332 3300046471 Ga0495650_0275559 Ga0495650_0275559_20_544 174
333 3300046472 Ga0495580_0050828 Ga0495580_0050828_2191_2715 174
334 3300046472 Ga0495580_0065688 Ga0495580_0065688_1153_1677 174
335 3300046473 Ga0495582_0019872 Ga0495582_0019872_2580_3104 174
336 3300046473 Ga0495582_0217620 Ga0495582_0217620_529_1056 174
337 3300046474 Ga0495605_0010491 Ga0495605_0010491_1603_2127 174
338 3300046475 Ga0495639_0010276 Ga0495639_0010276_3102_3629 174
339 3300046476 Ga0495662_0001181 Ga0495662_0001181_3047_3571 174
340 3300046476 Ga0495662_0008465 Ga0495662_0008465_1415_1942 174
341 3300046476 Ga0495662_0033850 Ga0495662_0033850_985_1512 174
342 3300046476 Ga0495662_0034895 Ga0495662_0034895_1001_1528 174
343 3300046476 Ga0495662_0050710 Ga0495662_0050710_227_751 174
344 3300046477 Ga0495664_0003330 Ga0495664_0003330_3525_4049 174
345 3300046492 Ga0495585_0018249 Ga0495585_0018249_86_610 174
346 3300046492 Ga0495585_0027318 Ga0495585_0027318_790_1317 174
347 3300046492 Ga0495585_0084813 Ga0495585_0084813_47_571 174
348 3300046492 Ga0495585_0145086 Ga0495585_0145086_119_643 174
349 3300046499 Ga0495594_0001243 Ga0495594_0001243_2939_3463 174
350 3300046499 Ga0495594_0002889 Ga0495594_0002889_5441_5965 174
351 3300046499 Ga0495594_0042434 Ga0495594_0042434_1824_2348 174
352 3300046499 Ga0495594_0080283 Ga0495594_0080283_580_1104 174
353 3300046499 Ga0495594_0110520 Ga0495594_0110520_985_1509 174
354 3300046499 Ga0495594_0240583 Ga0495594_0240583_166_693 174
355 3300046499 Ga0495594_0315758 Ga0495594_0315758_171_695 174
356 3300046500 Ga0495596_0262456 Ga0495596_0262456_100_624 174
357 3300046501 Ga0495607_0102582 Ga0495607_0102582_836_1363 174
358 3300046501 Ga0495607_0108428 Ga0495607_0108428_534_1058 174
359 3300046506 Ga0495583_0018225 Ga0495583_0018225_2714_3238 174
360 3300046512 Ga0495610_0025019 Ga0495610_0025019_877_1401 174
361 3300046512 Ga0495610_0187904 Ga0495610_0187904_145_669 174
362 3300046513 Ga0495616_0005671 Ga0495616_0005671_4711_5235 174
363 3300046514 Ga0495618_0020075 Ga0495618_0020075_923_1447 174
364 3300046514 Ga0495618_0060256 Ga0495618_0060256_1577_2101 174
365 3300046514 Ga0495618_0150237 Ga0495618_0150237_16_540 174
366 3300046514 Ga0495618_0265684 Ga0495618_0265684_389_913 174
367 3300046514 Ga0495618_0480857 Ga0495618_0480857_37_567 174
368 3300046515 Ga0495620_0009255 Ga0495620_0009255_3018_3542 174
369 3300046515 Ga0495620_0122193 Ga0495620_0122193_428_952 174
370 3300046515 Ga0495620_0154646 Ga0495620_0154646_180_704 174
371 3300046516 Ga0495628_0023674 Ga0495628_0023674_3174_3698 174
372 3300046516 Ga0495628_0033610 Ga0495628_0033610_3197_3721 174
373 3300046516 Ga0495628_0164216 Ga0495628_0164216_1137_1661 174
374 3300046517 Ga0495630_0014351 Ga0495630_0014351_4408_4932 174
375 3300046517 Ga0495630_0091961 Ga0495630_0091961_1573_2097 174
376 3300046518 Ga0495631_0004895 Ga0495631_0004895_2846_3370 174
377 3300046518 Ga0495631_0016807 Ga0495631_0016807_658_1182 174
378 3300046518 Ga0495631_0076072 Ga0495631_0076072_123_647 174
379 3300046518 Ga0495631_0139758 Ga0495631_0139758_456_980 174
380 3300046519 Ga0495632_0104096 Ga0495632_0104096_642_1166 174
381 3300046519 Ga0495632_0250828 Ga0495632_0250828_65_589 174
382 3300046520 Ga0495637_0019143 Ga0495637_0019143_2033_2557 174
383 3300046520 Ga0495637_0067543 Ga0495637_0067543_549_1073 174
384 3300046522 Ga0495643_0010503 Ga0495643_0010503_4042_4566 174
385 3300046522 Ga0495643_0017035 Ga0495643_0017035_3463_3987 174
386 3300046523 Ga0495644_0082260 Ga0495644_0082260_543_1067 174
387 3300046524 Ga0495648_0042870 Ga0495648_0042870_1931_2455 174
388 3300046524 Ga0495648_0416711 Ga0495648_0416711_12_536 174
389 3300046526 Ga0495666_0063697 Ga0495666_0063697_795_1319 174
390 3300046526 Ga0495666_0086849 Ga0495666_0086849_759_1283 174
391 3300046526 Ga0495666_0146317 Ga0495666_0146317_396_920 174
392 3300046528 Ga0495642_0038500 Ga0495642_0038500_893_1417 174
393 3300046528 Ga0495642_0082571 Ga0495642_0082571_91_618 174
394 3300046529 Ga0495652_0056978 Ga0495652_0056978_1447_1971 174
395 3300046529 Ga0495652_0071477 Ga0495652_0071477_442_966 174
396 3300046529 Ga0495652_0249963 Ga0495652_0249963_244_768 174
397 3300046530 Ga0495654_0032227 Ga0495654_0032227_1437_1961 174
398 3300046533 Ga0495640_0024612 Ga0495640_0024612_3212_3736 174
399 3300046533 Ga0495640_0070088 Ga0495640_0070088_1246_1770 174
400 3300046533 Ga0495640_0126053 Ga0495640_0126053_171_695 174
401 3300046533 Ga0495640_0280615 Ga0495640_0280615_162_686 174
402 3300046535 Ga0495586_0141856 Ga0495586_0141856_632_1156 174
403 3300046536 Ga0495587_0004720 Ga0495587_0004720_4505_5029 174
404 3300046536 Ga0495587_0173569 Ga0495587_0173569_271_798 174
405 3300046538 Ga0495609_0044503 Ga0495609_0044503_326_850 174
406 3300046538 Ga0495609_0158395 Ga0495609_0158395_357_884 174
407 3300046542 Ga0495597_0013132 Ga0495597_0013132_1524_2048 174
408 3300046542 Ga0495597_0162826 Ga0495597_0162826_155_679 174
409 3300046543 Ga0495645_0007723 Ga0495645_0007723_3097_3621 174
410 3300046543 Ga0495645_0071573 Ga0495645_0071573_1811_2338 174
411 3300046557 Ga0495622_0002791 Ga0495622_0002791_1733_2257 174
412 3300046557 Ga0495622_0004580 Ga0495622_0004580_5263_5787 174
413 3300046557 Ga0495622_0028023 Ga0495622_0028023_456_980 174
414 3300046557 Ga0495622_0046673 Ga0495622_0046673_57_581 174
415 3300046557 Ga0495622_0105813 Ga0495622_0105813_319_843 174
416 3300046558 Ga0495633_0029911 Ga0495633_0029911_1556_2080 174
417 3300046558 Ga0495633_0041208 Ga0495633_0041208_1599_2123 174
418 3300046558 Ga0495633_0189048 Ga0495633_0189048_387_911 174
419 3300046559 Ga0495667_0110411 Ga0495667_0110411_1029_1553 174
420 3300046559 Ga0495667_0157225 Ga0495667_0157225_358_882 174
421 3300046615 Ga0495656_0067028 Ga0495656_0067028_469_993 174
422 3300046616 Ga0495668_0010761 Ga0495668_0010761_659_1183 174
423 3300046616 Ga0495668_0030260 Ga0495668_0030260_1734_2258 174
424 3300046642 Ga0495634_0001501 Ga0495634_0001501_7792_8316 174
425 3300046642 Ga0495634_0017681 Ga0495634_0017681_1102_1626 174
426 3300046642 Ga0495634_0025000 Ga0495634_0025000_501_1025 174
427 3300046648 Ga0495611_0060854 Ga0495611_0060854_47_571 174
428 3300046648 Ga0495611_0070334 Ga0495611_0070334_933_1457 174
429 3300046660 Ga0495625_0017036 Ga0495625_0017036_4991_5515 174
430 3300046660 Ga0495625_0043102 Ga0495625_0043102_67_591 174
431 3300046660 Ga0495625_0057998 Ga0495625_0057998_1860_2384 174
432 3300046660 Ga0495625_0087206 Ga0495625_0087206_1249_1773 174
433 3300046660 Ga0495625_0109924 Ga0495625_0109924_1186_1710 174
434 3300046660 Ga0495625_0111415 Ga0495625_0111415_1209_1733 174
435 3300046663 Ga0495635_0000408 Ga0495635_0000408_17398_17922 174
436 3300046663 Ga0495635_0132749 Ga0495635_0132749_275_799 174
437 3300046665 Ga0495661_0337974 Ga0495661_0337974_147_671 174
438 3300046674 Ga0495588_0005045 Ga0495588_0005045_1700_2227 174
439 3300046674 Ga0495588_0012624 Ga0495588_0012624_2786_3310 174
440 3300046674 Ga0495588_0014145 Ga0495588_0014145_2829_3353 174
441 3300046674 Ga0495588_0044079 Ga0495588_0044079_1404_1928 174
442 3300046674 Ga0495588_0116761 Ga0495588_0116761_790_1317 174
443 3300046674 Ga0495588_0287815 Ga0495588_0287815_316_843 174
444 3300046674 Ga0495588_0358947 Ga0495588_0358947_43_567 174
445 3300046675 Ga0495657_0002188 Ga0495657_0002188_6880_7407 174
446 3300046675 Ga0495657_0011272 Ga0495657_0011272_3626_4150 174
447 3300046675 Ga0495657_0025880 Ga0495657_0025880_462_986 174
448 3300046675 Ga0495657_0026757 Ga0495657_0026757_362_886 174
449 3300046675 Ga0495657_0065452 Ga0495657_0065452_1654_2178 174
450 3300046678 Ga0495599_0122941 Ga0495599_0122941_135_659 174
451 3300046679 Ga0495623_0023158 Ga0495623_0023158_292_816 174
452 3300046680 Ga0495646_0003363 Ga0495646_0003363_2445_2969 174
453 3300046683 Ga0495658_0029706 Ga0495658_0029706_82_606 174
454 3300046689 Ga0495613_0008645 Ga0495613_0008645_471_995 174
455 3300046689 Ga0495613_0017345 Ga0495613_0017345_3939_4463 174
456 3300046689 Ga0495613_0028766 Ga0495613_0028766_3172_3696 174
457 3300046689 Ga0495613_0041397 Ga0495613_0041397_1376_1900 174
458 3300046689 Ga0495613_0051375 Ga0495613_0051375_943_1470 174
459 3300046689 Ga0495613_0089073 Ga0495613_0089073_1530_2054 174
460 3300046689 Ga0495613_0107579 Ga0495613_0107579_1247_1774 174
461 3300046689 Ga0495613_0133584 Ga0495613_0133584_924_1448 174
462 3300046689 Ga0495613_0342453 Ga0495613_0342453_330_854 174
463 3300046690 Ga0495624_0022326 Ga0495624_0022326_1270_1794 174
464 3300046690 Ga0495624_0028651 Ga0495624_0028651_1951_2475 174
465 3300046690 Ga0495624_0571539 Ga0495624_0571539_69_593 174
466 3300046691 Ga0495670_0004511 Ga0495670_0004511_3169_3693 174
467 3300046691 Ga0495670_0248746 Ga0495670_0248746_50_577 174
468 3300046692 Ga0495671_0016068 Ga0495671_0016068_2144_2668 174
469 3300046694 Ga0495649_0008303 Ga0495649_0008303_2716_3240 174
470 3300046694 Ga0495649_0031689 Ga0495649_0031689_1665_2189 174
471 3300046694 Ga0495649_0077038 Ga0495649_0077038_67_594 174
472 3300046694 Ga0495649_0103838 Ga0495649_0103838_900_1424 174
473 3300046794 Ga0495589_0009354 Ga0495589_0009354_3101_3628 174
474 3300046794 Ga0495589_0009504 Ga0495589_0009504_1067_1591 174
475 3300046794 Ga0495589_0013267 Ga0495589_0013267_1026_1553 174
476 3300046794 Ga0495589_0040584 Ga0495589_0040584_564_1088 174
477 3300046794 Ga0495589_0144959 Ga0495589_0144959_108_632 174
478 3300046809 Ga0495600_0089362 Ga0495600_0089362_1015_1539 174
479 3300046809 Ga0495600_0209504 Ga0495600_0209504_390_914 174
480 3300046809 Ga0495600_0344517 Ga0495600_0344517_313_837 174
481 3300046810 Ga0495660_0001994 Ga0495660_0001994_12176_12700 174
482 3300046810 Ga0495660_0042850 Ga0495660_0042850_1600_2124 174
483 3300046810 Ga0495660_0058955 Ga0495660_0058955_110_634 174
484 3300046810 Ga0495660_0132463 Ga0495660_0132463_223_747 174
485 3300047315 Ga0495581_0012417 Ga0495581_0012417_2617_3144 174
486 3300047315 Ga0495581_0037683 Ga0495581_0037683_131_658 174
487 3300047315 Ga0495581_0151060 Ga0495581_0151060_468_992 174
488 3300047315 Ga0495581_0178098 Ga0495581_0178098_601_1128 174
489 3300047317 Ga0495604_0000920 Ga0495604_0000920_10348_10872 174
490 3300047317 Ga0495604_0129623 Ga0495604_0129623_782_1306 174
491 3300047318 Ga0495636_0003117 Ga0495636_0003117_3034_3561 174
492 3300047318 Ga0495636_0003438 Ga0495636_0003438_2818_3345 174
493 3300047318 Ga0495636_0018273 Ga0495636_0018273_2208_2753 174
494 3300047318 Ga0495636_0035038 Ga0495636_0035038_685_1209 174
495 3300047318 Ga0495636_0048625 Ga0495636_0048625_210_737 174
496 3300047318 Ga0495636_0053817 Ga0495636_0053817_1145_1669 174
497 3300047318 Ga0495636_0062567 Ga0495636_0062567_16_540 174
498 3300047318 Ga0495636_0129732 Ga0495636_0129732_31_555 174
499 3300047318 Ga0495636_0254890 Ga0495636_0254890_269_796 174
500 3300047319 Ga0495674_0070014 Ga0495674_0070014_73_597 174
501 3300047319 Ga0495674_0084831 Ga0495674_0084831_23_547 174
502 3300047320 Ga0495672_0038501 Ga0495672_0038501_1306_1830 174
503 3300047321 Ga0495676_0009717 Ga0495676_0009717_2960_3484 174
504 3300047321 Ga0495676_0017221 Ga0495676_0017221_1062_1586 174
505 3300047321 Ga0495676_0031605 Ga0495676_0031605_2697_3221 174
506 3300047321 Ga0495676_0035387 Ga0495676_0035387_3170_3694 174
507 3300047321 Ga0495676_0214560 Ga0495676_0214560_28_552 174
508 3300047321 Ga0495676_0266427 Ga0495676_0266427_582_1106 174
509 3300047321 Ga0495676_0798823 Ga0495676_0798823_26_550 174
510 3300047322 Ga0495680_0131788 Ga0495680_0131788_168_695 174
511 3300047323 Ga0495683_0035929 Ga0495683_0035929_308_832 174
512 3300047323 Ga0495683_0053053 Ga0495683_0053053_67_591 174
513 3300047323 Ga0495683_0189676 Ga0495683_0189676_93_617 174
514 3300047443 Ga0495687_002642 Ga0495687_002642_10861_11388 174
515 3300047443 Ga0495687_008731 Ga0495687_008731_544_1068 174
516 3300047443 Ga0495687_029870 Ga0495687_029870_433_957 174
517 3300047444 Ga0495675_0012817 Ga0495675_0012817_3414_3938 174
518 3300047444 Ga0495675_0014026 Ga0495675_0014026_4454_4981 174
519 3300047444 Ga0495675_0042456 Ga0495675_0042456_52_576 174
520 3300047445 Ga0495677_0105235 Ga0495677_0105235_338_862 174
521 3300047445 Ga0495677_0191451 Ga0495677_0191451_54_578 174
522 3300047445 Ga0495677_0253913 Ga0495677_0253913_126_653 174
523 3300047447 Ga0495685_000133 Ga0495685_000133_561_1085 174
524 3300047447 Ga0495685_007228 Ga0495685_007228_576_1103 174
525 3300047447 Ga0495685_038711 Ga0495685_038711_648_1175 174
526 3300047447 Ga0495685_065688 Ga0495685_065688_624_1151 174
527 3300047447 Ga0495685_066139 Ga0495685_066139_414_938 174
528 3300047470 Ga0495681_0009498 Ga0495681_0009498_3200_3724 174
529 3300047470 Ga0495681_0012112 Ga0495681_0012112_3448_3972 174
530 3300047470 Ga0495681_0051621 Ga0495681_0051621_190_714 174
531 3300047470 Ga0495681_0247800 Ga0495681_0247800_14_541 174
532 3300047471 Ga0495684_0272521 Ga0495684_0272521_79_603 174
533 3300047472 Ga0495686_0004762 Ga0495686_0004762_107_631 174
534 3300047472 Ga0495686_0059871 Ga0495686_0059871_1126_1650 174
535 3300047472 Ga0495686_0118841 Ga0495686_0118841_1016_1540 174
536 3300047472 Ga0495686_0177322 Ga0495686_0177322_56_580 174
537 3300047673 Ga0495593_0005290 Ga0495593_0005290_4557_5081 174
538 3300047673 Ga0495593_0026491 Ga0495593_0026491_58_582 174
539 3300047673 Ga0495593_0075975 Ga0495593_0075975_44_568 174
540 3300047673 Ga0495593_0102829 Ga0495593_0102829_263_787 174
541 3300047673 Ga0495593_0215536 Ga0495593_0215536_396_920 174
542 3300047673 Ga0495593_0515481 Ga0495593_0515481_16_540 174
543 3300048088 Ga0495602_0016998 Ga0495602_0016998_4888_5412 174
544 3300048089 Ga0495614_0003174 Ga0495614_0003174_3522_4046 174
545 3300048091 Ga0495626_0010193 Ga0495626_0010193_3034_3558 174
546 3300048905 Ga0496102_0445276 Ga0496102_0445276_358_906 174
547 3300048906 Ga0496103_0354133 Ga0496103_0354133_361_885 174
548 3300048907 Ga0496104_0079888 Ga0496104_0079888_1671_2219 174
549 3300048907 Ga0496104_0474666 Ga0496104_0474666_269_796 174
550 3300048908 Ga0496105_0085955 Ga0496105_0085955_1171_1719 174
551 3300048909 Ga0496106_0542662 Ga0496106_0542662_51_602 174
552 3300048910 Ga0496107_0689181 Ga0496107_0689181_127_675 174
553 3300048911 Ga0496108_0145469 Ga0496108_0145469_1325_1873 174
554 3300048911 Ga0496108_0469500 Ga0496108_0469500_179_703 174
555 3300048911 Ga0496108_0849829 Ga0496108_0849829_105_632 174
556 3300048912 Ga0496109_0029382 Ga0496109_0029382_1334_1861 174
557 3300048912 Ga0496109_0063537 Ga0496109_0063537_338_886 174
558 3300048912 Ga0496109_0325928 Ga0496109_0325928_408_932 174
559 3300048913 Ga0496110_0295898 Ga0496110_0295898_114_662 174
560 3300048913 Ga0496110_1098724 Ga0496110_1098724_78_605 174
561 3300048913 Ga0496110_1228932 Ga0496110_1228932_59_583 174
562 3300048914 Ga0496111_0017686 Ga0496111_0017686_3350_3898 174
563 3300048915 Ga0496112_0289441 Ga0496112_0289441_303_854 174
564 3300048915 Ga0496112_0568319 Ga0496112_0568319_282_806 174
565 3300048915 Ga0496112_0613296 Ga0496112_0613296_224_751 174
566 3300048916 Ga0496113_0002493 Ga0496113_0002493_6465_7013 174
567 3300048918 Ga0496115_0488535 Ga0496115_0488535_71_619 174
568 3300048922 Ga0496119_0347025 Ga0496119_0347025_171_695 174
569 3300048926 Ga0496123_0220181 Ga0496123_0220181_266_790 174
570 3300048929 Ga0496126_0052554 Ga0496126_0052554_1342_1872 174
571 3300049459 Ga0495678_076067 Ga0495678_076067_79_603 174
572 3300049568 Ga0501031_0005905 Ga0501031_0005905_3007_3531 174
573 3300049568 Ga0501031_0010593 Ga0501031_0010593_2829_3353 174
574 3300049568 Ga0501031_0054865 Ga0501031_0054865_769_1293 174
575 3300049568 Ga0501031_0072552 Ga0501031_0072552_354_878 174
576 3300049568 Ga0501031_0259044 Ga0501031_0259044_585_1109 174
577 3300049569 Ga0501032_0002976 Ga0501032_0002976_12578_13102 174
578 3300049569 Ga0501032_0012268 Ga0501032_0012268_3873_4397 174
579 3300049569 Ga0501032_0095318 Ga0501032_0095318_389_913 174
580 3300049569 Ga0501032_0450669 Ga0501032_0450669_183_716 174
581 3300049570 Ga0501033_0001682 Ga0501033_0001682_12514_13047 174
582 3300049570 Ga0501033_0003976 Ga0501033_0003976_1393_1917 174
583 3300049570 Ga0501033_0010783 Ga0501033_0010783_5345_5869 174
584 3300049570 Ga0501033_0014812 Ga0501033_0014812_5300_5824 174
585 3300049570 Ga0501033_0081610 Ga0501033_0081610_715_1239 174
586 3300049570 Ga0501033_0084519 Ga0501033_0084519_1075_1599 174
587 3300049570 Ga0501033_0130248 Ga0501033_0130248_474_998 174
588 3300049570 Ga0501033_0154730 Ga0501033_0154730_560_1084 174
589 3300049571 Ga0501034_0020902 Ga0501034_0020902_2952_3476 174
590 3300049571 Ga0501034_0024322 Ga0501034_0024322_5254_5787 174
591 3300049571 Ga0501034_0031003 Ga0501034_0031003_1471_1995 174
592 3300049571 Ga0501034_0031323 Ga0501034_0031323_4616_5140 174
593 3300049571 Ga0501034_0149082 Ga0501034_0149082_1538_2062 174
594 3300049571 Ga0501034_0615871 Ga0501034_0615871_61_585 174
595 3300049571 Ga0501034_1196162 Ga0501034_1196162_45_569 174
596 3300049572 Ga0501036_0000603 Ga0501036_0000603_7306_7839 174
597 3300049572 Ga0501036_0004107 Ga0501036_0004107_2907_3431 174
598 3300049572 Ga0501036_0006344 Ga0501036_0006344_8989_9513 174
599 3300049572 Ga0501036_0020231 Ga0501036_0020231_2884_3408 174
600 3300049572 Ga0501036_0037289 Ga0501036_0037289_551_1075 174
601 3300049572 Ga0501036_0117598 Ga0501036_0117598_761_1285 174
602 3300049573 Ga0501037_0000832 Ga0501037_0000832_9368_9892 174
603 3300049573 Ga0501037_0012131 Ga0501037_0012131_2613_3137 174
604 3300049573 Ga0501037_0025200 Ga0501037_0025200_3108_3632 174
605 3300049573 Ga0501037_0237019 Ga0501037_0237019_87_611 174
606 3300049574 Ga0501038_0000231 Ga0501038_0000231_959_1483 174
607 3300049574 Ga0501038_0009979 Ga0501038_0009979_3683_4207 174
608 3300049574 Ga0501038_0112289 Ga0501038_0112289_170_703 174
609 3300049574 Ga0501038_0124225 Ga0501038_0124225_16_540 174
610 3300049574 Ga0501038_0151604 Ga0501038_0151604_1271_1795 174
611 3300049574 Ga0501038_0197042 Ga0501038_0197042_274_798 174
612 3300049575 Ga0501039_0003296 Ga0501039_0003296_9342_9875 174
613 3300049575 Ga0501039_0011475 Ga0501039_0011475_2206_2730 174
614 3300049575 Ga0501039_0267645 Ga0501039_0267645_641_1165 174
615 3300049576 Ga0501040_0005861 Ga0501040_0005861_3196_3720 174
616 3300049578 Ga0501042_0015032 Ga0501042_0015032_4624_5148 174
617 3300049578 Ga0501042_0402132 Ga0501042_0402132_237_770 174
618 3300049579 Ga0501043_0002088 Ga0501043_0002088_13565_14089 174
619 3300049579 Ga0501043_0002774 Ga0501043_0002774_3007_3531 174
620 3300049579 Ga0501043_0004088 Ga0501043_0004088_1818_2351 174
621 3300049579 Ga0501043_0043971 Ga0501043_0043971_2624_3148 174
622 3300049579 Ga0501043_0168484 Ga0501043_0168484_690_1214 174
623 3300049579 Ga0501043_0287753 Ga0501043_0287753_514_1038 174
624 3300049579 Ga0501043_0335673 Ga0501043_0335673_340_864 174
625 3300049580 Ga0501046_0003833 Ga0501046_0003833_4234_4758 174
626 3300049580 Ga0501046_0009593 Ga0501046_0009593_4465_4989 174
627 3300049580 Ga0501046_0041476 Ga0501046_0041476_2968_3492 174
628 3300049580 Ga0501046_0157102 Ga0501046_0157102_155_679 174
629 3300049581 Ga0501047_0012570 Ga0501047_0012570_6578_7102 174
630 3300049581 Ga0501047_0032534 Ga0501047_0032534_220_744 174
631 3300049581 Ga0501047_0036474 Ga0501047_0036474_3209_3733 174
632 3300049581 Ga0501047_0039284 Ga0501047_0039284_3549_4073 174
633 3300049581 Ga0501047_0061622 Ga0501047_0061622_793_1317 174
634 3300049581 Ga0501047_0226469 Ga0501047_0226469_881_1405 174
635 3300049581 Ga0501047_0251957 Ga0501047_0251957_933_1457 174
636 3300049581 Ga0501047_0562311 Ga0501047_0562311_423_947 174
637 3300049582 Ga0501048_0003964 Ga0501048_0003964_5440_5964 174
638 3300049582 Ga0501048_0017476 Ga0501048_0017476_210_734 174
639 3300049582 Ga0501048_0060025 Ga0501048_0060025_1259_1783 174
640 3300049584 Ga0501068_0006308 Ga0501068_0006308_1183_1707 174
641 3300049584 Ga0501068_0481735 Ga0501068_0481735_177_701 174
642 3300049585 Ga0501069_0003540 Ga0501069_0003540_5054_5578 174
643 3300049586 Ga0501070_0015281 Ga0501070_0015281_4745_5278 174
644 3300049586 Ga0501070_0307453 Ga0501070_0307453_386_910 174
645 3300049586 Ga0501070_0511826 Ga0501070_0511826_85_609 174
646 3300049586 Ga0501070_0770181 Ga0501070_0770181_195_719 174
647 3300049586 Ga0501070_0830601 Ga0501070_0830601_149_673 174
648 3300049586 Ga0501070_1126472 Ga0501070_1126472_16_540 174
649 3300049587 Ga0501071_0005287 Ga0501071_0005287_3017_3541 174
650 3300049588 Ga0501072_0002025 Ga0501072_0002025_13243_13767 174
651 3300049589 Ga0501073_0122461 Ga0501073_0122461_146_670 174
652 3300049589 Ga0501073_0317574 Ga0501073_0317574_195_728 174
653 3300049590 Ga0501074_0006619 Ga0501074_0006619_7614_8147 174
654 3300049590 Ga0501074_0606561 Ga0501074_0606561_215_739 174
655 3300049592 Ga0501076_0210350 Ga0501076_0210350_345_869 174
656 3300049593 Ga0501077_0009138 Ga0501077_0009138_2469_2993 174
657 3300049663 Ga0501223_069603 Ga0501223_069603_102_626 174
658 3300049669 Ga0501235_050762 Ga0501235_050762_352_879 174
659 3300049741 Ga0501079_0007274 Ga0501079_0007274_3186_3710 174
660 3300049742 Ga0501080_0319627 Ga0501080_0319627_146_670 174
661 3300049742 Ga0501080_0815672 Ga0501080_0815672_214_738 174
662 3300049744 Ga0501083_0000743 Ga0501083_0000743_17672_18196 174
663 3300049744 Ga0501083_0333833 Ga0501083_0333833_409_933 174
664 3300049778 Ga0501282_002532 Ga0501282_002532_1289_1816 174
665 3300049822 Ga0501035_0004966 Ga0501035_0004966_2181_2714 174
666 3300049822 Ga0501035_0026001 Ga0501035_0026001_654_1178 174
667 3300049822 Ga0501035_0036046 Ga0501035_0036046_3505_4029 174
668 3300049822 Ga0501035_0057671 Ga0501035_0057671_2675_3199 174
669 3300049822 Ga0501035_0082275 Ga0501035_0082275_172_696 174
670 3300049822 Ga0501035_0097265 Ga0501035_0097265_1144_1668 174
671 3300049822 Ga0501035_0308221 Ga0501035_0308221_202_726 174
672 3300049822 Ga0501035_0762469 Ga0501035_0762469_222_746 174
673 3300049823 Ga0501044_0004352 Ga0501044_0004352_9303_9827 174
674 3300049823 Ga0501044_0005219 Ga0501044_0005219_2620_3144 174
675 3300049823 Ga0501044_0005493 Ga0501044_0005493_3007_3531 174
676 3300049823 Ga0501044_0012492 Ga0501044_0012492_4334_4858 174
677 3300049823 Ga0501044_0016519 Ga0501044_0016519_3849_4373 174
678 3300049823 Ga0501044_0117849 Ga0501044_0117849_544_1068 174
679 3300049823 Ga0501044_0304081 Ga0501044_0304081_827_1351 174
680 3300049823 Ga0501044_0470222 Ga0501044_0470222_423_947 174
681 3300049823 Ga0501044_0578692 Ga0501044_0578692_141_665 174
682 3300049823 Ga0501044_0825538 Ga0501044_0825538_142_666 174
683 3300049824 Ga0501045_0381768 Ga0501045_0381768_410_934 174
684 3300050489 nmdc:mga03683_377297_c1 nmdc:mga03683_377297_c1_104_628 174
685 3300050490 nmdc:mga03n38_83388_c1 nmdc:mga03n38_83388_c1_288_812 174
686 3300050494 nmdc:mga06z11_127060_c1 nmdc:mga06z11_127060_c1_188_712 174
687 3300050495 nmdc:mga04h51_6120_c1 nmdc:mga04h51_6120_c1_741_1265 174
688 3300050496 nmdc:mga07m45_77589_c1 nmdc:mga07m45_77589_c1_718_1242 174
689 3300053085 Ga0495619_0242673 Ga0495619_0242673_62_586 174
690 3300053086 Ga0500578_0114814 Ga0500578_0114814_886_1410 174
691 3300053086 Ga0500578_0322575 Ga0500578_0322575_91_615 174
692 3300053088 Ga0500644_0010133 Ga0500644_0010133_1199_1723 174
693 3300053088 Ga0500644_0023261 Ga0500644_0023261_197_724 174
694 3300053090 Ga0500646_0000359 Ga0500646_0000359_10167_10691 174
695 3300053090 Ga0500646_0052212 Ga0500646_0052212_183_707 174
696 3300053092 Ga0500583_0246741 Ga0500583_0246741_141_665 174
697 3300053095 Ga0500640_011796 Ga0500640_011796_486_1010 174
698 3300053099 Ga0500654_063823 Ga0500654_063823_130_654 174
699 3300053101 Ga0500553_077472 Ga0500553_077472_264_788 174
700 3300053107 Ga0500560_010149 Ga0500560_010149_760_1284 174
701 3300053107 Ga0500560_024191 Ga0500560_024191_687_1211 174
702 3300053109 Ga0500569_003921 Ga0500569_003921_1418_1942 174
703 3300053111 Ga0500572_006235 Ga0500572_006235_1015_1539 174
704 3300053118 Ga0500594_0128135 Ga0500594_0128135_91_615 174
705 3300053124 Ga0500617_112577 Ga0500617_112577_131_655 174
706 3300053129 Ga0500628_002210 Ga0500628_002210_748_1272 174
707 3300053131 Ga0500652_003648 Ga0500652_003648_889_1413 174
708 3300053134 Ga0500658_0001635 Ga0500658_0001635_3413_3937 174
709 3300053136 Ga0500559_0003914 Ga0500559_0003914_3711_4235 174
710 3300053137 Ga0500561_0002416 Ga0500561_0002416_594_1118 174
711 3300053139 Ga0500568_0140902 Ga0500568_0140902_318_842 174
712 3300053140 Ga0500573_0037191 Ga0500573_0037191_847_1371 174
713 3300053140 Ga0500573_0089299 Ga0500573_0089299_229_753 174
714 3300053142 Ga0500577_0014784 Ga0500577_0014784_1575_2102 174
715 3300053142 Ga0500577_0111670 Ga0500577_0111670_510_1034 174
716 3300053143 Ga0500579_087240 Ga0500579_087240_121_645 174
717 3300053146 Ga0500588_0002851 Ga0500588_0002851_1189_1713 174
718 3300053146 Ga0500588_0277734 Ga0500588_0277734_89_613 174
719 3300053149 Ga0500600_0019800 Ga0500600_0019800_3185_3709 174
720 3300053153 Ga0500616_0336230 Ga0500616_0336230_17_541 174
721 3300053156 Ga0500622_0235644 Ga0500622_0235644_51_575 174
722 3300053160 Ga0500633_0038105 Ga0500633_0038105_946_1470 174
723 3300053161 Ga0500634_0009835 Ga0500634_0009835_3279_3803 174
724 3300053161 Ga0500634_0177886 Ga0500634_0177886_42_566 174
725 3300053732 Ga0500656_000596 Ga0500656_000596_543_1067 174
726 3300053739 Ga0500587_002964 Ga0500587_002964_282_806 174
727 3300054114 Ga0501084_0100963 Ga0501084_0100963_1763_2296 174
728 3300059628 Ga0587122_011395 Ga0587122_011395_227_751 174
729 3300060353 Ga0501082_0051593 Ga0501082_0051593_1524_2048 174
730 3300061719 Ga0466962_0000168 Ga0466962_0000168_19323_19847 174
731 3300061719 Ga0466962_0110057 Ga0466962_0110057_451_975 174
732 3300061719 Ga0466962_0192325 Ga0466962_0192325_254_778 174
733 3300061734 Ga0530510_0148368 Ga0530510_0148368_911_1435 174
734 3300025944 Ga0207661_10815200 Ga0207661_108152002 175
735 iso_pu_bacteria 2784746763 2785341498 176
736 iso_pu_bacteria 2795385472 2795791863 176
737 3300009551 Ga0105238_10057832 Ga0105238_100578322 177
738 3300046457 Ga0495590_0025435 Ga0495590_0025435_546_1079 177
739 3300046475 Ga0495639_0578428 Ga0495639_0578428_10_543 177
740 3300047471 Ga0495684_0447525 Ga0495684_0447525_137_670 177
741 3300049571 Ga0501034_0088988 Ga0501034_0088988_1790_2323 177
742 3300049572 Ga0501036_0672406 Ga0501036_0672406_264_797 177
743 3300049575 Ga0501039_0611561 Ga0501039_0611561_196_738 177
744 3300049581 Ga0501047_0008070 Ga0501047_0008070_874_1407 177
745 3300049582 Ga0501048_0070219 Ga0501048_0070219_1377_1910 177
746 3300049822 Ga0501035_0198038 Ga0501035_0198038_519_1052 177
747 3300030732 Ga0316176_1221328 Ga0316176_12213281 179
748 3300001989 JGI24739J22299_10005676 JGI24739J22299_100056761 180
749 3300001990 JGI24737J22298_10036687 JGI24737J22298_100366872 180
750 3300005330 Ga0070690_100025937 Ga0070690_1000259373 180
751 3300005563 Ga0068855_100861886 Ga0068855_1008618861 180
752 3300005614 Ga0068856_100938836 Ga0068856_1009388362 180
753 3300025904 Ga0207647_10003438 Ga0207647_100034386 180
754 3300025912 Ga0207707_10279892 Ga0207707_102798922 180
755 3300025949 Ga0207667_10671126 Ga0207667_106711262 180
756 3300030500 Ga0268256_1047276 Ga0268256_10472761 180
757 3300030732 Ga0316176_1044666 Ga0316176_10446661 180
758 3300030733 Ga0314311_1107895 Ga0314311_11078952 180
759 3300031456 Ga0307513_10281300 Ga0307513_102813002 180
760 3300031507 Ga0307509_10148111 Ga0307509_101481112 180
761 3300031616 Ga0307508_10009182 Ga0307508_100091827 180
762 3300042008 Ga0439450_068271 Ga0439450_068271_165_710 180
763 3300044656 Ga0466969_0099970 Ga0466969_0099970_548_1093 180
764 3300049571 Ga0501034_0158505 Ga0501034_0158505_541_1083 180
765 3300049573 Ga0501037_0320433 Ga0501037_0320433_130_672 180
766 3300049581 Ga0501047_0192917 Ga0501047_0192917_1173_1715 180
767 3300049582 Ga0501048_0215026 Ga0501048_0215026_463_1005 180
768 3300049590 Ga0501074_0221398 Ga0501074_0221398_541_1083 180
769 3300049742 Ga0501080_0275758 Ga0501080_0275758_964_1506 180
770 3300049823 Ga0501044_0053364 Ga0501044_0053364_1925_2467 180
771 iso_pu_bacteria 3006486233 3006486432 180
772 iso_pu_bacteria 8008558824 8008562467 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

50

124

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h20-assembly1.cif.gz_A-2 x-ray structure of padr-like transcription factor from bacteroid fragilis 0.8916 3 88
3elk-assembly1.cif.gz_B crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum 0.8916 3 87
6fuu-assembly1.cif.gz_A transcriptional regulator lmrr with bound heme 0.8814 1 88
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8803 5 88
6abt-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8604 4 88
ID Description Score Start End Superfamily
5h20A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8916 3 88 1.10.10.10
6fuuA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8814 1 88 1.10.10.10
2p4wB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8812 9 77 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8803 5 88 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8786 9 94 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Q2CT39-F1-model_v4 PadR family transcriptional regulator 0.9498 10 178
AF-A0A3M0I7D0-F1-model_v4 PadR family transcriptional regulator 0.942 8 87
AF-A0A7W7R6U0-F1-model_v4 DNA-binding PadR family transcriptional regulator 0.9371 8 87 GO:0003677
AF-A0A3R9UWV8-F1-model_v4 PadR family transcriptional regulator 0.9367 8 87
AF-A0A506YBI8-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9354 10 87

Feature Viewer

pLDDT pTM Quality
91.54 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map