F480146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 359 | 768 | 175 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8008558824|8008562467 |
| Length | 217 |
| Sequence | PVTVGFGDRTVTISSDLRPLTVRPGPIHGRYTWCVYLVCTVVLMSIGHTLLGLLESGPRHGYDLKRAFDEKFGHDRPLHYGQVYSTMSRLLKNGLVEVDGIEPGGGPERKRYAITEAGITDVQRWLATPEKPEPYLQSTLYTKVVLALLTDRNAADILDTQRSEHLRMMRILTDRKRKGDLADQLICDHALFHLEADLRWLELTAARLGKLAEAVTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 2 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 3 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 56 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 67 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 82 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 114 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 115 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 116 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 117 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 118 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 119 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 120 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 121 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 122 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 127 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 132 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 133 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 134 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 138 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 139 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 142 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 143 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 144 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 150 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 151 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 152 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 153 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 154 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 155 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 156 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 157 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 158 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 159 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 160 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 161 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 162 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 163 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 164 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 165 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 166 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 167 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 168 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 169 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 170 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 171 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 172 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 173 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 174 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 175 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 176 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 177 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 181 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 182 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 183 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 184 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 271 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 272 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 273 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 274 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 275 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 278 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 283 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 328 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 329 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 330 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 332 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 333 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 335 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 337 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 338 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 343 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 344 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 345 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 346 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 347 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 348 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 349 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 350 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 351 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 353 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 354 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 358 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 359 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.87 |
| Nodule | 0.26 |
| Rhizoplane | 3.63 |
| Rhizosphere | 81.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10005676 | 3300001989 | Bacteria | 4728 |
| 2 | JGI24737J22298_10036687 | 3300001990 | Bacteria | 1513 |
| 3 | JGI25406J46586_10010577 | 3300003203 | Bacteria | 4090 |
| 4 | rootH1_10034127 | 3300003316 | Bacteria | 13161 |
| 5 | rootH2_10080827 | 3300003320 | Bacteria | 1475 |
| 6 | JGI25160J50197_1010101 | 3300003354 | Bacteria | 3441 |
| 7 | JGI25160J50197_1034468 | 3300003354 | Bacteria | 1256 |
| 8 | Ga0070683_100083517 | 3300005329 | Bacteria | 2991 |
| 9 | Ga0070683_100860236 | 3300005329 | Bacteria | 870 |
| 10 | Ga0070690_100025937 | 3300005330 | Bacteria | 3611 |
| 11 | Ga0070660_100873306 | 3300005339 | Bacteria | 758 |
| 12 | Ga0070661_100419672 | 3300005344 | Bacteria | 1060 |
| 13 | Ga0070661_100610961 | 3300005344 | Unclassified | 882 |
| 14 | Ga0070668_100003878 | 3300005347 | Bacteria | 11042 |
| 15 | Ga0070675_100748090 | 3300005354 | Bacteria | 892 |
| 16 | Ga0070671_100628646 | 3300005355 | Bacteria | 929 |
| 17 | Ga0070674_100024269 | 3300005356 | Bacteria | 3934 |
| 18 | Ga0070674_100118821 | 3300005356 | Bacteria | 1954 |
| 19 | Ga0070659_100879752 | 3300005366 | Bacteria | 782 |
| 20 | Ga0070667_101154676 | 3300005367 | Bacteria | 724 |
| 21 | Ga0070709_10822967 | 3300005434 | Bacteria | 730 |
| 22 | Ga0070713_100506843 | 3300005436 | Bacteria | 1139 |
| 23 | Ga0070713_100766211 | 3300005436 | Bacteria | 924 |
| 24 | Ga0070710_10000158 | 3300005437 | Bacteria | 31424 |
| 25 | Ga0070663_100000450 | 3300005455 | Bacteria | 21744 |
| 26 | Ga0070663_100010974 | 3300005455 | Bacteria | 5667 |
| 27 | Ga0070663_100830547 | 3300005455 | Bacteria | 794 |
| 28 | Ga0070678_100630777 | 3300005456 | Bacteria | 959 |
| 29 | Ga0070678_100815706 | 3300005456 | Bacteria | 848 |
| 30 | Ga0070681_11083702 | 3300005458 | Unclassified | 722 |
| 31 | Ga0068867_100672415 | 3300005459 | Bacteria | 911 |
| 32 | Ga0070685_10000870 | 3300005466 | Bacteria | 16346 |
| 33 | Ga0070679_100454802 | 3300005530 | Bacteria | 1225 |
| 34 | Ga0070684_100024815 | 3300005535 | Bacteria | 5032 |
| 35 | Ga0070684_100121900 | 3300005535 | Bacteria | 2346 |
| 36 | Ga0070684_100159679 | 3300005535 | Bacteria | 2044 |
| 37 | Ga0070684_100459058 | 3300005535 | Bacteria | 1178 |
| 38 | Ga0070684_100633499 | 3300005535 | Bacteria | 995 |
| 39 | Ga0068853_100010969 | 3300005539 | Bacteria | 7343 |
| 40 | Ga0068853_100125636 | 3300005539 | Bacteria | 2291 |
| 41 | Ga0068853_101775563 | 3300005539 | Bacteria | 598 |
| 42 | Ga0070665_100040185 | 3300005548 | Bacteria | 4702 |
| 43 | Ga0070665_100232242 | 3300005548 | Bacteria | 1845 |
| 44 | Ga0068855_100861886 | 3300005563 | Bacteria | 959 |
| 45 | Ga0070664_100057265 | 3300005564 | Bacteria | 3313 |
| 46 | Ga0068857_100139912 | 3300005577 | Bacteria | 2187 |
| 47 | Ga0068854_100913560 | 3300005578 | Bacteria | 772 |
| 48 | Ga0068856_100239250 | 3300005614 | Bacteria | 1831 |
| 49 | Ga0068856_100938836 | 3300005614 | Bacteria | 884 |
| 50 | Ga0068852_100542870 | 3300005616 | Bacteria | 1162 |
| 51 | Ga0068852_101279811 | 3300005616 | Bacteria | 755 |
| 52 | Ga0068864_100012137 | 3300005618 | Bacteria | 7118 |
| 53 | Ga0068861_100424784 | 3300005719 | Bacteria | 1185 |
| 54 | Ga0068863_100193177 | 3300005841 | Bacteria | 1956 |
| 55 | Ga0068863_101494873 | 3300005841 | Bacteria | 684 |
| 56 | Ga0068858_100253821 | 3300005842 | Bacteria | 1671 |
| 57 | Ga0081455_10339733 | 3300005937 | Bacteria | 1063 |
| 58 | Ga0081538_10001098 | 3300005981 | Bacteria | 28674 |
| 59 | Ga0081540_1086172 | 3300005983 | Bacteria | 1396 |
| 60 | Ga0081539_10000173 | 3300005985 | Bacteria | 151356 |
| 61 | Ga0070717_10188534 | 3300006028 | Bacteria | 1801 |
| 62 | Ga0070717_10382673 | 3300006028 | Bacteria | 1262 |
| 63 | Ga0075368_10019948 | 3300006042 | Bacteria | 2534 |
| 64 | Ga0075363_100024448 | 3300006048 | Bacteria | 3071 |
| 65 | Ga0070716_100257080 | 3300006173 | Bacteria | 1193 |
| 66 | Ga0075367_10001478 | 3300006178 | Bacteria | 10147 |
| 67 | Ga0068871_100911839 | 3300006358 | Bacteria | 815 |
| 68 | Ga0075428_100687618 | 3300006844 | Bacteria | 1090 |
| 69 | Ga0075431_100385224 | 3300006847 | Bacteria | 1405 |
| 70 | Ga0075429_100001872 | 3300006880 | Bacteria | 17427 |
| 71 | Ga0075429_100079501 | 3300006880 | Bacteria | 2858 |
| 72 | Ga0099826_10050777 | 3300006948 | Bacteria | 2787 |
| 73 | Ga0105251_10008794 | 3300009011 | Bacteria | 6054 |
| 74 | Ga0111539_11815165 | 3300009094 | Bacteria | 707 |
| 75 | Ga0105245_10369678 | 3300009098 | Bacteria | 1425 |
| 76 | Ga0105245_10513312 | 3300009098 | Bacteria | 1216 |
| 77 | Ga0105247_10179591 | 3300009101 | Bacteria | 1412 |
| 78 | Ga0114129_12618001 | 3300009147 | Bacteria | 602 |
| 79 | Ga0105243_10572832 | 3300009148 | Bacteria | 1082 |
| 80 | Ga0105248_10034305 | 3300009177 | Bacteria | 5673 |
| 81 | Ga0105248_10614652 | 3300009177 | Bacteria | 1226 |
| 82 | Ga0105238_10057832 | 3300009551 | Bacteria | 3887 |
| 83 | Ga0105238_10607689 | 3300009551 | Bacteria | 1102 |
| 84 | Ga0105238_10745308 | 3300009551 | Bacteria | 993 |
| 85 | Ga0105249_10222611 | 3300009553 | Bacteria | 1857 |
| 86 | Ga0105246_10002882 | 3300011119 | Bacteria | 10405 |
| 87 | Ga0105246_10537800 | 3300011119 | Bacteria | 999 |
| 88 | Ga0157322_1008915 | 3300012490 | Bacteria | 778 |
| 89 | Ga0157313_1001614 | 3300012503 | Bacteria | 1243 |
| 90 | Ga0157369_10062288 | 3300013105 | Bacteria | 4020 |
| 91 | Ga0157374_11129171 | 3300013296 | Bacteria | 804 |
| 92 | Ga0163162_11845321 | 3300013306 | Bacteria | 691 |
| 93 | Ga0157372_10077506 | 3300013307 | Bacteria | 3754 |
| 94 | Ga0157375_10361097 | 3300013308 | Bacteria | 1619 |
| 95 | Ga0163163_10002986 | 3300014325 | Bacteria | 14314 |
| 96 | Ga0163163_10044342 | 3300014325 | Bacteria | 4363 |
| 97 | Ga0163163_11036005 | 3300014325 | Bacteria | 884 |
| 98 | Ga0157380_12074321 | 3300014326 | Bacteria | 631 |
| 99 | Ga0182008_10008823 | 3300014497 | Bacteria | 5474 |
| 100 | Ga0157377_10737251 | 3300014745 | Bacteria | 719 |
| 101 | Ga0157379_10078837 | 3300014968 | Bacteria | 2950 |
| 102 | Ga0157379_10305055 | 3300014968 | Bacteria | 1451 |
| 103 | Ga0157376_11861728 | 3300014969 | Bacteria | 638 |
| 104 | Ga0182006_1013159 | 3300015261 | Bacteria | 3597 |
| 105 | Ga0182007_10000817 | 3300015262 | Bacteria | 17355 |
| 106 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 107 | Ga0213875_10002957 | 3300021388 | Bacteria | 9903 |
| 108 | Ga0209758_1014489 | 3300025297 | Bacteria | 4187 |
| 109 | Ga0207426_1001306 | 3300025302 | Bacteria | 21312 |
| 110 | Ga0207426_1001848 | 3300025302 | Bacteria | 15553 |
| 111 | Ga0207426_1002757 | 3300025302 | Bacteria | 10624 |
| 112 | Ga0207426_1010918 | 3300025302 | Bacteria | 3493 |
| 113 | Ga0207713_1032563 | 3300025735 | Bacteria | 2287 |
| 114 | Ga0207692_10009605 | 3300025898 | Bacteria | 4047 |
| 115 | Ga0207647_10003438 | 3300025904 | Bacteria | 11884 |
| 116 | Ga0207699_10151302 | 3300025906 | Bacteria | 1536 |
| 117 | Ga0207707_10279892 | 3300025912 | Bacteria | 1445 |
| 118 | Ga0207707_10646139 | 3300025912 | Bacteria | 892 |
| 119 | Ga0207663_10347687 | 3300025916 | Bacteria | 1122 |
| 120 | Ga0207649_11294285 | 3300025920 | Unclassified | 577 |
| 121 | Ga0207694_10620977 | 3300025924 | Bacteria | 909 |
| 122 | Ga0207694_10621337 | 3300025924 | Bacteria | 909 |
| 123 | Ga0207687_10293450 | 3300025927 | Bacteria | 1307 |
| 124 | Ga0207700_10438357 | 3300025928 | Bacteria | 1150 |
| 125 | Ga0207700_10873607 | 3300025928 | Bacteria | 805 |
| 126 | Ga0207664_10005716 | 3300025929 | Bacteria | 8502 |
| 127 | Ga0207686_10477905 | 3300025934 | Bacteria | 963 |
| 128 | Ga0207669_10016652 | 3300025937 | Bacteria | 3742 |
| 129 | Ga0207669_10080358 | 3300025937 | Bacteria | 2085 |
| 130 | Ga0207711_10098123 | 3300025941 | Bacteria | 2588 |
| 131 | Ga0207661_10815200 | 3300025944 | Bacteria | 859 |
| 132 | Ga0207679_10106311 | 3300025945 | Bacteria | 2206 |
| 133 | Ga0207667_10671126 | 3300025949 | Bacteria | 1041 |
| 134 | Ga0207640_10372940 | 3300025981 | Bacteria | 1154 |
| 135 | Ga0207639_10456527 | 3300026041 | Bacteria | 1161 |
| 136 | Ga0207702_11503955 | 3300026078 | Bacteria | 667 |
| 137 | Ga0207683_11377686 | 3300026121 | Bacteria | 652 |
| 138 | Ga0207698_11024681 | 3300026142 | Bacteria | 837 |
| 139 | Ga0209813_10005391 | 3300027866 | Bacteria | 3102 |
| 140 | Ga0268266_10012541 | 3300028379 | Bacteria | 7324 |
| 141 | Ga0268266_10478045 | 3300028379 | Bacteria | 1187 |
| 142 | Ga0268266_10505727 | 3300028379 | Bacteria | 1154 |
| 143 | Ga0268265_10000008 | 3300028380 | Bacteria | 417328 |
| 144 | Ga0307517_10001976 | 3300028786 | Bacteria | 33403 |
| 145 | Ga0307517_10010759 | 3300028786 | Bacteria | 12754 |
| 146 | Ga0307515_10000573 | 3300028794 | Bacteria | 86907 |
| 147 | Ga0307515_10056033 | 3300028794 | Bacteria | 5740 |
| 148 | Ga0307515_10409932 | 3300028794 | Bacteria | 978 |
| 149 | Ga0268256_1047276 | 3300030500 | Bacteria | 927 |
| 150 | Ga0307511_10002078 | 3300030521 | Bacteria | 20966 |
| 151 | Ga0307511_10019025 | 3300030521 | Bacteria | 6544 |
| 152 | Ga0307512_10046279 | 3300030522 | Bacteria | 3549 |
| 153 | Ga0307512_10060881 | 3300030522 | Bacteria | 2914 |
| 154 | Ga0316176_1044666 | 3300030732 | Bacteria | 1081 |
| 155 | Ga0316176_1221328 | 3300030732 | Bacteria | 973 |
| 156 | Ga0314311_1107895 | 3300030733 | Bacteria | 2912 |
| 157 | Ga0316182_1181641 | 3300030745 | Bacteria | 762 |
| 158 | Ga0307513_10020470 | 3300031456 | Bacteria | 7846 |
| 159 | Ga0307513_10281300 | 3300031456 | Bacteria | 1441 |
| 160 | Ga0307509_10148111 | 3300031507 | Bacteria | 2269 |
| 161 | Ga0307509_10227715 | 3300031507 | Bacteria | 1670 |
| 162 | Ga0307509_10228616 | 3300031507 | Bacteria | 1665 |
| 163 | Ga0307508_10009182 | 3300031616 | Bacteria | 9107 |
| 164 | Ga0307508_10012239 | 3300031616 | Bacteria | 7844 |
| 165 | Ga0307508_10012977 | 3300031616 | Bacteria | 7618 |
| 166 | Ga0307508_10036728 | 3300031616 | Bacteria | 4410 |
| 167 | Ga0307508_10037736 | 3300031616 | Bacteria | 4344 |
| 168 | Ga0307508_10131454 | 3300031616 | Bacteria | 2106 |
| 169 | Ga0307508_10348546 | 3300031616 | Bacteria | 1072 |
| 170 | Ga0307514_10002934 | 3300031649 | Bacteria | 16969 |
| 171 | Ga0307514_10100336 | 3300031649 | Bacteria | 2081 |
| 172 | Ga0307514_10138027 | 3300031649 | Bacteria | 1664 |
| 173 | Ga0307516_10011280 | 3300031730 | Bacteria | 9737 |
| 174 | Ga0307516_10075768 | 3300031730 | Bacteria | 3218 |
| 175 | Ga0307516_10181201 | 3300031730 | Bacteria | 1840 |
| 176 | Ga0307516_10216060 | 3300031730 | Bacteria | 1629 |
| 177 | Ga0307516_10422406 | 3300031730 | Bacteria | 991 |
| 178 | Ga0307413_10483676 | 3300031824 | Bacteria | 990 |
| 179 | Ga0307413_10489999 | 3300031824 | Bacteria | 985 |
| 180 | Ga0307518_10000112 | 3300031838 | Bacteria | 56876 |
| 181 | Ga0307518_10033606 | 3300031838 | Bacteria | 3721 |
| 182 | Ga0307410_10218052 | 3300031852 | Bacteria | 1466 |
| 183 | Ga0307406_10608627 | 3300031901 | Bacteria | 902 |
| 184 | Ga0307407_10176598 | 3300031903 | Bacteria | 1412 |
| 185 | Ga0307407_10622535 | 3300031903 | Bacteria | 806 |
| 186 | Ga0307409_100473179 | 3300031995 | Bacteria | 1214 |
| 187 | Ga0307416_100031544 | 3300032002 | Bacteria | 3991 |
| 188 | Ga0307416_100387891 | 3300032002 | Bacteria | 1430 |
| 189 | Ga0307416_100549642 | 3300032002 | Bacteria | 1228 |
| 190 | Ga0307414_11666137 | 3300032004 | Bacteria | 595 |
| 191 | Ga0307415_100459996 | 3300032126 | Bacteria | 1102 |
| 192 | Ga0307507_10017829 | 3300033179 | Bacteria | 8122 |
| 193 | Ga0307507_10053956 | 3300033179 | Bacteria | 3833 |
| 194 | Ga0307510_10023073 | 3300033180 | Bacteria | 7218 |
| 195 | Ga0307510_10031752 | 3300033180 | Bacteria | 5958 |
| 196 | Ga0373960_0049582 | 3300035121 | Bacteria | 1242 |
| 197 | Ga0373962_0015607 | 3300035242 | Bacteria | 1949 |
| 198 | Ga0395900_0092122 | 3300037418 | Bacteria | 3114 |
| 199 | Ga0395900_0831748 | 3300037418 | Bacteria | 850 |
| 200 | Ga0395898_0003080 | 3300037466 | Bacteria | 18879 |
| 201 | Ga0395898_0014340 | 3300037466 | Bacteria | 8145 |
| 202 | Ga0395898_0106436 | 3300037466 | Bacteria | 2690 |
| 203 | Ga0395898_1132737 | 3300037466 | Bacteria | 715 |
| 204 | Ga0395905_0355780 | 3300037471 | Bacteria | 1357 |
| 205 | Ga0436364_0645566 | 3300037853 | Bacteria | 17181 |
| 206 | Ga0395901_0249537 | 3300038443 | Bacteria | 1849 |
| 207 | Ga0400483_122074 | 3300039062 | Bacteria | 27519 |
| 208 | Ga0400483_274169 | 3300039062 | Bacteria | 27465 |
| 209 | Ga0439436_0000677 | 3300041404 | Bacteria | 9155 |
| 210 | Ga0439436_0007726 | 3300041404 | Bacteria | 3307 |
| 211 | Ga0439439_0029023 | 3300041406 | Bacteria | 1403 |
| 212 | Ga0451789_0910477 | 3300041443 | Bacteria | 586 |
| 213 | Ga0451791_1040063 | 3300041451 | Bacteria | 933 |
| 214 | Ga0451791_1317664 | 3300041451 | Bacteria | 953 |
| 215 | Ga0451800_1683482 | 3300041459 | Bacteria | 981 |
| 216 | Ga0451802_0027211 | 3300041460 | Bacteria | 734 |
| 217 | Ga0451807_1611693 | 3300041486 | Bacteria | 1382 |
| 218 | Ga0451833_1440405 | 3300041491 | Bacteria | 913 |
| 219 | Ga0451837_0144890 | 3300041494 | Bacteria | 2239 |
| 220 | Ga0451841_0490569 | 3300041498 | Bacteria | 617 |
| 221 | Ga0451849_0309245 | 3300041505 | Bacteria | 918 |
| 222 | Ga0451843_1509281 | 3300041509 | Bacteria | 815 |
| 223 | Ga0451853_0021657 | 3300041512 | Bacteria | 2352 |
| 224 | Ga0451853_0041685 | 3300041512 | Bacteria | 1363 |
| 225 | Ga0451853_1547161 | 3300041512 | Bacteria | 667 |
| 226 | Ga0451853_1597759 | 3300041512 | Bacteria | 5102 |
| 227 | Ga0451853_3661833 | 3300041512 | Bacteria | 1854 |
| 228 | Ga0439433_0001648 | 3300041999 | Bacteria | 4653 |
| 229 | Ga0439433_0089217 | 3300041999 | Bacteria | 756 |
| 230 | Ga0439442_035026 | 3300042002 | Bacteria | 1049 |
| 231 | Ga0439449_0003496 | 3300042007 | Bacteria | 6103 |
| 232 | Ga0439449_0041644 | 3300042007 | Bacteria | 1708 |
| 233 | Ga0439449_0043178 | 3300042007 | Bacteria | 1674 |
| 234 | Ga0439449_0072607 | 3300042007 | Bacteria | 1268 |
| 235 | Ga0439450_068271 | 3300042008 | Bacteria | 869 |
| 236 | Ga0439457_000892 | 3300042014 | Bacteria | 9007 |
| 237 | Ga0439457_001325 | 3300042014 | Bacteria | 7422 |
| 238 | Ga0439462_0127561 | 3300042015 | Bacteria | 709 |
| 239 | Ga0450894_000106 | 3300042131 | Bacteria | 14208 |
| 240 | Ga0450895_000619 | 3300042132 | Bacteria | 2137 |
| 241 | Ga0450896_007236 | 3300042133 | Bacteria | 1529 |
| 242 | Ga0450898_001267 | 3300042134 | Bacteria | 3286 |
| 243 | Ga0450898_048962 | 3300042134 | Bacteria | 813 |
| 244 | Ga0450899_008909 | 3300042135 | Bacteria | 1102 |
| 245 | Ga0450903_002366 | 3300042138 | Bacteria | 3365 |
| 246 | Ga0450906_000159 | 3300042145 | Bacteria | 12639 |
| 247 | Ga0450908_019491 | 3300042184 | Bacteria | 1193 |
| 248 | Ga0466969_0000546 | 3300044656 | Bacteria | 20630 |
| 249 | Ga0466969_0007921 | 3300044656 | Bacteria | 5639 |
| 250 | Ga0466969_0013369 | 3300044656 | Bacteria | 4322 |
| 251 | Ga0466969_0099970 | 3300044656 | Bacteria | 1366 |
| 252 | Ga0466972_0000424 | 3300044658 | Bacteria | 21937 |
| 253 | Ga0466972_0003320 | 3300044658 | Bacteria | 7982 |
| 254 | Ga0466972_0006802 | 3300044658 | Bacteria | 5738 |
| 255 | Ga0466972_0030090 | 3300044658 | Bacteria | 2673 |
| 256 | Ga0466972_0447947 | 3300044658 | Bacteria | 606 |
| 257 | Ga0466965_0002362 | 3300044683 | Bacteria | 7992 |
| 258 | Ga0466965_0004621 | 3300044683 | Bacteria | 6131 |
| 259 | Ga0466965_0005701 | 3300044683 | Bacteria | 5616 |
| 260 | Ga0466965_0090357 | 3300044683 | Bacteria | 1557 |
| 261 | Ga0466965_0112090 | 3300044683 | Bacteria | 1402 |
| 262 | Ga0466965_0150114 | 3300044683 | Bacteria | 1218 |
| 263 | Ga0466966_0000750 | 3300044684 | Bacteria | 20552 |
| 264 | Ga0466966_0001055 | 3300044684 | Bacteria | 17604 |
| 265 | Ga0466966_0013928 | 3300044684 | Bacteria | 5324 |
| 266 | Ga0466966_0128861 | 3300044684 | Bacteria | 1550 |
| 267 | Ga0466966_0274554 | 3300044684 | Bacteria | 1014 |
| 268 | Ga0466961_0005280 | 3300044693 | Bacteria | 8130 |
| 269 | Ga0466961_0010876 | 3300044693 | Bacteria | 5813 |
| 270 | Ga0466961_0027274 | 3300044693 | Bacteria | 3672 |
| 271 | Ga0466961_0084577 | 3300044693 | Bacteria | 2006 |
| 272 | Ga0466961_0155146 | 3300044693 | Bacteria | 1428 |
| 273 | Ga0466961_0404633 | 3300044693 | Bacteria | 828 |
| 274 | Ga0466963_0000109 | 3300044694 | Bacteria | 30106 |
| 275 | Ga0466963_0151396 | 3300044694 | Bacteria | 1611 |
| 276 | Ga0466963_0277979 | 3300044694 | Bacteria | 1176 |
| 277 | Ga0466963_0408738 | 3300044694 | Bacteria | 957 |
| 278 | Ga0466964_0001669 | 3300044706 | Bacteria | 7682 |
| 279 | Ga0466964_0125668 | 3300044706 | Bacteria | 1161 |
| 280 | Ga0466971_0016182 | 3300044719 | Bacteria | 3286 |
| 281 | Ga0466971_0017608 | 3300044719 | Bacteria | 3162 |
| 282 | Ga0466971_0066555 | 3300044719 | Bacteria | 1633 |
| 283 | Ga0466968_0021293 | 3300044735 | Bacteria | 2624 |
| 284 | Ga0466968_0110904 | 3300044735 | Bacteria | 1233 |
| 285 | Ga0466968_0379167 | 3300044735 | Bacteria | 690 |
| 286 | Ga0466970_0000171 | 3300044765 | Bacteria | 30809 |
| 287 | Ga0466970_0004913 | 3300044765 | Bacteria | 6600 |
| 288 | Ga0466970_0077392 | 3300044765 | Bacteria | 1793 |
| 289 | Ga0466970_0216566 | 3300044765 | Bacteria | 1068 |
| 290 | Ga0466957_0000581 | 3300044842 | Bacteria | 18492 |
| 291 | Ga0466957_0069417 | 3300044842 | Bacteria | 2177 |
| 292 | Ga0466957_0077421 | 3300044842 | Bacteria | 2066 |
| 293 | Ga0466957_0631325 | 3300044842 | Bacteria | 752 |
| 294 | Ga0466957_0809202 | 3300044842 | Bacteria | 666 |
| 295 | Ga0466960_0006669 | 3300044901 | Bacteria | 4644 |
| 296 | Ga0466960_0255114 | 3300044901 | Bacteria | 975 |
| 297 | Ga0466959_0001913 | 3300045049 | Bacteria | 13101 |
| 298 | Ga0466959_0003244 | 3300045049 | Bacteria | 10585 |
| 299 | Ga0466959_0006999 | 3300045049 | Bacteria | 7881 |
| 300 | Ga0466959_0059373 | 3300045049 | Bacteria | 2785 |
| 301 | Ga0466959_0329448 | 3300045049 | Bacteria | 1043 |
| 302 | Ga0466958_0001612 | 3300045836 | Bacteria | 10858 |
| 303 | Ga0466958_0318575 | 3300045836 | Bacteria | 999 |
| 304 | Ga0466958_0780162 | 3300045836 | Bacteria | 623 |
| 305 | Ga0466967_0014568 | 3300045976 | Bacteria | 6131 |
| 306 | Ga0466967_0031279 | 3300045976 | Bacteria | 4478 |
| 307 | Ga0466967_0078324 | 3300045976 | Bacteria | 2977 |
| 308 | Ga0466967_0510713 | 3300045976 | Bacteria | 1180 |
| 309 | Ga0466967_0794383 | 3300045976 | Bacteria | 940 |
| 310 | Ga0466967_1210674 | 3300045976 | Bacteria | 752 |
| 311 | Ga0495617_030958 | 3300046452 | Bacteria | 1798 |
| 312 | Ga0495592_0006815 | 3300046454 | Bacteria | 8528 |
| 313 | Ga0495592_0030209 | 3300046454 | Bacteria | 4099 |
| 314 | Ga0495592_0040645 | 3300046454 | Bacteria | 3489 |
| 315 | Ga0495603_0010390 | 3300046455 | Bacteria | 5637 |
| 316 | Ga0495603_0012587 | 3300046455 | Bacteria | 5119 |
| 317 | Ga0495603_0014790 | 3300046455 | Bacteria | 4720 |
| 318 | Ga0495603_0017423 | 3300046455 | Bacteria | 4346 |
| 319 | Ga0495603_0027719 | 3300046455 | Bacteria | 3417 |
| 320 | Ga0495603_0029220 | 3300046455 | Bacteria | 3324 |
| 321 | Ga0495603_0130513 | 3300046455 | Bacteria | 1463 |
| 322 | Ga0495603_0182794 | 3300046455 | Bacteria | 1213 |
| 323 | Ga0495603_0287175 | 3300046455 | Bacteria | 945 |
| 324 | Ga0495603_0335267 | 3300046455 | Bacteria | 868 |
| 325 | Ga0495590_0025435 | 3300046457 | Bacteria | 2081 |
| 326 | Ga0495590_0085351 | 3300046457 | Bacteria | 1114 |
| 327 | Ga0495629_0000763 | 3300046459 | Bacteria | 25923 |
| 328 | Ga0495629_0001125 | 3300046459 | Bacteria | 21193 |
| 329 | Ga0495629_0002352 | 3300046459 | Bacteria | 14569 |
| 330 | Ga0495629_0018204 | 3300046459 | Bacteria | 5032 |
| 331 | Ga0495629_0020001 | 3300046459 | Bacteria | 4778 |
| 332 | Ga0495629_0022998 | 3300046459 | Bacteria | 4442 |
| 333 | Ga0495629_0056039 | 3300046459 | Bacteria | 2756 |
| 334 | Ga0495629_0066640 | 3300046459 | Bacteria | 2513 |
| 335 | Ga0495629_0212322 | 3300046459 | Bacteria | 1336 |
| 336 | Ga0495638_0017645 | 3300046460 | Bacteria | 4753 |
| 337 | Ga0495638_0022169 | 3300046460 | Bacteria | 4172 |
| 338 | Ga0495638_0030766 | 3300046460 | Bacteria | 3452 |
| 339 | Ga0495638_0139546 | 3300046460 | Bacteria | 1416 |
| 340 | Ga0495638_0298877 | 3300046460 | Bacteria | 868 |
| 341 | Ga0495651_0003297 | 3300046462 | Bacteria | 12391 |
| 342 | Ga0495651_0019425 | 3300046462 | Bacteria | 5268 |
| 343 | Ga0495651_0064616 | 3300046462 | Bacteria | 2796 |
| 344 | Ga0495653_0110578 | 3300046463 | Bacteria | 1975 |
| 345 | Ga0495650_0275559 | 3300046471 | Bacteria | 567 |
| 346 | Ga0495580_0050828 | 3300046472 | Bacteria | 2930 |
| 347 | Ga0495580_0065688 | 3300046472 | Bacteria | 2541 |
| 348 | Ga0495582_0019872 | 3300046473 | Bacteria | 3674 |
| 349 | Ga0495582_0217620 | 3300046473 | Bacteria | 1092 |
| 350 | Ga0495605_0010491 | 3300046474 | Bacteria | 5181 |
| 351 | Ga0495639_0010276 | 3300046475 | Bacteria | 4027 |
| 352 | Ga0495639_0578428 | 3300046475 | Bacteria | 577 |
| 353 | Ga0495662_0001181 | 3300046476 | Bacteria | 12890 |
| 354 | Ga0495662_0008465 | 3300046476 | Bacteria | 5059 |
| 355 | Ga0495662_0033850 | 3300046476 | Bacteria | 2468 |
| 356 | Ga0495662_0034895 | 3300046476 | Bacteria | 2428 |
| 357 | Ga0495662_0050710 | 3300046476 | Bacteria | 2003 |
| 358 | Ga0495664_0003330 | 3300046477 | Bacteria | 8730 |
| 359 | Ga0495585_0018249 | 3300046492 | Bacteria | 4049 |
| 360 | Ga0495585_0027318 | 3300046492 | Bacteria | 3257 |
| 361 | Ga0495585_0084813 | 3300046492 | Bacteria | 1712 |
| 362 | Ga0495585_0145086 | 3300046492 | Bacteria | 1241 |
| 363 | Ga0495594_0001243 | 3300046499 | Bacteria | 13345 |
| 364 | Ga0495594_0002889 | 3300046499 | Bacteria | 8936 |
| 365 | Ga0495594_0042434 | 3300046499 | Bacteria | 2491 |
| 366 | Ga0495594_0080283 | 3300046499 | Bacteria | 1821 |
| 367 | Ga0495594_0110520 | 3300046499 | Bacteria | 1550 |
| 368 | Ga0495594_0240583 | 3300046499 | Bacteria | 1032 |
| 369 | Ga0495594_0315758 | 3300046499 | Bacteria | 890 |
| 370 | Ga0495594_0393696 | 3300046499 | Bacteria | 788 |
| 371 | Ga0495596_0262456 | 3300046500 | Bacteria | 670 |
| 372 | Ga0495607_0102582 | 3300046501 | Bacteria | 1529 |
| 373 | Ga0495607_0108428 | 3300046501 | Bacteria | 1475 |
| 374 | Ga0495583_0018225 | 3300046506 | Bacteria | 3700 |
| 375 | Ga0495610_0025019 | 3300046512 | Bacteria | 3214 |
| 376 | Ga0495610_0187904 | 3300046512 | Bacteria | 855 |
| 377 | Ga0495616_0005671 | 3300046513 | Bacteria | 7645 |
| 378 | Ga0495618_0020075 | 3300046514 | Bacteria | 4113 |
| 379 | Ga0495618_0060256 | 3300046514 | Bacteria | 2406 |
| 380 | Ga0495618_0150237 | 3300046514 | Bacteria | 1488 |
| 381 | Ga0495618_0265684 | 3300046514 | Bacteria | 1073 |
| 382 | Ga0495618_0480857 | 3300046514 | Bacteria | 751 |
| 383 | Ga0495620_0009255 | 3300046515 | Bacteria | 5245 |
| 384 | Ga0495620_0122193 | 3300046515 | Bacteria | 1025 |
| 385 | Ga0495620_0154646 | 3300046515 | Bacteria | 893 |
| 386 | Ga0495628_0023674 | 3300046516 | Bacteria | 5038 |
| 387 | Ga0495628_0033610 | 3300046516 | Bacteria | 4131 |
| 388 | Ga0495628_0164216 | 3300046516 | Bacteria | 1686 |
| 389 | Ga0495630_0014351 | 3300046517 | Bacteria | 5770 |
| 390 | Ga0495630_0091961 | 3300046517 | Bacteria | 2293 |
| 391 | Ga0495631_0004895 | 3300046518 | Bacteria | 7052 |
| 392 | Ga0495631_0016807 | 3300046518 | Bacteria | 3477 |
| 393 | Ga0495631_0076072 | 3300046518 | Bacteria | 1449 |
| 394 | Ga0495631_0139758 | 3300046518 | Bacteria | 1040 |
| 395 | Ga0495632_0104096 | 3300046519 | Bacteria | 1336 |
| 396 | Ga0495632_0250828 | 3300046519 | Bacteria | 794 |
| 397 | Ga0495637_0019143 | 3300046520 | Bacteria | 3167 |
| 398 | Ga0495637_0067543 | 3300046520 | Bacteria | 1451 |
| 399 | Ga0495643_0010503 | 3300046522 | Bacteria | 5693 |
| 400 | Ga0495643_0017035 | 3300046522 | Bacteria | 4258 |
| 401 | Ga0495644_0082260 | 3300046523 | Bacteria | 1214 |
| 402 | Ga0495648_0042870 | 3300046524 | Bacteria | 2843 |
| 403 | Ga0495648_0416711 | 3300046524 | Bacteria | 596 |
| 404 | Ga0495666_0063697 | 3300046526 | Bacteria | 1760 |
| 405 | Ga0495666_0086849 | 3300046526 | Bacteria | 1477 |
| 406 | Ga0495666_0146317 | 3300046526 | Bacteria | 1100 |
| 407 | Ga0495642_0038500 | 3300046528 | Bacteria | 1938 |
| 408 | Ga0495642_0082571 | 3300046528 | Bacteria | 1355 |
| 409 | Ga0495652_0056978 | 3300046529 | Bacteria | 3316 |
| 410 | Ga0495652_0071477 | 3300046529 | Bacteria | 2896 |
| 411 | Ga0495652_0249963 | 3300046529 | Bacteria | 1314 |
| 412 | Ga0495654_0032227 | 3300046530 | Bacteria | 2657 |
| 413 | Ga0495640_0024612 | 3300046533 | Bacteria | 4378 |
| 414 | Ga0495640_0070088 | 3300046533 | Bacteria | 2357 |
| 415 | Ga0495640_0126053 | 3300046533 | Bacteria | 1661 |
| 416 | Ga0495640_0280615 | 3300046533 | Bacteria | 1037 |
| 417 | Ga0495586_0141856 | 3300046535 | Bacteria | 1349 |
| 418 | Ga0495587_0004720 | 3300046536 | Bacteria | 8941 |
| 419 | Ga0495587_0173569 | 3300046536 | Bacteria | 1224 |
| 420 | Ga0495609_0044503 | 3300046538 | Bacteria | 1990 |
| 421 | Ga0495609_0158395 | 3300046538 | Bacteria | 961 |
| 422 | Ga0495597_0013132 | 3300046542 | Bacteria | 3975 |
| 423 | Ga0495597_0162826 | 3300046542 | Bacteria | 909 |
| 424 | Ga0495645_0007723 | 3300046543 | Bacteria | 7485 |
| 425 | Ga0495645_0071573 | 3300046543 | Bacteria | 2500 |
| 426 | Ga0495622_0002791 | 3300046557 | Bacteria | 8335 |
| 427 | Ga0495622_0004580 | 3300046557 | Bacteria | 6402 |
| 428 | Ga0495622_0028023 | 3300046557 | Bacteria | 2629 |
| 429 | Ga0495622_0046673 | 3300046557 | Bacteria | 2012 |
| 430 | Ga0495622_0105813 | 3300046557 | Bacteria | 1289 |
| 431 | Ga0495633_0029911 | 3300046558 | Bacteria | 2648 |
| 432 | Ga0495633_0041208 | 3300046558 | Bacteria | 2196 |
| 433 | Ga0495633_0189048 | 3300046558 | Bacteria | 947 |
| 434 | Ga0495667_0110411 | 3300046559 | Bacteria | 1777 |
| 435 | Ga0495667_0157225 | 3300046559 | Bacteria | 1462 |
| 436 | Ga0495656_0067028 | 3300046615 | Bacteria | 1583 |
| 437 | Ga0495668_0010761 | 3300046616 | Bacteria | 5524 |
| 438 | Ga0495668_0030260 | 3300046616 | Bacteria | 3057 |
| 439 | Ga0495634_0001501 | 3300046642 | Bacteria | 20644 |
| 440 | Ga0495634_0017681 | 3300046642 | Bacteria | 5084 |
| 441 | Ga0495634_0025000 | 3300046642 | Bacteria | 4186 |
| 442 | Ga0495611_0060854 | 3300046648 | Bacteria | 1715 |
| 443 | Ga0495611_0070334 | 3300046648 | Bacteria | 1599 |
| 444 | Ga0495625_0017036 | 3300046660 | Bacteria | 5695 |
| 445 | Ga0495625_0043102 | 3300046660 | Bacteria | 3274 |
| 446 | Ga0495625_0057998 | 3300046660 | Bacteria | 2751 |
| 447 | Ga0495625_0087206 | 3300046660 | Bacteria | 2164 |
| 448 | Ga0495625_0109924 | 3300046660 | Bacteria | 1885 |
| 449 | Ga0495625_0111415 | 3300046660 | Bacteria | 1870 |
| 450 | Ga0495635_0000408 | 3300046663 | Bacteria | 27373 |
| 451 | Ga0495635_0132749 | 3300046663 | Bacteria | 1697 |
| 452 | Ga0495661_0337974 | 3300046665 | Bacteria | 744 |
| 453 | Ga0495588_0005045 | 3300046674 | Bacteria | 5861 |
| 454 | Ga0495588_0012624 | 3300046674 | Bacteria | 3999 |
| 455 | Ga0495588_0014145 | 3300046674 | Bacteria | 3815 |
| 456 | Ga0495588_0044079 | 3300046674 | Bacteria | 2284 |
| 457 | Ga0495588_0116761 | 3300046674 | Bacteria | 1406 |
| 458 | Ga0495588_0287815 | 3300046674 | Bacteria | 866 |
| 459 | Ga0495588_0358947 | 3300046674 | Bacteria | 765 |
| 460 | Ga0495657_0002188 | 3300046675 | Bacteria | 16568 |
| 461 | Ga0495657_0011272 | 3300046675 | Bacteria | 6694 |
| 462 | Ga0495657_0025880 | 3300046675 | Bacteria | 4162 |
| 463 | Ga0495657_0026757 | 3300046675 | Bacteria | 4081 |
| 464 | Ga0495657_0065452 | 3300046675 | Bacteria | 2390 |
| 465 | Ga0495599_0122941 | 3300046678 | Bacteria | 1613 |
| 466 | Ga0495623_0023158 | 3300046679 | Bacteria | 4008 |
| 467 | Ga0495646_0003363 | 3300046680 | Bacteria | 9948 |
| 468 | Ga0495658_0029706 | 3300046683 | Bacteria | 2962 |
| 469 | Ga0495613_0008645 | 3300046689 | Bacteria | 7555 |
| 470 | Ga0495613_0017345 | 3300046689 | Bacteria | 5365 |
| 471 | Ga0495613_0028766 | 3300046689 | Bacteria | 4133 |
| 472 | Ga0495613_0041397 | 3300046689 | Bacteria | 3412 |
| 473 | Ga0495613_0051375 | 3300046689 | Bacteria | 3038 |
| 474 | Ga0495613_0089073 | 3300046689 | Bacteria | 2235 |
| 475 | Ga0495613_0107579 | 3300046689 | Bacteria | 2011 |
| 476 | Ga0495613_0124730 | 3300046689 | Bacteria | 1847 |
| 477 | Ga0495613_0133584 | 3300046689 | Bacteria | 1776 |
| 478 | Ga0495613_0342453 | 3300046689 | Bacteria | 1028 |
| 479 | Ga0495624_0022326 | 3300046690 | Bacteria | 4185 |
| 480 | Ga0495624_0028651 | 3300046690 | Bacteria | 3637 |
| 481 | Ga0495624_0571539 | 3300046690 | Bacteria | 674 |
| 482 | Ga0495670_0004511 | 3300046691 | Bacteria | 6824 |
| 483 | Ga0495670_0248746 | 3300046691 | Bacteria | 947 |
| 484 | Ga0495671_0016068 | 3300046692 | Bacteria | 4002 |
| 485 | Ga0495649_0008303 | 3300046694 | Bacteria | 6251 |
| 486 | Ga0495649_0031689 | 3300046694 | Bacteria | 2914 |
| 487 | Ga0495649_0077038 | 3300046694 | Bacteria | 1785 |
| 488 | Ga0495649_0103838 | 3300046694 | Bacteria | 1509 |
| 489 | Ga0495589_0009354 | 3300046794 | Bacteria | 5096 |
| 490 | Ga0495589_0009504 | 3300046794 | Bacteria | 5054 |
| 491 | Ga0495589_0013267 | 3300046794 | Bacteria | 4253 |
| 492 | Ga0495589_0040584 | 3300046794 | Bacteria | 2324 |
| 493 | Ga0495589_0144959 | 3300046794 | Bacteria | 1136 |
| 494 | Ga0495600_0089362 | 3300046809 | Bacteria | 2009 |
| 495 | Ga0495600_0209504 | 3300046809 | Bacteria | 1249 |
| 496 | Ga0495600_0344517 | 3300046809 | Bacteria | 934 |
| 497 | Ga0495660_0001994 | 3300046810 | Bacteria | 13286 |
| 498 | Ga0495660_0042850 | 3300046810 | Bacteria | 2499 |
| 499 | Ga0495660_0058955 | 3300046810 | Bacteria | 2065 |
| 500 | Ga0495660_0132463 | 3300046810 | Bacteria | 1249 |
| 501 | Ga0495581_0012417 | 3300047315 | Bacteria | 4935 |
| 502 | Ga0495581_0037683 | 3300047315 | Bacteria | 2799 |
| 503 | Ga0495581_0151060 | 3300047315 | Bacteria | 1356 |
| 504 | Ga0495581_0178098 | 3300047315 | Bacteria | 1243 |
| 505 | Ga0495604_0000920 | 3300047317 | Bacteria | 24512 |
| 506 | Ga0495604_0129623 | 3300047317 | Bacteria | 1814 |
| 507 | Ga0495636_0003117 | 3300047318 | Bacteria | 6427 |
| 508 | Ga0495636_0003438 | 3300047318 | Bacteria | 6142 |
| 509 | Ga0495636_0018273 | 3300047318 | Bacteria | 2812 |
| 510 | Ga0495636_0035038 | 3300047318 | Bacteria | 2067 |
| 511 | Ga0495636_0048625 | 3300047318 | Bacteria | 1773 |
| 512 | Ga0495636_0053817 | 3300047318 | Bacteria | 1690 |
| 513 | Ga0495636_0062567 | 3300047318 | Bacteria | 1575 |
| 514 | Ga0495636_0129732 | 3300047318 | Bacteria | 1121 |
| 515 | Ga0495636_0254890 | 3300047318 | Bacteria | 812 |
| 516 | Ga0495674_0070014 | 3300047319 | Bacteria | 3032 |
| 517 | Ga0495674_0084831 | 3300047319 | Bacteria | 2714 |
| 518 | Ga0495672_0038501 | 3300047320 | Bacteria | 2916 |
| 519 | Ga0495676_0009717 | 3300047321 | Bacteria | 8746 |
| 520 | Ga0495676_0017221 | 3300047321 | Bacteria | 6395 |
| 521 | Ga0495676_0028759 | 3300047321 | Bacteria | 4742 |
| 522 | Ga0495676_0031605 | 3300047321 | Bacteria | 4474 |
| 523 | Ga0495676_0035387 | 3300047321 | Bacteria | 4177 |
| 524 | Ga0495676_0214560 | 3300047321 | Bacteria | 1329 |
| 525 | Ga0495676_0266427 | 3300047321 | Bacteria | 1164 |
| 526 | Ga0495676_0798823 | 3300047321 | Bacteria | 607 |
| 527 | Ga0495680_0131788 | 3300047322 | Bacteria | 1836 |
| 528 | Ga0495683_0035929 | 3300047323 | Bacteria | 2517 |
| 529 | Ga0495683_0053053 | 3300047323 | Bacteria | 2022 |
| 530 | Ga0495683_0189676 | 3300047323 | Bacteria | 933 |
| 531 | Ga0495687_002642 | 3300047443 | Bacteria | 14003 |
| 532 | Ga0495687_008731 | 3300047443 | Bacteria | 5754 |
| 533 | Ga0495687_029870 | 3300047443 | Bacteria | 2515 |
| 534 | Ga0495675_0012817 | 3300047444 | Bacteria | 5282 |
| 535 | Ga0495675_0014026 | 3300047444 | Bacteria | 5066 |
| 536 | Ga0495675_0042456 | 3300047444 | Bacteria | 2897 |
| 537 | Ga0495677_0105235 | 3300047445 | Bacteria | 1070 |
| 538 | Ga0495677_0191451 | 3300047445 | Bacteria | 794 |
| 539 | Ga0495677_0253913 | 3300047445 | Bacteria | 688 |
| 540 | Ga0495685_000133 | 3300047447 | Bacteria | 25839 |
| 541 | Ga0495685_007228 | 3300047447 | Bacteria | 3660 |
| 542 | Ga0495685_038711 | 3300047447 | Bacteria | 1633 |
| 543 | Ga0495685_065688 | 3300047447 | Bacteria | 1219 |
| 544 | Ga0495685_066139 | 3300047447 | Bacteria | 1215 |
| 545 | Ga0495681_0009498 | 3300047470 | Bacteria | 5983 |
| 546 | Ga0495681_0012112 | 3300047470 | Bacteria | 5082 |
| 547 | Ga0495681_0051621 | 3300047470 | Bacteria | 1933 |
| 548 | Ga0495681_0247800 | 3300047470 | Bacteria | 704 |
| 549 | Ga0495684_0272521 | 3300047471 | Bacteria | 1224 |
| 550 | Ga0495684_0447525 | 3300047471 | Bacteria | 898 |
| 551 | Ga0495686_0004762 | 3300047472 | Bacteria | 10979 |
| 552 | Ga0495686_0059871 | 3300047472 | Bacteria | 2369 |
| 553 | Ga0495686_0118841 | 3300047472 | Bacteria | 1578 |
| 554 | Ga0495686_0177322 | 3300047472 | Bacteria | 1236 |
| 555 | Ga0495593_0005290 | 3300047673 | Bacteria | 7625 |
| 556 | Ga0495593_0026491 | 3300047673 | Bacteria | 3200 |
| 557 | Ga0495593_0075975 | 3300047673 | Bacteria | 1741 |
| 558 | Ga0495593_0102829 | 3300047673 | Bacteria | 1464 |
| 559 | Ga0495593_0170585 | 3300047673 | Bacteria | 1097 |
| 560 | Ga0495593_0215536 | 3300047673 | Bacteria | 964 |
| 561 | Ga0495593_0515481 | 3300047673 | Bacteria | 599 |
| 562 | Ga0495602_0016998 | 3300048088 | Bacteria | 7299 |
| 563 | Ga0495614_0000594 | 3300048089 | Bacteria | 15141 |
| 564 | Ga0495614_0003174 | 3300048089 | Bacteria | 7339 |
| 565 | Ga0495626_0010193 | 3300048091 | Bacteria | 5038 |
| 566 | Ga0496102_0445276 | 3300048905 | Bacteria | 1215 |
| 567 | Ga0496103_0354133 | 3300048906 | Bacteria | 944 |
| 568 | Ga0496104_0079888 | 3300048907 | Bacteria | 3117 |
| 569 | Ga0496104_0474666 | 3300048907 | Bacteria | 1162 |
| 570 | Ga0496105_0085955 | 3300048908 | Bacteria | 2599 |
| 571 | Ga0496106_0542662 | 3300048909 | Bacteria | 933 |
| 572 | Ga0496107_0689181 | 3300048910 | Bacteria | 752 |
| 573 | Ga0496108_0145469 | 3300048911 | Bacteria | 2043 |
| 574 | Ga0496108_0469500 | 3300048911 | Bacteria | 1099 |
| 575 | Ga0496108_0849829 | 3300048911 | Bacteria | 785 |
| 576 | Ga0496109_0029382 | 3300048912 | Bacteria | 4923 |
| 577 | Ga0496109_0063537 | 3300048912 | Bacteria | 3377 |
| 578 | Ga0496109_0325928 | 3300048912 | Bacteria | 1450 |
| 579 | Ga0496110_0295898 | 3300048913 | Bacteria | 1474 |
| 580 | Ga0496110_1098724 | 3300048913 | Bacteria | 703 |
| 581 | Ga0496110_1228932 | 3300048913 | Bacteria | 658 |
| 582 | Ga0496111_0017686 | 3300048914 | Bacteria | 4930 |
| 583 | Ga0496112_0289441 | 3300048915 | Bacteria | 1584 |
| 584 | Ga0496112_0568319 | 3300048915 | Bacteria | 1067 |
| 585 | Ga0496112_0613296 | 3300048915 | Unclassified | 1019 |
| 586 | Ga0496113_0002493 | 3300048916 | Bacteria | 10722 |
| 587 | Ga0496115_0488535 | 3300048918 | Bacteria | 991 |
| 588 | Ga0496119_0347025 | 3300048922 | Bacteria | 720 |
| 589 | Ga0496123_0220181 | 3300048926 | Bacteria | 958 |
| 590 | Ga0496124_0068026 | 3300048927 | Bacteria | 2962 |
| 591 | Ga0496126_0052554 | 3300048929 | Bacteria | 3702 |
| 592 | Ga0495678_076067 | 3300049459 | Bacteria | 1217 |
| 593 | Ga0501031_0005905 | 3300049568 | Bacteria | 7978 |
| 594 | Ga0501031_0010593 | 3300049568 | Bacteria | 6002 |
| 595 | Ga0501031_0054865 | 3300049568 | Bacteria | 2596 |
| 596 | Ga0501031_0072552 | 3300049568 | Bacteria | 2241 |
| 597 | Ga0501031_0259044 | 3300049568 | Bacteria | 1130 |
| 598 | Ga0501032_0002976 | 3300049569 | Bacteria | 13151 |
| 599 | Ga0501032_0012268 | 3300049569 | Bacteria | 6132 |
| 600 | Ga0501032_0095318 | 3300049569 | Bacteria | 1973 |
| 601 | Ga0501032_0450669 | 3300049569 | Bacteria | 824 |
| 602 | Ga0501033_0001682 | 3300049570 | Bacteria | 19357 |
| 603 | Ga0501033_0003976 | 3300049570 | Bacteria | 11979 |
| 604 | Ga0501033_0010783 | 3300049570 | Bacteria | 7008 |
| 605 | Ga0501033_0014812 | 3300049570 | Bacteria | 5921 |
| 606 | Ga0501033_0081610 | 3300049570 | Bacteria | 2371 |
| 607 | Ga0501033_0084519 | 3300049570 | Bacteria | 2326 |
| 608 | Ga0501033_0130248 | 3300049570 | Bacteria | 1823 |
| 609 | Ga0501033_0154730 | 3300049570 | Bacteria | 1652 |
| 610 | Ga0501034_0020902 | 3300049571 | Bacteria | 6681 |
| 611 | Ga0501034_0024322 | 3300049571 | Bacteria | 6160 |
| 612 | Ga0501034_0031003 | 3300049571 | Bacteria | 5434 |
| 613 | Ga0501034_0031323 | 3300049571 | Bacteria | 5402 |
| 614 | Ga0501034_0088988 | 3300049571 | Bacteria | 3085 |
| 615 | Ga0501034_0149082 | 3300049571 | Bacteria | 2315 |
| 616 | Ga0501034_0158505 | 3300049571 | Bacteria | 2236 |
| 617 | Ga0501034_0615871 | 3300049571 | Bacteria | 990 |
| 618 | Ga0501034_1196162 | 3300049571 | Bacteria | 639 |
| 619 | Ga0501036_0000603 | 3300049572 | Bacteria | 26056 |
| 620 | Ga0501036_0004107 | 3300049572 | Bacteria | 11716 |
| 621 | Ga0501036_0006344 | 3300049572 | Bacteria | 9596 |
| 622 | Ga0501036_0020231 | 3300049572 | Bacteria | 5589 |
| 623 | Ga0501036_0037289 | 3300049572 | Bacteria | 4113 |
| 624 | Ga0501036_0117598 | 3300049572 | Bacteria | 2245 |
| 625 | Ga0501036_0672406 | 3300049572 | Bacteria | 856 |
| 626 | Ga0501037_0000832 | 3300049573 | Bacteria | 23045 |
| 627 | Ga0501037_0012131 | 3300049573 | Bacteria | 6345 |
| 628 | Ga0501037_0025200 | 3300049573 | Bacteria | 4395 |
| 629 | Ga0501037_0237019 | 3300049573 | Bacteria | 1280 |
| 630 | Ga0501037_0320433 | 3300049573 | Bacteria | 1073 |
| 631 | Ga0501038_0000231 | 3300049574 | Bacteria | 47327 |
| 632 | Ga0501038_0009979 | 3300049574 | Bacteria | 8695 |
| 633 | Ga0501038_0112289 | 3300049574 | Bacteria | 2256 |
| 634 | Ga0501038_0124225 | 3300049574 | Bacteria | 2125 |
| 635 | Ga0501038_0151604 | 3300049574 | Bacteria | 1889 |
| 636 | Ga0501038_0197042 | 3300049574 | Bacteria | 1618 |
| 637 | Ga0501039_0003296 | 3300049575 | Bacteria | 12069 |
| 638 | Ga0501039_0011475 | 3300049575 | Bacteria | 6742 |
| 639 | Ga0501039_0267645 | 3300049575 | Bacteria | 1343 |
| 640 | Ga0501039_0611561 | 3300049575 | Bacteria | 854 |
| 641 | Ga0501040_0005861 | 3300049576 | Bacteria | 7953 |
| 642 | Ga0501042_0015032 | 3300049578 | Bacteria | 5293 |
| 643 | Ga0501042_0402132 | 3300049578 | Bacteria | 992 |
| 644 | Ga0501043_0002088 | 3300049579 | Bacteria | 17067 |
| 645 | Ga0501043_0002774 | 3300049579 | Bacteria | 14645 |
| 646 | Ga0501043_0004088 | 3300049579 | Bacteria | 11922 |
| 647 | Ga0501043_0043971 | 3300049579 | Bacteria | 3511 |
| 648 | Ga0501043_0168484 | 3300049579 | Bacteria | 1709 |
| 649 | Ga0501043_0287753 | 3300049579 | Bacteria | 1258 |
| 650 | Ga0501043_0335673 | 3300049579 | Bacteria | 1150 |
| 651 | Ga0501046_0003833 | 3300049580 | Bacteria | 13759 |
| 652 | Ga0501046_0009593 | 3300049580 | Bacteria | 8351 |
| 653 | Ga0501046_0041476 | 3300049580 | Bacteria | 3672 |
| 654 | Ga0501046_0157102 | 3300049580 | Bacteria | 1712 |
| 655 | Ga0501047_0008070 | 3300049581 | Bacteria | 9932 |
| 656 | Ga0501047_0012570 | 3300049581 | Bacteria | 8018 |
| 657 | Ga0501047_0032534 | 3300049581 | Bacteria | 5035 |
| 658 | Ga0501047_0036474 | 3300049581 | Bacteria | 4751 |
| 659 | Ga0501047_0039284 | 3300049581 | Bacteria | 4577 |
| 660 | Ga0501047_0061622 | 3300049581 | Bacteria | 3619 |
| 661 | Ga0501047_0192917 | 3300049581 | Bacteria | 1900 |
| 662 | Ga0501047_0226469 | 3300049581 | Bacteria | 1724 |
| 663 | Ga0501047_0251957 | 3300049581 | Bacteria | 1614 |
| 664 | Ga0501047_0562311 | 3300049581 | Bacteria | 964 |
| 665 | Ga0501048_0003964 | 3300049582 | Bacteria | 11246 |
| 666 | Ga0501048_0017476 | 3300049582 | Bacteria | 5281 |
| 667 | Ga0501048_0060025 | 3300049582 | Bacteria | 2695 |
| 668 | Ga0501048_0070219 | 3300049582 | Bacteria | 2474 |
| 669 | Ga0501048_0215026 | 3300049582 | Bacteria | 1363 |
| 670 | Ga0501068_0006308 | 3300049584 | Bacteria | 6532 |
| 671 | Ga0501068_0481735 | 3300049584 | Bacteria | 804 |
| 672 | Ga0501069_0003540 | 3300049585 | Bacteria | 8037 |
| 673 | Ga0501070_0015281 | 3300049586 | Bacteria | 6459 |
| 674 | Ga0501070_0307453 | 3300049586 | Bacteria | 1291 |
| 675 | Ga0501070_0511826 | 3300049586 | Bacteria | 964 |
| 676 | Ga0501070_0770181 | 3300049586 | Bacteria | 757 |
| 677 | Ga0501070_0830601 | 3300049586 | Bacteria | 724 |
| 678 | Ga0501070_1126472 | 3300049586 | Bacteria | 604 |
| 679 | Ga0501071_0005287 | 3300049587 | Bacteria | 8282 |
| 680 | Ga0501072_0002025 | 3300049588 | Bacteria | 15080 |
| 681 | Ga0501072_1066324 | 3300049588 | Bacteria | 629 |
| 682 | Ga0501073_0122461 | 3300049589 | Bacteria | 1802 |
| 683 | Ga0501073_0317574 | 3300049589 | Bacteria | 1075 |
| 684 | Ga0501074_0006619 | 3300049590 | Bacteria | 8378 |
| 685 | Ga0501074_0221398 | 3300049590 | Bacteria | 1347 |
| 686 | Ga0501074_0606561 | 3300049590 | Bacteria | 774 |
| 687 | Ga0501076_0210350 | 3300049592 | Bacteria | 1589 |
| 688 | Ga0501077_0009138 | 3300049593 | Bacteria | 6154 |
| 689 | Ga0501223_069603 | 3300049663 | Bacteria | 694 |
| 690 | Ga0501235_050762 | 3300049669 | Bacteria | 961 |
| 691 | Ga0501079_0007274 | 3300049741 | Bacteria | 8358 |
| 692 | Ga0501080_0275758 | 3300049742 | Bacteria | 1530 |
| 693 | Ga0501080_0319627 | 3300049742 | Bacteria | 1405 |
| 694 | Ga0501080_0815672 | 3300049742 | Bacteria | 817 |
| 695 | Ga0501083_0000743 | 3300049744 | Bacteria | 21288 |
| 696 | Ga0501083_0333833 | 3300049744 | Bacteria | 986 |
| 697 | Ga0501282_002532 | 3300049778 | Bacteria | 1982 |
| 698 | Ga0501035_0004966 | 3300049822 | Bacteria | 12612 |
| 699 | Ga0501035_0026001 | 3300049822 | Bacteria | 5362 |
| 700 | Ga0501035_0036046 | 3300049822 | Bacteria | 4485 |
| 701 | Ga0501035_0057671 | 3300049822 | Bacteria | 3461 |
| 702 | Ga0501035_0082275 | 3300049822 | Bacteria | 2841 |
| 703 | Ga0501035_0097265 | 3300049822 | Bacteria | 2585 |
| 704 | Ga0501035_0198038 | 3300049822 | Bacteria | 1724 |
| 705 | Ga0501035_0308221 | 3300049822 | Bacteria | 1332 |
| 706 | Ga0501035_0762469 | 3300049822 | Bacteria | 776 |
| 707 | Ga0501044_0004352 | 3300049823 | Bacteria | 15862 |
| 708 | Ga0501044_0005219 | 3300049823 | Bacteria | 14455 |
| 709 | Ga0501044_0005493 | 3300049823 | Bacteria | 14083 |
| 710 | Ga0501044_0012492 | 3300049823 | Bacteria | 9195 |
| 711 | Ga0501044_0016519 | 3300049823 | Bacteria | 7921 |
| 712 | Ga0501044_0053364 | 3300049823 | Bacteria | 4159 |
| 713 | Ga0501044_0117849 | 3300049823 | Bacteria | 2659 |
| 714 | Ga0501044_0304081 | 3300049823 | Bacteria | 1523 |
| 715 | Ga0501044_0470222 | 3300049823 | Bacteria | 1161 |
| 716 | Ga0501044_0578692 | 3300049823 | Bacteria | 1017 |
| 717 | Ga0501044_0825538 | 3300049823 | Bacteria | 805 |
| 718 | Ga0501045_0381768 | 3300049824 | Bacteria | 1049 |
| 719 | nmdc:mga03683_377297_c1 | 3300050489 | Bacteria | 674 |
| 720 | nmdc:mga03n38_83388_c1 | 3300050490 | Bacteria | 1507 |
| 721 | nmdc:mga06z11_127060_c1 | 3300050494 | Bacteria | 1428 |
| 722 | nmdc:mga04h51_6120_c1 | 3300050495 | Bacteria | 3102 |
| 723 | nmdc:mga07m45_77589_c1 | 3300050496 | Bacteria | 1895 |
| 724 | Ga0495619_0242673 | 3300053085 | Bacteria | 1248 |
| 725 | Ga0500578_0114814 | 3300053086 | Bacteria | 1695 |
| 726 | Ga0500578_0322575 | 3300053086 | Bacteria | 910 |
| 727 | Ga0500644_0010133 | 3300053088 | Bacteria | 2543 |
| 728 | Ga0500644_0023261 | 3300053088 | Bacteria | 1880 |
| 729 | Ga0500646_0000359 | 3300053090 | Bacteria | 13745 |
| 730 | Ga0500646_0052212 | 3300053090 | Bacteria | 1183 |
| 731 | Ga0500583_0246741 | 3300053092 | Bacteria | 882 |
| 732 | Ga0500640_011796 | 3300053095 | Bacteria | 3570 |
| 733 | Ga0500654_063823 | 3300053099 | Bacteria | 1860 |
| 734 | Ga0500553_077472 | 3300053101 | Bacteria | 1508 |
| 735 | Ga0500560_010149 | 3300053107 | Bacteria | 2346 |
| 736 | Ga0500560_024191 | 3300053107 | Bacteria | 1770 |
| 737 | Ga0500569_003921 | 3300053109 | Bacteria | 3086 |
| 738 | Ga0500572_006235 | 3300053111 | Bacteria | 2727 |
| 739 | Ga0500594_0128135 | 3300053118 | Bacteria | 802 |
| 740 | Ga0500617_112577 | 3300053124 | Bacteria | 1135 |
| 741 | Ga0500628_002210 | 3300053129 | Bacteria | 3250 |
| 742 | Ga0500652_003648 | 3300053131 | Bacteria | 4683 |
| 743 | Ga0500658_0001635 | 3300053134 | Bacteria | 8933 |
| 744 | Ga0500559_0003914 | 3300053136 | Bacteria | 7190 |
| 745 | Ga0500561_0002416 | 3300053137 | Bacteria | 3142 |
| 746 | Ga0500568_0140902 | 3300053139 | Bacteria | 894 |
| 747 | Ga0500573_0037191 | 3300053140 | Bacteria | 2812 |
| 748 | Ga0500573_0089299 | 3300053140 | Bacteria | 1743 |
| 749 | Ga0500577_0014784 | 3300053142 | Bacteria | 2422 |
| 750 | Ga0500577_0111670 | 3300053142 | Bacteria | 1129 |
| 751 | Ga0500579_087240 | 3300053143 | Bacteria | 1707 |
| 752 | Ga0500588_0002851 | 3300053146 | Bacteria | 3584 |
| 753 | Ga0500588_0277734 | 3300053146 | Bacteria | 632 |
| 754 | Ga0500600_0019800 | 3300053149 | Bacteria | 4049 |
| 755 | Ga0500616_0336230 | 3300053153 | Bacteria | 618 |
| 756 | Ga0500622_0235644 | 3300053156 | Bacteria | 812 |
| 757 | Ga0500633_0038105 | 3300053160 | Bacteria | 1599 |
| 758 | Ga0500634_0009835 | 3300053161 | Bacteria | 4862 |
| 759 | Ga0500634_0177886 | 3300053161 | Bacteria | 961 |
| 760 | Ga0500656_000596 | 3300053732 | Bacteria | 2767 |
| 761 | Ga0500587_002964 | 3300053739 | Bacteria | 2403 |
| 762 | Ga0501084_0100963 | 3300054114 | Bacteria | 2423 |
| 763 | Ga0587122_011395 | 3300059628 | Bacteria | 854 |
| 764 | Ga0501082_0051593 | 3300060353 | Bacteria | 3545 |
| 765 | Ga0466962_0000168 | 3300061719 | Bacteria | 27818 |
| 766 | Ga0466962_0110057 | 3300061719 | Bacteria | 1326 |
| 767 | Ga0466962_0192325 | 3300061719 | Bacteria | 996 |
| 768 | Ga0530510_0148368 | 3300061734 | Bacteria | 1730 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041509 | Ga0451843_1509281 | Ga0451843_1509281_183_743 | 158 |
| 2 | 3300044658 | Ga0466972_0447947 | Ga0466972_0447947_14_538 | 160 |
| 3 | 3300044765 | Ga0466970_0077392 | Ga0466970_0077392_880_1404 | 160 |
| 4 | 3300045049 | Ga0466959_0059373 | Ga0466959_0059373_1770_2294 | 160 |
| 5 | 3300048927 | Ga0496124_0068026 | Ga0496124_0068026_2267_2791 | 160 |
| 6 | 3300049588 | Ga0501072_1066324 | Ga0501072_1066324_112_615 | 164 |
| 7 | 3300005436 | Ga0070713_100766211 | Ga0070713_1007662111 | 167 |
| 8 | 3300006844 | Ga0075428_100687618 | Ga0075428_1006876182 | 172 |
| 9 | 3300005347 | Ga0070668_100003878 | Ga0070668_1000038787 | 173 |
| 10 | 3300005367 | Ga0070667_101154676 | Ga0070667_1011546762 | 173 |
| 11 | 3300005455 | Ga0070663_100000450 | Ga0070663_1000004502 | 173 |
| 12 | 3300005455 | Ga0070663_100010974 | Ga0070663_1000109741 | 173 |
| 13 | 3300031852 | Ga0307410_10218052 | Ga0307410_102180523 | 173 |
| 14 | 3300032002 | Ga0307416_100031544 | Ga0307416_1000315443 | 173 |
| 15 | 3300046455 | Ga0495603_0027719 | Ga0495603_0027719_500_1024 | 173 |
| 16 | 3300046459 | Ga0495629_0000763 | Ga0495629_0000763_5015_5539 | 173 |
| 17 | 3300046499 | Ga0495594_0393696 | Ga0495594_0393696_103_627 | 173 |
| 18 | 3300046689 | Ga0495613_0124730 | Ga0495613_0124730_1267_1791 | 173 |
| 19 | 3300047321 | Ga0495676_0028759 | Ga0495676_0028759_122_646 | 173 |
| 20 | 3300047673 | Ga0495593_0170585 | Ga0495593_0170585_116_640 | 173 |
| 21 | 3300048089 | Ga0495614_0000594 | Ga0495614_0000594_5686_6210 | 173 |
| 22 | 3300003203 | JGI25406J46586_10010577 | JGI25406J46586_100105772 | 174 |
| 23 | 3300003316 | rootH1_10034127 | rootH1_100341277 | 174 |
| 24 | 3300003320 | rootH2_10080827 | rootH2_100808271 | 174 |
| 25 | 3300003354 | JGI25160J50197_1010101 | JGI25160J50197_10101013 | 174 |
| 26 | 3300003354 | JGI25160J50197_1034468 | JGI25160J50197_10344682 | 174 |
| 27 | 3300005329 | Ga0070683_100083517 | Ga0070683_1000835173 | 174 |
| 28 | 3300005329 | Ga0070683_100860236 | Ga0070683_1008602361 | 174 |
| 29 | 3300005339 | Ga0070660_100873306 | Ga0070660_1008733062 | 174 |
| 30 | 3300005344 | Ga0070661_100419672 | Ga0070661_1004196722 | 174 |
| 31 | 3300005344 | Ga0070661_100610961 | Ga0070661_1006109612 | 174 |
| 32 | 3300005354 | Ga0070675_100748090 | Ga0070675_1007480901 | 174 |
| 33 | 3300005355 | Ga0070671_100628646 | Ga0070671_1006286462 | 174 |
| 34 | 3300005356 | Ga0070674_100024269 | Ga0070674_1000242693 | 174 |
| 35 | 3300005356 | Ga0070674_100118821 | Ga0070674_1001188211 | 174 |
| 36 | 3300005366 | Ga0070659_100879752 | Ga0070659_1008797522 | 174 |
| 37 | 3300005434 | Ga0070709_10822967 | Ga0070709_108229671 | 174 |
| 38 | 3300005436 | Ga0070713_100506843 | Ga0070713_1005068432 | 174 |
| 39 | 3300005437 | Ga0070710_10000158 | Ga0070710_1000015825 | 174 |
| 40 | 3300005455 | Ga0070663_100830547 | Ga0070663_1008305471 | 174 |
| 41 | 3300005456 | Ga0070678_100630777 | Ga0070678_1006307772 | 174 |
| 42 | 3300005456 | Ga0070678_100815706 | Ga0070678_1008157062 | 174 |
| 43 | 3300005458 | Ga0070681_11083702 | Ga0070681_110837021 | 174 |
| 44 | 3300005459 | Ga0068867_100672415 | Ga0068867_1006724152 | 174 |
| 45 | 3300005466 | Ga0070685_10000870 | Ga0070685_1000087011 | 174 |
| 46 | 3300005530 | Ga0070679_100454802 | Ga0070679_1004548022 | 174 |
| 47 | 3300005535 | Ga0070684_100024815 | Ga0070684_1000248153 | 174 |
| 48 | 3300005535 | Ga0070684_100121900 | Ga0070684_1001219003 | 174 |
| 49 | 3300005535 | Ga0070684_100159679 | Ga0070684_1001596792 | 174 |
| 50 | 3300005535 | Ga0070684_100459058 | Ga0070684_1004590582 | 174 |
| 51 | 3300005535 | Ga0070684_100633499 | Ga0070684_1006334991 | 174 |
| 52 | 3300005539 | Ga0068853_100010969 | Ga0068853_1000109697 | 174 |
| 53 | 3300005539 | Ga0068853_100125636 | Ga0068853_1001256361 | 174 |
| 54 | 3300005539 | Ga0068853_101775563 | Ga0068853_1017755631 | 174 |
| 55 | 3300005548 | Ga0070665_100040185 | Ga0070665_1000401852 | 174 |
| 56 | 3300005548 | Ga0070665_100232242 | Ga0070665_1002322424 | 174 |
| 57 | 3300005564 | Ga0070664_100057265 | Ga0070664_1000572653 | 174 |
| 58 | 3300005577 | Ga0068857_100139912 | Ga0068857_1001399123 | 174 |
| 59 | 3300005578 | Ga0068854_100913560 | Ga0068854_1009135602 | 174 |
| 60 | 3300005614 | Ga0068856_100239250 | Ga0068856_1002392503 | 174 |
| 61 | 3300005616 | Ga0068852_100542870 | Ga0068852_1005428702 | 174 |
| 62 | 3300005616 | Ga0068852_101279811 | Ga0068852_1012798112 | 174 |
| 63 | 3300005618 | Ga0068864_100012137 | Ga0068864_1000121373 | 174 |
| 64 | 3300005719 | Ga0068861_100424784 | Ga0068861_1004247841 | 174 |
| 65 | 3300005841 | Ga0068863_100193177 | Ga0068863_1001931771 | 174 |
| 66 | 3300005841 | Ga0068863_101494873 | Ga0068863_1014948731 | 174 |
| 67 | 3300005842 | Ga0068858_100253821 | Ga0068858_1002538212 | 174 |
| 68 | 3300005937 | Ga0081455_10339733 | Ga0081455_103397332 | 174 |
| 69 | 3300005981 | Ga0081538_10001098 | Ga0081538_1000109820 | 174 |
| 70 | 3300005983 | Ga0081540_1086172 | Ga0081540_10861722 | 174 |
| 71 | 3300005985 | Ga0081539_10000173 | Ga0081539_1000017355 | 174 |
| 72 | 3300006028 | Ga0070717_10188534 | Ga0070717_101885342 | 174 |
| 73 | 3300006028 | Ga0070717_10382673 | Ga0070717_103826731 | 174 |
| 74 | 3300006042 | Ga0075368_10019948 | Ga0075368_100199482 | 174 |
| 75 | 3300006048 | Ga0075363_100024448 | Ga0075363_1000244483 | 174 |
| 76 | 3300006173 | Ga0070716_100257080 | Ga0070716_1002570802 | 174 |
| 77 | 3300006178 | Ga0075367_10001478 | Ga0075367_100014787 | 174 |
| 78 | 3300006358 | Ga0068871_100911839 | Ga0068871_1009118392 | 174 |
| 79 | 3300006847 | Ga0075431_100385224 | Ga0075431_1003852242 | 174 |
| 80 | 3300006880 | Ga0075429_100001872 | Ga0075429_10000187210 | 174 |
| 81 | 3300006880 | Ga0075429_100079501 | Ga0075429_1000795013 | 174 |
| 82 | 3300006948 | Ga0099826_10050777 | Ga0099826_100507771 | 174 |
| 83 | 3300009011 | Ga0105251_10008794 | Ga0105251_100087943 | 174 |
| 84 | 3300009094 | Ga0111539_11815165 | Ga0111539_118151651 | 174 |
| 85 | 3300009098 | Ga0105245_10369678 | Ga0105245_103696782 | 174 |
| 86 | 3300009098 | Ga0105245_10513312 | Ga0105245_105133121 | 174 |
| 87 | 3300009101 | Ga0105247_10179591 | Ga0105247_101795912 | 174 |
| 88 | 3300009147 | Ga0114129_12618001 | Ga0114129_126180011 | 174 |
| 89 | 3300009148 | Ga0105243_10572832 | Ga0105243_105728322 | 174 |
| 90 | 3300009177 | Ga0105248_10034305 | Ga0105248_100343054 | 174 |
| 91 | 3300009177 | Ga0105248_10614652 | Ga0105248_106146522 | 174 |
| 92 | 3300009551 | Ga0105238_10607689 | Ga0105238_106076892 | 174 |
| 93 | 3300009551 | Ga0105238_10745308 | Ga0105238_107453082 | 174 |
| 94 | 3300009553 | Ga0105249_10222611 | Ga0105249_102226111 | 174 |
| 95 | 3300011119 | Ga0105246_10002882 | Ga0105246_100028823 | 174 |
| 96 | 3300011119 | Ga0105246_10537800 | Ga0105246_105378002 | 174 |
| 97 | 3300012490 | Ga0157322_1008915 | Ga0157322_10089152 | 174 |
| 98 | 3300012503 | Ga0157313_1001614 | Ga0157313_10016142 | 174 |
| 99 | 3300013105 | Ga0157369_10062288 | Ga0157369_100622883 | 174 |
| 100 | 3300013296 | Ga0157374_11129171 | Ga0157374_111291712 | 174 |
| 101 | 3300013306 | Ga0163162_11845321 | Ga0163162_118453211 | 174 |
| 102 | 3300013307 | Ga0157372_10077506 | Ga0157372_100775064 | 174 |
| 103 | 3300013308 | Ga0157375_10361097 | Ga0157375_103610972 | 174 |
| 104 | 3300014325 | Ga0163163_10002986 | Ga0163163_100029867 | 174 |
| 105 | 3300014325 | Ga0163163_10044342 | Ga0163163_100443424 | 174 |
| 106 | 3300014325 | Ga0163163_11036005 | Ga0163163_110360052 | 174 |
| 107 | 3300014326 | Ga0157380_12074321 | Ga0157380_120743211 | 174 |
| 108 | 3300014497 | Ga0182008_10008823 | Ga0182008_100088232 | 174 |
| 109 | 3300014745 | Ga0157377_10737251 | Ga0157377_107372511 | 174 |
| 110 | 3300014968 | Ga0157379_10078837 | Ga0157379_100788372 | 174 |
| 111 | 3300014968 | Ga0157379_10305055 | Ga0157379_103050552 | 174 |
| 112 | 3300014969 | Ga0157376_11861728 | Ga0157376_118617281 | 174 |
| 113 | 3300015261 | Ga0182006_1013159 | Ga0182006_10131592 | 174 |
| 114 | 3300015262 | Ga0182007_10000817 | Ga0182007_100008173 | 174 |
| 115 | 3300015688 | Ga0183367_1002 | Ga0183367_1002376 | 174 |
| 116 | 3300021388 | Ga0213875_10002957 | Ga0213875_100029577 | 174 |
| 117 | 3300025297 | Ga0209758_1014489 | Ga0209758_10144893 | 174 |
| 118 | 3300025302 | Ga0207426_1001306 | Ga0207426_100130613 | 174 |
| 119 | 3300025302 | Ga0207426_1001848 | Ga0207426_10018486 | 174 |
| 120 | 3300025302 | Ga0207426_1002757 | Ga0207426_10027575 | 174 |
| 121 | 3300025302 | Ga0207426_1010918 | Ga0207426_10109184 | 174 |
| 122 | 3300025735 | Ga0207713_1032563 | Ga0207713_10325633 | 174 |
| 123 | 3300025898 | Ga0207692_10009605 | Ga0207692_100096053 | 174 |
| 124 | 3300025906 | Ga0207699_10151302 | Ga0207699_101513022 | 174 |
| 125 | 3300025912 | Ga0207707_10646139 | Ga0207707_106461392 | 174 |
| 126 | 3300025916 | Ga0207663_10347687 | Ga0207663_103476871 | 174 |
| 127 | 3300025920 | Ga0207649_11294285 | Ga0207649_112942851 | 174 |
| 128 | 3300025924 | Ga0207694_10620977 | Ga0207694_106209772 | 174 |
| 129 | 3300025924 | Ga0207694_10621337 | Ga0207694_106213371 | 174 |
| 130 | 3300025927 | Ga0207687_10293450 | Ga0207687_102934501 | 174 |
| 131 | 3300025928 | Ga0207700_10438357 | Ga0207700_104383571 | 174 |
| 132 | 3300025928 | Ga0207700_10873607 | Ga0207700_108736071 | 174 |
| 133 | 3300025929 | Ga0207664_10005716 | Ga0207664_100057162 | 174 |
| 134 | 3300025934 | Ga0207686_10477905 | Ga0207686_104779051 | 174 |
| 135 | 3300025937 | Ga0207669_10016652 | Ga0207669_100166523 | 174 |
| 136 | 3300025937 | Ga0207669_10080358 | Ga0207669_100803583 | 174 |
| 137 | 3300025941 | Ga0207711_10098123 | Ga0207711_100981233 | 174 |
| 138 | 3300025945 | Ga0207679_10106311 | Ga0207679_101063112 | 174 |
| 139 | 3300025981 | Ga0207640_10372940 | Ga0207640_103729402 | 174 |
| 140 | 3300026041 | Ga0207639_10456527 | Ga0207639_104565271 | 174 |
| 141 | 3300026078 | Ga0207702_11503955 | Ga0207702_115039551 | 174 |
| 142 | 3300026121 | Ga0207683_11377686 | Ga0207683_113776862 | 174 |
| 143 | 3300026142 | Ga0207698_11024681 | Ga0207698_110246811 | 174 |
| 144 | 3300027866 | Ga0209813_10005391 | Ga0209813_100053912 | 174 |
| 145 | 3300028379 | Ga0268266_10012541 | Ga0268266_100125412 | 174 |
| 146 | 3300028379 | Ga0268266_10478045 | Ga0268266_104780452 | 174 |
| 147 | 3300028379 | Ga0268266_10505727 | Ga0268266_105057272 | 174 |
| 148 | 3300028380 | Ga0268265_10000008 | Ga0268265_10000008201 | 174 |
| 149 | 3300028786 | Ga0307517_10001976 | Ga0307517_1000197637 | 174 |
| 150 | 3300028786 | Ga0307517_10010759 | Ga0307517_100107596 | 174 |
| 151 | 3300028794 | Ga0307515_10000573 | Ga0307515_100005739 | 174 |
| 152 | 3300028794 | Ga0307515_10056033 | Ga0307515_100560333 | 174 |
| 153 | 3300028794 | Ga0307515_10409932 | Ga0307515_104099322 | 174 |
| 154 | 3300030521 | Ga0307511_10002078 | Ga0307511_1000207814 | 174 |
| 155 | 3300030521 | Ga0307511_10019025 | Ga0307511_100190251 | 174 |
| 156 | 3300030522 | Ga0307512_10046279 | Ga0307512_100462792 | 174 |
| 157 | 3300030522 | Ga0307512_10060881 | Ga0307512_100608812 | 174 |
| 158 | 3300030745 | Ga0316182_1181641 | Ga0316182_11816411 | 174 |
| 159 | 3300031456 | Ga0307513_10020470 | Ga0307513_100204703 | 174 |
| 160 | 3300031507 | Ga0307509_10227715 | Ga0307509_102277152 | 174 |
| 161 | 3300031507 | Ga0307509_10228616 | Ga0307509_102286163 | 174 |
| 162 | 3300031616 | Ga0307508_10012239 | Ga0307508_100122393 | 174 |
| 163 | 3300031616 | Ga0307508_10012977 | Ga0307508_100129774 | 174 |
| 164 | 3300031616 | Ga0307508_10036728 | Ga0307508_100367285 | 174 |
| 165 | 3300031616 | Ga0307508_10037736 | Ga0307508_100377364 | 174 |
| 166 | 3300031616 | Ga0307508_10131454 | Ga0307508_101314543 | 174 |
| 167 | 3300031616 | Ga0307508_10348546 | Ga0307508_103485462 | 174 |
| 168 | 3300031649 | Ga0307514_10002934 | Ga0307514_100029343 | 174 |
| 169 | 3300031649 | Ga0307514_10100336 | Ga0307514_101003363 | 174 |
| 170 | 3300031649 | Ga0307514_10138027 | Ga0307514_101380271 | 174 |
| 171 | 3300031730 | Ga0307516_10011280 | Ga0307516_100112804 | 174 |
| 172 | 3300031730 | Ga0307516_10075768 | Ga0307516_100757683 | 174 |
| 173 | 3300031730 | Ga0307516_10181201 | Ga0307516_101812013 | 174 |
| 174 | 3300031730 | Ga0307516_10216060 | Ga0307516_102160602 | 174 |
| 175 | 3300031730 | Ga0307516_10422406 | Ga0307516_104224061 | 174 |
| 176 | 3300031824 | Ga0307413_10483676 | Ga0307413_104836762 | 174 |
| 177 | 3300031824 | Ga0307413_10489999 | Ga0307413_104899992 | 174 |
| 178 | 3300031838 | Ga0307518_10000112 | Ga0307518_1000011235 | 174 |
| 179 | 3300031838 | Ga0307518_10033606 | Ga0307518_100336062 | 174 |
| 180 | 3300031901 | Ga0307406_10608627 | Ga0307406_106086272 | 174 |
| 181 | 3300031903 | Ga0307407_10176598 | Ga0307407_101765982 | 174 |
| 182 | 3300031903 | Ga0307407_10622535 | Ga0307407_106225352 | 174 |
| 183 | 3300031995 | Ga0307409_100473179 | Ga0307409_1004731792 | 174 |
| 184 | 3300032002 | Ga0307416_100387891 | Ga0307416_1003878912 | 174 |
| 185 | 3300032002 | Ga0307416_100549642 | Ga0307416_1005496422 | 174 |
| 186 | 3300032004 | Ga0307414_11666137 | Ga0307414_116661371 | 174 |
| 187 | 3300032126 | Ga0307415_100459996 | Ga0307415_1004599962 | 174 |
| 188 | 3300033179 | Ga0307507_10017829 | Ga0307507_100178293 | 174 |
| 189 | 3300033179 | Ga0307507_10053956 | Ga0307507_100539563 | 174 |
| 190 | 3300033180 | Ga0307510_10023073 | Ga0307510_100230733 | 174 |
| 191 | 3300033180 | Ga0307510_10031752 | Ga0307510_100317524 | 174 |
| 192 | 3300035121 | Ga0373960_0049582 | Ga0373960_0049582_156_683 | 174 |
| 193 | 3300035242 | Ga0373962_0015607 | Ga0373962_0015607_1014_1541 | 174 |
| 194 | 3300037418 | Ga0395900_0092122 | Ga0395900_0092122_203_727 | 174 |
| 195 | 3300037418 | Ga0395900_0831748 | Ga0395900_0831748_111_635 | 174 |
| 196 | 3300037466 | Ga0395898_0003080 | Ga0395898_0003080_15535_16059 | 174 |
| 197 | 3300037466 | Ga0395898_0014340 | Ga0395898_0014340_4157_4681 | 174 |
| 198 | 3300037466 | Ga0395898_0106436 | Ga0395898_0106436_2102_2626 | 174 |
| 199 | 3300037466 | Ga0395898_1132737 | Ga0395898_1132737_10_534 | 174 |
| 200 | 3300037471 | Ga0395905_0355780 | Ga0395905_0355780_415_939 | 174 |
| 201 | 3300037853 | Ga0436364_0645566 | Ga0436364_0645566_11322_11846 | 174 |
| 202 | 3300038443 | Ga0395901_0249537 | Ga0395901_0249537_474_998 | 174 |
| 203 | 3300039062 | Ga0400483_122074 | Ga0400483_122074_12455_12988 | 174 |
| 204 | 3300039062 | Ga0400483_274169 | Ga0400483_274169_14574_15107 | 174 |
| 205 | 3300041404 | Ga0439436_0000677 | Ga0439436_0000677_54_578 | 174 |
| 206 | 3300041404 | Ga0439436_0007726 | Ga0439436_0007726_546_1070 | 174 |
| 207 | 3300041406 | Ga0439439_0029023 | Ga0439439_0029023_98_625 | 174 |
| 208 | 3300041443 | Ga0451789_0910477 | Ga0451789_0910477_17_541 | 174 |
| 209 | 3300041451 | Ga0451791_1040063 | Ga0451791_1040063_146_673 | 174 |
| 210 | 3300041451 | Ga0451791_1317664 | Ga0451791_1317664_133_657 | 174 |
| 211 | 3300041459 | Ga0451800_1683482 | Ga0451800_1683482_371_895 | 174 |
| 212 | 3300041460 | Ga0451802_0027211 | Ga0451802_0027211_37_564 | 174 |
| 213 | 3300041486 | Ga0451807_1611693 | Ga0451807_1611693_437_964 | 174 |
| 214 | 3300041491 | Ga0451833_1440405 | Ga0451833_1440405_265_789 | 174 |
| 215 | 3300041494 | Ga0451837_0144890 | Ga0451837_0144890_847_1371 | 174 |
| 216 | 3300041498 | Ga0451841_0490569 | Ga0451841_0490569_20_544 | 174 |
| 217 | 3300041505 | Ga0451849_0309245 | Ga0451849_0309245_372_896 | 174 |
| 218 | 3300041512 | Ga0451853_0021657 | Ga0451853_0021657_1363_1890 | 174 |
| 219 | 3300041512 | Ga0451853_0041685 | Ga0451853_0041685_350_874 | 174 |
| 220 | 3300041512 | Ga0451853_1547161 | Ga0451853_1547161_11_535 | 174 |
| 221 | 3300041512 | Ga0451853_1597759 | Ga0451853_1597759_4231_4755 | 174 |
| 222 | 3300041512 | Ga0451853_3661833 | Ga0451853_3661833_338_865 | 174 |
| 223 | 3300041999 | Ga0439433_0001648 | Ga0439433_0001648_3719_4243 | 174 |
| 224 | 3300041999 | Ga0439433_0089217 | Ga0439433_0089217_170_694 | 174 |
| 225 | 3300042002 | Ga0439442_035026 | Ga0439442_035026_508_1032 | 174 |
| 226 | 3300042007 | Ga0439449_0003496 | Ga0439449_0003496_3220_3744 | 174 |
| 227 | 3300042007 | Ga0439449_0041644 | Ga0439449_0041644_1066_1590 | 174 |
| 228 | 3300042007 | Ga0439449_0043178 | Ga0439449_0043178_1025_1549 | 174 |
| 229 | 3300042007 | Ga0439449_0072607 | Ga0439449_0072607_165_689 | 174 |
| 230 | 3300042014 | Ga0439457_000892 | Ga0439457_000892_7581_8105 | 174 |
| 231 | 3300042014 | Ga0439457_001325 | Ga0439457_001325_1466_1990 | 174 |
| 232 | 3300042015 | Ga0439462_0127561 | Ga0439462_0127561_148_672 | 174 |
| 233 | 3300042131 | Ga0450894_000106 | Ga0450894_000106_10842_11369 | 174 |
| 234 | 3300042132 | Ga0450895_000619 | Ga0450895_000619_346_873 | 174 |
| 235 | 3300042133 | Ga0450896_007236 | Ga0450896_007236_922_1449 | 174 |
| 236 | 3300042134 | Ga0450898_001267 | Ga0450898_001267_2682_3209 | 174 |
| 237 | 3300042134 | Ga0450898_048962 | Ga0450898_048962_39_563 | 174 |
| 238 | 3300042135 | Ga0450899_008909 | Ga0450899_008909_401_928 | 174 |
| 239 | 3300042138 | Ga0450903_002366 | Ga0450903_002366_1729_2253 | 174 |
| 240 | 3300042145 | Ga0450906_000159 | Ga0450906_000159_489_1016 | 174 |
| 241 | 3300042184 | Ga0450908_019491 | Ga0450908_019491_630_1157 | 174 |
| 242 | 3300044656 | Ga0466969_0000546 | Ga0466969_0000546_7143_7670 | 174 |
| 243 | 3300044656 | Ga0466969_0007921 | Ga0466969_0007921_4320_4844 | 174 |
| 244 | 3300044656 | Ga0466969_0013369 | Ga0466969_0013369_3452_3976 | 174 |
| 245 | 3300044658 | Ga0466972_0000424 | Ga0466972_0000424_4298_4822 | 174 |
| 246 | 3300044658 | Ga0466972_0003320 | Ga0466972_0003320_235_759 | 174 |
| 247 | 3300044658 | Ga0466972_0006802 | Ga0466972_0006802_4446_4973 | 174 |
| 248 | 3300044658 | Ga0466972_0030090 | Ga0466972_0030090_43_567 | 174 |
| 249 | 3300044683 | Ga0466965_0002362 | Ga0466965_0002362_4927_5451 | 174 |
| 250 | 3300044683 | Ga0466965_0004621 | Ga0466965_0004621_177_701 | 174 |
| 251 | 3300044683 | Ga0466965_0005701 | Ga0466965_0005701_1770_2294 | 174 |
| 252 | 3300044683 | Ga0466965_0090357 | Ga0466965_0090357_870_1394 | 174 |
| 253 | 3300044683 | Ga0466965_0112090 | Ga0466965_0112090_766_1290 | 174 |
| 254 | 3300044683 | Ga0466965_0150114 | Ga0466965_0150114_643_1167 | 174 |
| 255 | 3300044684 | Ga0466966_0000750 | Ga0466966_0000750_10126_10650 | 174 |
| 256 | 3300044684 | Ga0466966_0001055 | Ga0466966_0001055_5804_6328 | 174 |
| 257 | 3300044684 | Ga0466966_0013928 | Ga0466966_0013928_139_666 | 174 |
| 258 | 3300044684 | Ga0466966_0128861 | Ga0466966_0128861_741_1265 | 174 |
| 259 | 3300044684 | Ga0466966_0274554 | Ga0466966_0274554_111_635 | 174 |
| 260 | 3300044693 | Ga0466961_0005280 | Ga0466961_0005280_1997_2521 | 174 |
| 261 | 3300044693 | Ga0466961_0010876 | Ga0466961_0010876_5196_5723 | 174 |
| 262 | 3300044693 | Ga0466961_0027274 | Ga0466961_0027274_592_1116 | 174 |
| 263 | 3300044693 | Ga0466961_0084577 | Ga0466961_0084577_82_609 | 174 |
| 264 | 3300044693 | Ga0466961_0155146 | Ga0466961_0155146_564_1088 | 174 |
| 265 | 3300044693 | Ga0466961_0404633 | Ga0466961_0404633_281_805 | 174 |
| 266 | 3300044694 | Ga0466963_0000109 | Ga0466963_0000109_10670_11194 | 174 |
| 267 | 3300044694 | Ga0466963_0151396 | Ga0466963_0151396_271_795 | 174 |
| 268 | 3300044694 | Ga0466963_0277979 | Ga0466963_0277979_362_886 | 174 |
| 269 | 3300044694 | Ga0466963_0408738 | Ga0466963_0408738_287_811 | 174 |
| 270 | 3300044706 | Ga0466964_0001669 | Ga0466964_0001669_6658_7182 | 174 |
| 271 | 3300044706 | Ga0466964_0125668 | Ga0466964_0125668_219_743 | 174 |
| 272 | 3300044719 | Ga0466971_0016182 | Ga0466971_0016182_1082_1606 | 174 |
| 273 | 3300044719 | Ga0466971_0017608 | Ga0466971_0017608_2230_2754 | 174 |
| 274 | 3300044719 | Ga0466971_0066555 | Ga0466971_0066555_454_978 | 174 |
| 275 | 3300044735 | Ga0466968_0021293 | Ga0466968_0021293_1377_1901 | 174 |
| 276 | 3300044735 | Ga0466968_0110904 | Ga0466968_0110904_214_738 | 174 |
| 277 | 3300044735 | Ga0466968_0379167 | Ga0466968_0379167_24_548 | 174 |
| 278 | 3300044765 | Ga0466970_0000171 | Ga0466970_0000171_21837_22361 | 174 |
| 279 | 3300044765 | Ga0466970_0004913 | Ga0466970_0004913_921_1445 | 174 |
| 280 | 3300044765 | Ga0466970_0216566 | Ga0466970_0216566_342_869 | 174 |
| 281 | 3300044842 | Ga0466957_0000581 | Ga0466957_0000581_17517_18041 | 174 |
| 282 | 3300044842 | Ga0466957_0069417 | Ga0466957_0069417_907_1467 | 174 |
| 283 | 3300044842 | Ga0466957_0077421 | Ga0466957_0077421_332_856 | 174 |
| 284 | 3300044842 | Ga0466957_0631325 | Ga0466957_0631325_162_686 | 174 |
| 285 | 3300044842 | Ga0466957_0809202 | Ga0466957_0809202_124_648 | 174 |
| 286 | 3300044901 | Ga0466960_0006669 | Ga0466960_0006669_1924_2448 | 174 |
| 287 | 3300044901 | Ga0466960_0255114 | Ga0466960_0255114_204_731 | 174 |
| 288 | 3300045049 | Ga0466959_0001913 | Ga0466959_0001913_4606_5130 | 174 |
| 289 | 3300045049 | Ga0466959_0003244 | Ga0466959_0003244_1733_2260 | 174 |
| 290 | 3300045049 | Ga0466959_0006999 | Ga0466959_0006999_5605_6129 | 174 |
| 291 | 3300045049 | Ga0466959_0329448 | Ga0466959_0329448_344_868 | 174 |
| 292 | 3300045836 | Ga0466958_0001612 | Ga0466958_0001612_208_732 | 174 |
| 293 | 3300045836 | Ga0466958_0318575 | Ga0466958_0318575_91_615 | 174 |
| 294 | 3300045836 | Ga0466958_0780162 | Ga0466958_0780162_25_549 | 174 |
| 295 | 3300045976 | Ga0466967_0014568 | Ga0466967_0014568_2495_3019 | 174 |
| 296 | 3300045976 | Ga0466967_0031279 | Ga0466967_0031279_1262_1786 | 174 |
| 297 | 3300045976 | Ga0466967_0078324 | Ga0466967_0078324_2137_2661 | 174 |
| 298 | 3300045976 | Ga0466967_0510713 | Ga0466967_0510713_581_1105 | 174 |
| 299 | 3300045976 | Ga0466967_0794383 | Ga0466967_0794383_358_882 | 174 |
| 300 | 3300045976 | Ga0466967_1210674 | Ga0466967_1210674_185_709 | 174 |
| 301 | 3300046452 | Ga0495617_030958 | Ga0495617_030958_941_1465 | 174 |
| 302 | 3300046454 | Ga0495592_0006815 | Ga0495592_0006815_4366_4890 | 174 |
| 303 | 3300046454 | Ga0495592_0030209 | Ga0495592_0030209_1028_1552 | 174 |
| 304 | 3300046454 | Ga0495592_0040645 | Ga0495592_0040645_601_1125 | 174 |
| 305 | 3300046455 | Ga0495603_0010390 | Ga0495603_0010390_503_1030 | 174 |
| 306 | 3300046455 | Ga0495603_0012587 | Ga0495603_0012587_3929_4456 | 174 |
| 307 | 3300046455 | Ga0495603_0014790 | Ga0495603_0014790_1680_2207 | 174 |
| 308 | 3300046455 | Ga0495603_0017423 | Ga0495603_0017423_1126_1650 | 174 |
| 309 | 3300046455 | Ga0495603_0029220 | Ga0495603_0029220_1733_2257 | 174 |
| 310 | 3300046455 | Ga0495603_0130513 | Ga0495603_0130513_186_710 | 174 |
| 311 | 3300046455 | Ga0495603_0182794 | Ga0495603_0182794_558_1082 | 174 |
| 312 | 3300046455 | Ga0495603_0287175 | Ga0495603_0287175_288_812 | 174 |
| 313 | 3300046455 | Ga0495603_0335267 | Ga0495603_0335267_334_858 | 174 |
| 314 | 3300046457 | Ga0495590_0085351 | Ga0495590_0085351_223_747 | 174 |
| 315 | 3300046459 | Ga0495629_0001125 | Ga0495629_0001125_6620_7144 | 174 |
| 316 | 3300046459 | Ga0495629_0002352 | Ga0495629_0002352_3690_4214 | 174 |
| 317 | 3300046459 | Ga0495629_0018204 | Ga0495629_0018204_1793_2317 | 174 |
| 318 | 3300046459 | Ga0495629_0020001 | Ga0495629_0020001_3090_3617 | 174 |
| 319 | 3300046459 | Ga0495629_0022998 | Ga0495629_0022998_1681_2205 | 174 |
| 320 | 3300046459 | Ga0495629_0056039 | Ga0495629_0056039_422_946 | 174 |
| 321 | 3300046459 | Ga0495629_0066640 | Ga0495629_0066640_300_824 | 174 |
| 322 | 3300046459 | Ga0495629_0212322 | Ga0495629_0212322_449_973 | 174 |
| 323 | 3300046460 | Ga0495638_0017645 | Ga0495638_0017645_978_1502 | 174 |
| 324 | 3300046460 | Ga0495638_0022169 | Ga0495638_0022169_594_1118 | 174 |
| 325 | 3300046460 | Ga0495638_0030766 | Ga0495638_0030766_2735_3259 | 174 |
| 326 | 3300046460 | Ga0495638_0139546 | Ga0495638_0139546_496_1023 | 174 |
| 327 | 3300046460 | Ga0495638_0298877 | Ga0495638_0298877_297_821 | 174 |
| 328 | 3300046462 | Ga0495651_0003297 | Ga0495651_0003297_3047_3571 | 174 |
| 329 | 3300046462 | Ga0495651_0019425 | Ga0495651_0019425_208_732 | 174 |
| 330 | 3300046462 | Ga0495651_0064616 | Ga0495651_0064616_360_884 | 174 |
| 331 | 3300046463 | Ga0495653_0110578 | Ga0495653_0110578_469_993 | 174 |
| 332 | 3300046471 | Ga0495650_0275559 | Ga0495650_0275559_20_544 | 174 |
| 333 | 3300046472 | Ga0495580_0050828 | Ga0495580_0050828_2191_2715 | 174 |
| 334 | 3300046472 | Ga0495580_0065688 | Ga0495580_0065688_1153_1677 | 174 |
| 335 | 3300046473 | Ga0495582_0019872 | Ga0495582_0019872_2580_3104 | 174 |
| 336 | 3300046473 | Ga0495582_0217620 | Ga0495582_0217620_529_1056 | 174 |
| 337 | 3300046474 | Ga0495605_0010491 | Ga0495605_0010491_1603_2127 | 174 |
| 338 | 3300046475 | Ga0495639_0010276 | Ga0495639_0010276_3102_3629 | 174 |
| 339 | 3300046476 | Ga0495662_0001181 | Ga0495662_0001181_3047_3571 | 174 |
| 340 | 3300046476 | Ga0495662_0008465 | Ga0495662_0008465_1415_1942 | 174 |
| 341 | 3300046476 | Ga0495662_0033850 | Ga0495662_0033850_985_1512 | 174 |
| 342 | 3300046476 | Ga0495662_0034895 | Ga0495662_0034895_1001_1528 | 174 |
| 343 | 3300046476 | Ga0495662_0050710 | Ga0495662_0050710_227_751 | 174 |
| 344 | 3300046477 | Ga0495664_0003330 | Ga0495664_0003330_3525_4049 | 174 |
| 345 | 3300046492 | Ga0495585_0018249 | Ga0495585_0018249_86_610 | 174 |
| 346 | 3300046492 | Ga0495585_0027318 | Ga0495585_0027318_790_1317 | 174 |
| 347 | 3300046492 | Ga0495585_0084813 | Ga0495585_0084813_47_571 | 174 |
| 348 | 3300046492 | Ga0495585_0145086 | Ga0495585_0145086_119_643 | 174 |
| 349 | 3300046499 | Ga0495594_0001243 | Ga0495594_0001243_2939_3463 | 174 |
| 350 | 3300046499 | Ga0495594_0002889 | Ga0495594_0002889_5441_5965 | 174 |
| 351 | 3300046499 | Ga0495594_0042434 | Ga0495594_0042434_1824_2348 | 174 |
| 352 | 3300046499 | Ga0495594_0080283 | Ga0495594_0080283_580_1104 | 174 |
| 353 | 3300046499 | Ga0495594_0110520 | Ga0495594_0110520_985_1509 | 174 |
| 354 | 3300046499 | Ga0495594_0240583 | Ga0495594_0240583_166_693 | 174 |
| 355 | 3300046499 | Ga0495594_0315758 | Ga0495594_0315758_171_695 | 174 |
| 356 | 3300046500 | Ga0495596_0262456 | Ga0495596_0262456_100_624 | 174 |
| 357 | 3300046501 | Ga0495607_0102582 | Ga0495607_0102582_836_1363 | 174 |
| 358 | 3300046501 | Ga0495607_0108428 | Ga0495607_0108428_534_1058 | 174 |
| 359 | 3300046506 | Ga0495583_0018225 | Ga0495583_0018225_2714_3238 | 174 |
| 360 | 3300046512 | Ga0495610_0025019 | Ga0495610_0025019_877_1401 | 174 |
| 361 | 3300046512 | Ga0495610_0187904 | Ga0495610_0187904_145_669 | 174 |
| 362 | 3300046513 | Ga0495616_0005671 | Ga0495616_0005671_4711_5235 | 174 |
| 363 | 3300046514 | Ga0495618_0020075 | Ga0495618_0020075_923_1447 | 174 |
| 364 | 3300046514 | Ga0495618_0060256 | Ga0495618_0060256_1577_2101 | 174 |
| 365 | 3300046514 | Ga0495618_0150237 | Ga0495618_0150237_16_540 | 174 |
| 366 | 3300046514 | Ga0495618_0265684 | Ga0495618_0265684_389_913 | 174 |
| 367 | 3300046514 | Ga0495618_0480857 | Ga0495618_0480857_37_567 | 174 |
| 368 | 3300046515 | Ga0495620_0009255 | Ga0495620_0009255_3018_3542 | 174 |
| 369 | 3300046515 | Ga0495620_0122193 | Ga0495620_0122193_428_952 | 174 |
| 370 | 3300046515 | Ga0495620_0154646 | Ga0495620_0154646_180_704 | 174 |
| 371 | 3300046516 | Ga0495628_0023674 | Ga0495628_0023674_3174_3698 | 174 |
| 372 | 3300046516 | Ga0495628_0033610 | Ga0495628_0033610_3197_3721 | 174 |
| 373 | 3300046516 | Ga0495628_0164216 | Ga0495628_0164216_1137_1661 | 174 |
| 374 | 3300046517 | Ga0495630_0014351 | Ga0495630_0014351_4408_4932 | 174 |
| 375 | 3300046517 | Ga0495630_0091961 | Ga0495630_0091961_1573_2097 | 174 |
| 376 | 3300046518 | Ga0495631_0004895 | Ga0495631_0004895_2846_3370 | 174 |
| 377 | 3300046518 | Ga0495631_0016807 | Ga0495631_0016807_658_1182 | 174 |
| 378 | 3300046518 | Ga0495631_0076072 | Ga0495631_0076072_123_647 | 174 |
| 379 | 3300046518 | Ga0495631_0139758 | Ga0495631_0139758_456_980 | 174 |
| 380 | 3300046519 | Ga0495632_0104096 | Ga0495632_0104096_642_1166 | 174 |
| 381 | 3300046519 | Ga0495632_0250828 | Ga0495632_0250828_65_589 | 174 |
| 382 | 3300046520 | Ga0495637_0019143 | Ga0495637_0019143_2033_2557 | 174 |
| 383 | 3300046520 | Ga0495637_0067543 | Ga0495637_0067543_549_1073 | 174 |
| 384 | 3300046522 | Ga0495643_0010503 | Ga0495643_0010503_4042_4566 | 174 |
| 385 | 3300046522 | Ga0495643_0017035 | Ga0495643_0017035_3463_3987 | 174 |
| 386 | 3300046523 | Ga0495644_0082260 | Ga0495644_0082260_543_1067 | 174 |
| 387 | 3300046524 | Ga0495648_0042870 | Ga0495648_0042870_1931_2455 | 174 |
| 388 | 3300046524 | Ga0495648_0416711 | Ga0495648_0416711_12_536 | 174 |
| 389 | 3300046526 | Ga0495666_0063697 | Ga0495666_0063697_795_1319 | 174 |
| 390 | 3300046526 | Ga0495666_0086849 | Ga0495666_0086849_759_1283 | 174 |
| 391 | 3300046526 | Ga0495666_0146317 | Ga0495666_0146317_396_920 | 174 |
| 392 | 3300046528 | Ga0495642_0038500 | Ga0495642_0038500_893_1417 | 174 |
| 393 | 3300046528 | Ga0495642_0082571 | Ga0495642_0082571_91_618 | 174 |
| 394 | 3300046529 | Ga0495652_0056978 | Ga0495652_0056978_1447_1971 | 174 |
| 395 | 3300046529 | Ga0495652_0071477 | Ga0495652_0071477_442_966 | 174 |
| 396 | 3300046529 | Ga0495652_0249963 | Ga0495652_0249963_244_768 | 174 |
| 397 | 3300046530 | Ga0495654_0032227 | Ga0495654_0032227_1437_1961 | 174 |
| 398 | 3300046533 | Ga0495640_0024612 | Ga0495640_0024612_3212_3736 | 174 |
| 399 | 3300046533 | Ga0495640_0070088 | Ga0495640_0070088_1246_1770 | 174 |
| 400 | 3300046533 | Ga0495640_0126053 | Ga0495640_0126053_171_695 | 174 |
| 401 | 3300046533 | Ga0495640_0280615 | Ga0495640_0280615_162_686 | 174 |
| 402 | 3300046535 | Ga0495586_0141856 | Ga0495586_0141856_632_1156 | 174 |
| 403 | 3300046536 | Ga0495587_0004720 | Ga0495587_0004720_4505_5029 | 174 |
| 404 | 3300046536 | Ga0495587_0173569 | Ga0495587_0173569_271_798 | 174 |
| 405 | 3300046538 | Ga0495609_0044503 | Ga0495609_0044503_326_850 | 174 |
| 406 | 3300046538 | Ga0495609_0158395 | Ga0495609_0158395_357_884 | 174 |
| 407 | 3300046542 | Ga0495597_0013132 | Ga0495597_0013132_1524_2048 | 174 |
| 408 | 3300046542 | Ga0495597_0162826 | Ga0495597_0162826_155_679 | 174 |
| 409 | 3300046543 | Ga0495645_0007723 | Ga0495645_0007723_3097_3621 | 174 |
| 410 | 3300046543 | Ga0495645_0071573 | Ga0495645_0071573_1811_2338 | 174 |
| 411 | 3300046557 | Ga0495622_0002791 | Ga0495622_0002791_1733_2257 | 174 |
| 412 | 3300046557 | Ga0495622_0004580 | Ga0495622_0004580_5263_5787 | 174 |
| 413 | 3300046557 | Ga0495622_0028023 | Ga0495622_0028023_456_980 | 174 |
| 414 | 3300046557 | Ga0495622_0046673 | Ga0495622_0046673_57_581 | 174 |
| 415 | 3300046557 | Ga0495622_0105813 | Ga0495622_0105813_319_843 | 174 |
| 416 | 3300046558 | Ga0495633_0029911 | Ga0495633_0029911_1556_2080 | 174 |
| 417 | 3300046558 | Ga0495633_0041208 | Ga0495633_0041208_1599_2123 | 174 |
| 418 | 3300046558 | Ga0495633_0189048 | Ga0495633_0189048_387_911 | 174 |
| 419 | 3300046559 | Ga0495667_0110411 | Ga0495667_0110411_1029_1553 | 174 |
| 420 | 3300046559 | Ga0495667_0157225 | Ga0495667_0157225_358_882 | 174 |
| 421 | 3300046615 | Ga0495656_0067028 | Ga0495656_0067028_469_993 | 174 |
| 422 | 3300046616 | Ga0495668_0010761 | Ga0495668_0010761_659_1183 | 174 |
| 423 | 3300046616 | Ga0495668_0030260 | Ga0495668_0030260_1734_2258 | 174 |
| 424 | 3300046642 | Ga0495634_0001501 | Ga0495634_0001501_7792_8316 | 174 |
| 425 | 3300046642 | Ga0495634_0017681 | Ga0495634_0017681_1102_1626 | 174 |
| 426 | 3300046642 | Ga0495634_0025000 | Ga0495634_0025000_501_1025 | 174 |
| 427 | 3300046648 | Ga0495611_0060854 | Ga0495611_0060854_47_571 | 174 |
| 428 | 3300046648 | Ga0495611_0070334 | Ga0495611_0070334_933_1457 | 174 |
| 429 | 3300046660 | Ga0495625_0017036 | Ga0495625_0017036_4991_5515 | 174 |
| 430 | 3300046660 | Ga0495625_0043102 | Ga0495625_0043102_67_591 | 174 |
| 431 | 3300046660 | Ga0495625_0057998 | Ga0495625_0057998_1860_2384 | 174 |
| 432 | 3300046660 | Ga0495625_0087206 | Ga0495625_0087206_1249_1773 | 174 |
| 433 | 3300046660 | Ga0495625_0109924 | Ga0495625_0109924_1186_1710 | 174 |
| 434 | 3300046660 | Ga0495625_0111415 | Ga0495625_0111415_1209_1733 | 174 |
| 435 | 3300046663 | Ga0495635_0000408 | Ga0495635_0000408_17398_17922 | 174 |
| 436 | 3300046663 | Ga0495635_0132749 | Ga0495635_0132749_275_799 | 174 |
| 437 | 3300046665 | Ga0495661_0337974 | Ga0495661_0337974_147_671 | 174 |
| 438 | 3300046674 | Ga0495588_0005045 | Ga0495588_0005045_1700_2227 | 174 |
| 439 | 3300046674 | Ga0495588_0012624 | Ga0495588_0012624_2786_3310 | 174 |
| 440 | 3300046674 | Ga0495588_0014145 | Ga0495588_0014145_2829_3353 | 174 |
| 441 | 3300046674 | Ga0495588_0044079 | Ga0495588_0044079_1404_1928 | 174 |
| 442 | 3300046674 | Ga0495588_0116761 | Ga0495588_0116761_790_1317 | 174 |
| 443 | 3300046674 | Ga0495588_0287815 | Ga0495588_0287815_316_843 | 174 |
| 444 | 3300046674 | Ga0495588_0358947 | Ga0495588_0358947_43_567 | 174 |
| 445 | 3300046675 | Ga0495657_0002188 | Ga0495657_0002188_6880_7407 | 174 |
| 446 | 3300046675 | Ga0495657_0011272 | Ga0495657_0011272_3626_4150 | 174 |
| 447 | 3300046675 | Ga0495657_0025880 | Ga0495657_0025880_462_986 | 174 |
| 448 | 3300046675 | Ga0495657_0026757 | Ga0495657_0026757_362_886 | 174 |
| 449 | 3300046675 | Ga0495657_0065452 | Ga0495657_0065452_1654_2178 | 174 |
| 450 | 3300046678 | Ga0495599_0122941 | Ga0495599_0122941_135_659 | 174 |
| 451 | 3300046679 | Ga0495623_0023158 | Ga0495623_0023158_292_816 | 174 |
| 452 | 3300046680 | Ga0495646_0003363 | Ga0495646_0003363_2445_2969 | 174 |
| 453 | 3300046683 | Ga0495658_0029706 | Ga0495658_0029706_82_606 | 174 |
| 454 | 3300046689 | Ga0495613_0008645 | Ga0495613_0008645_471_995 | 174 |
| 455 | 3300046689 | Ga0495613_0017345 | Ga0495613_0017345_3939_4463 | 174 |
| 456 | 3300046689 | Ga0495613_0028766 | Ga0495613_0028766_3172_3696 | 174 |
| 457 | 3300046689 | Ga0495613_0041397 | Ga0495613_0041397_1376_1900 | 174 |
| 458 | 3300046689 | Ga0495613_0051375 | Ga0495613_0051375_943_1470 | 174 |
| 459 | 3300046689 | Ga0495613_0089073 | Ga0495613_0089073_1530_2054 | 174 |
| 460 | 3300046689 | Ga0495613_0107579 | Ga0495613_0107579_1247_1774 | 174 |
| 461 | 3300046689 | Ga0495613_0133584 | Ga0495613_0133584_924_1448 | 174 |
| 462 | 3300046689 | Ga0495613_0342453 | Ga0495613_0342453_330_854 | 174 |
| 463 | 3300046690 | Ga0495624_0022326 | Ga0495624_0022326_1270_1794 | 174 |
| 464 | 3300046690 | Ga0495624_0028651 | Ga0495624_0028651_1951_2475 | 174 |
| 465 | 3300046690 | Ga0495624_0571539 | Ga0495624_0571539_69_593 | 174 |
| 466 | 3300046691 | Ga0495670_0004511 | Ga0495670_0004511_3169_3693 | 174 |
| 467 | 3300046691 | Ga0495670_0248746 | Ga0495670_0248746_50_577 | 174 |
| 468 | 3300046692 | Ga0495671_0016068 | Ga0495671_0016068_2144_2668 | 174 |
| 469 | 3300046694 | Ga0495649_0008303 | Ga0495649_0008303_2716_3240 | 174 |
| 470 | 3300046694 | Ga0495649_0031689 | Ga0495649_0031689_1665_2189 | 174 |
| 471 | 3300046694 | Ga0495649_0077038 | Ga0495649_0077038_67_594 | 174 |
| 472 | 3300046694 | Ga0495649_0103838 | Ga0495649_0103838_900_1424 | 174 |
| 473 | 3300046794 | Ga0495589_0009354 | Ga0495589_0009354_3101_3628 | 174 |
| 474 | 3300046794 | Ga0495589_0009504 | Ga0495589_0009504_1067_1591 | 174 |
| 475 | 3300046794 | Ga0495589_0013267 | Ga0495589_0013267_1026_1553 | 174 |
| 476 | 3300046794 | Ga0495589_0040584 | Ga0495589_0040584_564_1088 | 174 |
| 477 | 3300046794 | Ga0495589_0144959 | Ga0495589_0144959_108_632 | 174 |
| 478 | 3300046809 | Ga0495600_0089362 | Ga0495600_0089362_1015_1539 | 174 |
| 479 | 3300046809 | Ga0495600_0209504 | Ga0495600_0209504_390_914 | 174 |
| 480 | 3300046809 | Ga0495600_0344517 | Ga0495600_0344517_313_837 | 174 |
| 481 | 3300046810 | Ga0495660_0001994 | Ga0495660_0001994_12176_12700 | 174 |
| 482 | 3300046810 | Ga0495660_0042850 | Ga0495660_0042850_1600_2124 | 174 |
| 483 | 3300046810 | Ga0495660_0058955 | Ga0495660_0058955_110_634 | 174 |
| 484 | 3300046810 | Ga0495660_0132463 | Ga0495660_0132463_223_747 | 174 |
| 485 | 3300047315 | Ga0495581_0012417 | Ga0495581_0012417_2617_3144 | 174 |
| 486 | 3300047315 | Ga0495581_0037683 | Ga0495581_0037683_131_658 | 174 |
| 487 | 3300047315 | Ga0495581_0151060 | Ga0495581_0151060_468_992 | 174 |
| 488 | 3300047315 | Ga0495581_0178098 | Ga0495581_0178098_601_1128 | 174 |
| 489 | 3300047317 | Ga0495604_0000920 | Ga0495604_0000920_10348_10872 | 174 |
| 490 | 3300047317 | Ga0495604_0129623 | Ga0495604_0129623_782_1306 | 174 |
| 491 | 3300047318 | Ga0495636_0003117 | Ga0495636_0003117_3034_3561 | 174 |
| 492 | 3300047318 | Ga0495636_0003438 | Ga0495636_0003438_2818_3345 | 174 |
| 493 | 3300047318 | Ga0495636_0018273 | Ga0495636_0018273_2208_2753 | 174 |
| 494 | 3300047318 | Ga0495636_0035038 | Ga0495636_0035038_685_1209 | 174 |
| 495 | 3300047318 | Ga0495636_0048625 | Ga0495636_0048625_210_737 | 174 |
| 496 | 3300047318 | Ga0495636_0053817 | Ga0495636_0053817_1145_1669 | 174 |
| 497 | 3300047318 | Ga0495636_0062567 | Ga0495636_0062567_16_540 | 174 |
| 498 | 3300047318 | Ga0495636_0129732 | Ga0495636_0129732_31_555 | 174 |
| 499 | 3300047318 | Ga0495636_0254890 | Ga0495636_0254890_269_796 | 174 |
| 500 | 3300047319 | Ga0495674_0070014 | Ga0495674_0070014_73_597 | 174 |
| 501 | 3300047319 | Ga0495674_0084831 | Ga0495674_0084831_23_547 | 174 |
| 502 | 3300047320 | Ga0495672_0038501 | Ga0495672_0038501_1306_1830 | 174 |
| 503 | 3300047321 | Ga0495676_0009717 | Ga0495676_0009717_2960_3484 | 174 |
| 504 | 3300047321 | Ga0495676_0017221 | Ga0495676_0017221_1062_1586 | 174 |
| 505 | 3300047321 | Ga0495676_0031605 | Ga0495676_0031605_2697_3221 | 174 |
| 506 | 3300047321 | Ga0495676_0035387 | Ga0495676_0035387_3170_3694 | 174 |
| 507 | 3300047321 | Ga0495676_0214560 | Ga0495676_0214560_28_552 | 174 |
| 508 | 3300047321 | Ga0495676_0266427 | Ga0495676_0266427_582_1106 | 174 |
| 509 | 3300047321 | Ga0495676_0798823 | Ga0495676_0798823_26_550 | 174 |
| 510 | 3300047322 | Ga0495680_0131788 | Ga0495680_0131788_168_695 | 174 |
| 511 | 3300047323 | Ga0495683_0035929 | Ga0495683_0035929_308_832 | 174 |
| 512 | 3300047323 | Ga0495683_0053053 | Ga0495683_0053053_67_591 | 174 |
| 513 | 3300047323 | Ga0495683_0189676 | Ga0495683_0189676_93_617 | 174 |
| 514 | 3300047443 | Ga0495687_002642 | Ga0495687_002642_10861_11388 | 174 |
| 515 | 3300047443 | Ga0495687_008731 | Ga0495687_008731_544_1068 | 174 |
| 516 | 3300047443 | Ga0495687_029870 | Ga0495687_029870_433_957 | 174 |
| 517 | 3300047444 | Ga0495675_0012817 | Ga0495675_0012817_3414_3938 | 174 |
| 518 | 3300047444 | Ga0495675_0014026 | Ga0495675_0014026_4454_4981 | 174 |
| 519 | 3300047444 | Ga0495675_0042456 | Ga0495675_0042456_52_576 | 174 |
| 520 | 3300047445 | Ga0495677_0105235 | Ga0495677_0105235_338_862 | 174 |
| 521 | 3300047445 | Ga0495677_0191451 | Ga0495677_0191451_54_578 | 174 |
| 522 | 3300047445 | Ga0495677_0253913 | Ga0495677_0253913_126_653 | 174 |
| 523 | 3300047447 | Ga0495685_000133 | Ga0495685_000133_561_1085 | 174 |
| 524 | 3300047447 | Ga0495685_007228 | Ga0495685_007228_576_1103 | 174 |
| 525 | 3300047447 | Ga0495685_038711 | Ga0495685_038711_648_1175 | 174 |
| 526 | 3300047447 | Ga0495685_065688 | Ga0495685_065688_624_1151 | 174 |
| 527 | 3300047447 | Ga0495685_066139 | Ga0495685_066139_414_938 | 174 |
| 528 | 3300047470 | Ga0495681_0009498 | Ga0495681_0009498_3200_3724 | 174 |
| 529 | 3300047470 | Ga0495681_0012112 | Ga0495681_0012112_3448_3972 | 174 |
| 530 | 3300047470 | Ga0495681_0051621 | Ga0495681_0051621_190_714 | 174 |
| 531 | 3300047470 | Ga0495681_0247800 | Ga0495681_0247800_14_541 | 174 |
| 532 | 3300047471 | Ga0495684_0272521 | Ga0495684_0272521_79_603 | 174 |
| 533 | 3300047472 | Ga0495686_0004762 | Ga0495686_0004762_107_631 | 174 |
| 534 | 3300047472 | Ga0495686_0059871 | Ga0495686_0059871_1126_1650 | 174 |
| 535 | 3300047472 | Ga0495686_0118841 | Ga0495686_0118841_1016_1540 | 174 |
| 536 | 3300047472 | Ga0495686_0177322 | Ga0495686_0177322_56_580 | 174 |
| 537 | 3300047673 | Ga0495593_0005290 | Ga0495593_0005290_4557_5081 | 174 |
| 538 | 3300047673 | Ga0495593_0026491 | Ga0495593_0026491_58_582 | 174 |
| 539 | 3300047673 | Ga0495593_0075975 | Ga0495593_0075975_44_568 | 174 |
| 540 | 3300047673 | Ga0495593_0102829 | Ga0495593_0102829_263_787 | 174 |
| 541 | 3300047673 | Ga0495593_0215536 | Ga0495593_0215536_396_920 | 174 |
| 542 | 3300047673 | Ga0495593_0515481 | Ga0495593_0515481_16_540 | 174 |
| 543 | 3300048088 | Ga0495602_0016998 | Ga0495602_0016998_4888_5412 | 174 |
| 544 | 3300048089 | Ga0495614_0003174 | Ga0495614_0003174_3522_4046 | 174 |
| 545 | 3300048091 | Ga0495626_0010193 | Ga0495626_0010193_3034_3558 | 174 |
| 546 | 3300048905 | Ga0496102_0445276 | Ga0496102_0445276_358_906 | 174 |
| 547 | 3300048906 | Ga0496103_0354133 | Ga0496103_0354133_361_885 | 174 |
| 548 | 3300048907 | Ga0496104_0079888 | Ga0496104_0079888_1671_2219 | 174 |
| 549 | 3300048907 | Ga0496104_0474666 | Ga0496104_0474666_269_796 | 174 |
| 550 | 3300048908 | Ga0496105_0085955 | Ga0496105_0085955_1171_1719 | 174 |
| 551 | 3300048909 | Ga0496106_0542662 | Ga0496106_0542662_51_602 | 174 |
| 552 | 3300048910 | Ga0496107_0689181 | Ga0496107_0689181_127_675 | 174 |
| 553 | 3300048911 | Ga0496108_0145469 | Ga0496108_0145469_1325_1873 | 174 |
| 554 | 3300048911 | Ga0496108_0469500 | Ga0496108_0469500_179_703 | 174 |
| 555 | 3300048911 | Ga0496108_0849829 | Ga0496108_0849829_105_632 | 174 |
| 556 | 3300048912 | Ga0496109_0029382 | Ga0496109_0029382_1334_1861 | 174 |
| 557 | 3300048912 | Ga0496109_0063537 | Ga0496109_0063537_338_886 | 174 |
| 558 | 3300048912 | Ga0496109_0325928 | Ga0496109_0325928_408_932 | 174 |
| 559 | 3300048913 | Ga0496110_0295898 | Ga0496110_0295898_114_662 | 174 |
| 560 | 3300048913 | Ga0496110_1098724 | Ga0496110_1098724_78_605 | 174 |
| 561 | 3300048913 | Ga0496110_1228932 | Ga0496110_1228932_59_583 | 174 |
| 562 | 3300048914 | Ga0496111_0017686 | Ga0496111_0017686_3350_3898 | 174 |
| 563 | 3300048915 | Ga0496112_0289441 | Ga0496112_0289441_303_854 | 174 |
| 564 | 3300048915 | Ga0496112_0568319 | Ga0496112_0568319_282_806 | 174 |
| 565 | 3300048915 | Ga0496112_0613296 | Ga0496112_0613296_224_751 | 174 |
| 566 | 3300048916 | Ga0496113_0002493 | Ga0496113_0002493_6465_7013 | 174 |
| 567 | 3300048918 | Ga0496115_0488535 | Ga0496115_0488535_71_619 | 174 |
| 568 | 3300048922 | Ga0496119_0347025 | Ga0496119_0347025_171_695 | 174 |
| 569 | 3300048926 | Ga0496123_0220181 | Ga0496123_0220181_266_790 | 174 |
| 570 | 3300048929 | Ga0496126_0052554 | Ga0496126_0052554_1342_1872 | 174 |
| 571 | 3300049459 | Ga0495678_076067 | Ga0495678_076067_79_603 | 174 |
| 572 | 3300049568 | Ga0501031_0005905 | Ga0501031_0005905_3007_3531 | 174 |
| 573 | 3300049568 | Ga0501031_0010593 | Ga0501031_0010593_2829_3353 | 174 |
| 574 | 3300049568 | Ga0501031_0054865 | Ga0501031_0054865_769_1293 | 174 |
| 575 | 3300049568 | Ga0501031_0072552 | Ga0501031_0072552_354_878 | 174 |
| 576 | 3300049568 | Ga0501031_0259044 | Ga0501031_0259044_585_1109 | 174 |
| 577 | 3300049569 | Ga0501032_0002976 | Ga0501032_0002976_12578_13102 | 174 |
| 578 | 3300049569 | Ga0501032_0012268 | Ga0501032_0012268_3873_4397 | 174 |
| 579 | 3300049569 | Ga0501032_0095318 | Ga0501032_0095318_389_913 | 174 |
| 580 | 3300049569 | Ga0501032_0450669 | Ga0501032_0450669_183_716 | 174 |
| 581 | 3300049570 | Ga0501033_0001682 | Ga0501033_0001682_12514_13047 | 174 |
| 582 | 3300049570 | Ga0501033_0003976 | Ga0501033_0003976_1393_1917 | 174 |
| 583 | 3300049570 | Ga0501033_0010783 | Ga0501033_0010783_5345_5869 | 174 |
| 584 | 3300049570 | Ga0501033_0014812 | Ga0501033_0014812_5300_5824 | 174 |
| 585 | 3300049570 | Ga0501033_0081610 | Ga0501033_0081610_715_1239 | 174 |
| 586 | 3300049570 | Ga0501033_0084519 | Ga0501033_0084519_1075_1599 | 174 |
| 587 | 3300049570 | Ga0501033_0130248 | Ga0501033_0130248_474_998 | 174 |
| 588 | 3300049570 | Ga0501033_0154730 | Ga0501033_0154730_560_1084 | 174 |
| 589 | 3300049571 | Ga0501034_0020902 | Ga0501034_0020902_2952_3476 | 174 |
| 590 | 3300049571 | Ga0501034_0024322 | Ga0501034_0024322_5254_5787 | 174 |
| 591 | 3300049571 | Ga0501034_0031003 | Ga0501034_0031003_1471_1995 | 174 |
| 592 | 3300049571 | Ga0501034_0031323 | Ga0501034_0031323_4616_5140 | 174 |
| 593 | 3300049571 | Ga0501034_0149082 | Ga0501034_0149082_1538_2062 | 174 |
| 594 | 3300049571 | Ga0501034_0615871 | Ga0501034_0615871_61_585 | 174 |
| 595 | 3300049571 | Ga0501034_1196162 | Ga0501034_1196162_45_569 | 174 |
| 596 | 3300049572 | Ga0501036_0000603 | Ga0501036_0000603_7306_7839 | 174 |
| 597 | 3300049572 | Ga0501036_0004107 | Ga0501036_0004107_2907_3431 | 174 |
| 598 | 3300049572 | Ga0501036_0006344 | Ga0501036_0006344_8989_9513 | 174 |
| 599 | 3300049572 | Ga0501036_0020231 | Ga0501036_0020231_2884_3408 | 174 |
| 600 | 3300049572 | Ga0501036_0037289 | Ga0501036_0037289_551_1075 | 174 |
| 601 | 3300049572 | Ga0501036_0117598 | Ga0501036_0117598_761_1285 | 174 |
| 602 | 3300049573 | Ga0501037_0000832 | Ga0501037_0000832_9368_9892 | 174 |
| 603 | 3300049573 | Ga0501037_0012131 | Ga0501037_0012131_2613_3137 | 174 |
| 604 | 3300049573 | Ga0501037_0025200 | Ga0501037_0025200_3108_3632 | 174 |
| 605 | 3300049573 | Ga0501037_0237019 | Ga0501037_0237019_87_611 | 174 |
| 606 | 3300049574 | Ga0501038_0000231 | Ga0501038_0000231_959_1483 | 174 |
| 607 | 3300049574 | Ga0501038_0009979 | Ga0501038_0009979_3683_4207 | 174 |
| 608 | 3300049574 | Ga0501038_0112289 | Ga0501038_0112289_170_703 | 174 |
| 609 | 3300049574 | Ga0501038_0124225 | Ga0501038_0124225_16_540 | 174 |
| 610 | 3300049574 | Ga0501038_0151604 | Ga0501038_0151604_1271_1795 | 174 |
| 611 | 3300049574 | Ga0501038_0197042 | Ga0501038_0197042_274_798 | 174 |
| 612 | 3300049575 | Ga0501039_0003296 | Ga0501039_0003296_9342_9875 | 174 |
| 613 | 3300049575 | Ga0501039_0011475 | Ga0501039_0011475_2206_2730 | 174 |
| 614 | 3300049575 | Ga0501039_0267645 | Ga0501039_0267645_641_1165 | 174 |
| 615 | 3300049576 | Ga0501040_0005861 | Ga0501040_0005861_3196_3720 | 174 |
| 616 | 3300049578 | Ga0501042_0015032 | Ga0501042_0015032_4624_5148 | 174 |
| 617 | 3300049578 | Ga0501042_0402132 | Ga0501042_0402132_237_770 | 174 |
| 618 | 3300049579 | Ga0501043_0002088 | Ga0501043_0002088_13565_14089 | 174 |
| 619 | 3300049579 | Ga0501043_0002774 | Ga0501043_0002774_3007_3531 | 174 |
| 620 | 3300049579 | Ga0501043_0004088 | Ga0501043_0004088_1818_2351 | 174 |
| 621 | 3300049579 | Ga0501043_0043971 | Ga0501043_0043971_2624_3148 | 174 |
| 622 | 3300049579 | Ga0501043_0168484 | Ga0501043_0168484_690_1214 | 174 |
| 623 | 3300049579 | Ga0501043_0287753 | Ga0501043_0287753_514_1038 | 174 |
| 624 | 3300049579 | Ga0501043_0335673 | Ga0501043_0335673_340_864 | 174 |
| 625 | 3300049580 | Ga0501046_0003833 | Ga0501046_0003833_4234_4758 | 174 |
| 626 | 3300049580 | Ga0501046_0009593 | Ga0501046_0009593_4465_4989 | 174 |
| 627 | 3300049580 | Ga0501046_0041476 | Ga0501046_0041476_2968_3492 | 174 |
| 628 | 3300049580 | Ga0501046_0157102 | Ga0501046_0157102_155_679 | 174 |
| 629 | 3300049581 | Ga0501047_0012570 | Ga0501047_0012570_6578_7102 | 174 |
| 630 | 3300049581 | Ga0501047_0032534 | Ga0501047_0032534_220_744 | 174 |
| 631 | 3300049581 | Ga0501047_0036474 | Ga0501047_0036474_3209_3733 | 174 |
| 632 | 3300049581 | Ga0501047_0039284 | Ga0501047_0039284_3549_4073 | 174 |
| 633 | 3300049581 | Ga0501047_0061622 | Ga0501047_0061622_793_1317 | 174 |
| 634 | 3300049581 | Ga0501047_0226469 | Ga0501047_0226469_881_1405 | 174 |
| 635 | 3300049581 | Ga0501047_0251957 | Ga0501047_0251957_933_1457 | 174 |
| 636 | 3300049581 | Ga0501047_0562311 | Ga0501047_0562311_423_947 | 174 |
| 637 | 3300049582 | Ga0501048_0003964 | Ga0501048_0003964_5440_5964 | 174 |
| 638 | 3300049582 | Ga0501048_0017476 | Ga0501048_0017476_210_734 | 174 |
| 639 | 3300049582 | Ga0501048_0060025 | Ga0501048_0060025_1259_1783 | 174 |
| 640 | 3300049584 | Ga0501068_0006308 | Ga0501068_0006308_1183_1707 | 174 |
| 641 | 3300049584 | Ga0501068_0481735 | Ga0501068_0481735_177_701 | 174 |
| 642 | 3300049585 | Ga0501069_0003540 | Ga0501069_0003540_5054_5578 | 174 |
| 643 | 3300049586 | Ga0501070_0015281 | Ga0501070_0015281_4745_5278 | 174 |
| 644 | 3300049586 | Ga0501070_0307453 | Ga0501070_0307453_386_910 | 174 |
| 645 | 3300049586 | Ga0501070_0511826 | Ga0501070_0511826_85_609 | 174 |
| 646 | 3300049586 | Ga0501070_0770181 | Ga0501070_0770181_195_719 | 174 |
| 647 | 3300049586 | Ga0501070_0830601 | Ga0501070_0830601_149_673 | 174 |
| 648 | 3300049586 | Ga0501070_1126472 | Ga0501070_1126472_16_540 | 174 |
| 649 | 3300049587 | Ga0501071_0005287 | Ga0501071_0005287_3017_3541 | 174 |
| 650 | 3300049588 | Ga0501072_0002025 | Ga0501072_0002025_13243_13767 | 174 |
| 651 | 3300049589 | Ga0501073_0122461 | Ga0501073_0122461_146_670 | 174 |
| 652 | 3300049589 | Ga0501073_0317574 | Ga0501073_0317574_195_728 | 174 |
| 653 | 3300049590 | Ga0501074_0006619 | Ga0501074_0006619_7614_8147 | 174 |
| 654 | 3300049590 | Ga0501074_0606561 | Ga0501074_0606561_215_739 | 174 |
| 655 | 3300049592 | Ga0501076_0210350 | Ga0501076_0210350_345_869 | 174 |
| 656 | 3300049593 | Ga0501077_0009138 | Ga0501077_0009138_2469_2993 | 174 |
| 657 | 3300049663 | Ga0501223_069603 | Ga0501223_069603_102_626 | 174 |
| 658 | 3300049669 | Ga0501235_050762 | Ga0501235_050762_352_879 | 174 |
| 659 | 3300049741 | Ga0501079_0007274 | Ga0501079_0007274_3186_3710 | 174 |
| 660 | 3300049742 | Ga0501080_0319627 | Ga0501080_0319627_146_670 | 174 |
| 661 | 3300049742 | Ga0501080_0815672 | Ga0501080_0815672_214_738 | 174 |
| 662 | 3300049744 | Ga0501083_0000743 | Ga0501083_0000743_17672_18196 | 174 |
| 663 | 3300049744 | Ga0501083_0333833 | Ga0501083_0333833_409_933 | 174 |
| 664 | 3300049778 | Ga0501282_002532 | Ga0501282_002532_1289_1816 | 174 |
| 665 | 3300049822 | Ga0501035_0004966 | Ga0501035_0004966_2181_2714 | 174 |
| 666 | 3300049822 | Ga0501035_0026001 | Ga0501035_0026001_654_1178 | 174 |
| 667 | 3300049822 | Ga0501035_0036046 | Ga0501035_0036046_3505_4029 | 174 |
| 668 | 3300049822 | Ga0501035_0057671 | Ga0501035_0057671_2675_3199 | 174 |
| 669 | 3300049822 | Ga0501035_0082275 | Ga0501035_0082275_172_696 | 174 |
| 670 | 3300049822 | Ga0501035_0097265 | Ga0501035_0097265_1144_1668 | 174 |
| 671 | 3300049822 | Ga0501035_0308221 | Ga0501035_0308221_202_726 | 174 |
| 672 | 3300049822 | Ga0501035_0762469 | Ga0501035_0762469_222_746 | 174 |
| 673 | 3300049823 | Ga0501044_0004352 | Ga0501044_0004352_9303_9827 | 174 |
| 674 | 3300049823 | Ga0501044_0005219 | Ga0501044_0005219_2620_3144 | 174 |
| 675 | 3300049823 | Ga0501044_0005493 | Ga0501044_0005493_3007_3531 | 174 |
| 676 | 3300049823 | Ga0501044_0012492 | Ga0501044_0012492_4334_4858 | 174 |
| 677 | 3300049823 | Ga0501044_0016519 | Ga0501044_0016519_3849_4373 | 174 |
| 678 | 3300049823 | Ga0501044_0117849 | Ga0501044_0117849_544_1068 | 174 |
| 679 | 3300049823 | Ga0501044_0304081 | Ga0501044_0304081_827_1351 | 174 |
| 680 | 3300049823 | Ga0501044_0470222 | Ga0501044_0470222_423_947 | 174 |
| 681 | 3300049823 | Ga0501044_0578692 | Ga0501044_0578692_141_665 | 174 |
| 682 | 3300049823 | Ga0501044_0825538 | Ga0501044_0825538_142_666 | 174 |
| 683 | 3300049824 | Ga0501045_0381768 | Ga0501045_0381768_410_934 | 174 |
| 684 | 3300050489 | nmdc:mga03683_377297_c1 | nmdc:mga03683_377297_c1_104_628 | 174 |
| 685 | 3300050490 | nmdc:mga03n38_83388_c1 | nmdc:mga03n38_83388_c1_288_812 | 174 |
| 686 | 3300050494 | nmdc:mga06z11_127060_c1 | nmdc:mga06z11_127060_c1_188_712 | 174 |
| 687 | 3300050495 | nmdc:mga04h51_6120_c1 | nmdc:mga04h51_6120_c1_741_1265 | 174 |
| 688 | 3300050496 | nmdc:mga07m45_77589_c1 | nmdc:mga07m45_77589_c1_718_1242 | 174 |
| 689 | 3300053085 | Ga0495619_0242673 | Ga0495619_0242673_62_586 | 174 |
| 690 | 3300053086 | Ga0500578_0114814 | Ga0500578_0114814_886_1410 | 174 |
| 691 | 3300053086 | Ga0500578_0322575 | Ga0500578_0322575_91_615 | 174 |
| 692 | 3300053088 | Ga0500644_0010133 | Ga0500644_0010133_1199_1723 | 174 |
| 693 | 3300053088 | Ga0500644_0023261 | Ga0500644_0023261_197_724 | 174 |
| 694 | 3300053090 | Ga0500646_0000359 | Ga0500646_0000359_10167_10691 | 174 |
| 695 | 3300053090 | Ga0500646_0052212 | Ga0500646_0052212_183_707 | 174 |
| 696 | 3300053092 | Ga0500583_0246741 | Ga0500583_0246741_141_665 | 174 |
| 697 | 3300053095 | Ga0500640_011796 | Ga0500640_011796_486_1010 | 174 |
| 698 | 3300053099 | Ga0500654_063823 | Ga0500654_063823_130_654 | 174 |
| 699 | 3300053101 | Ga0500553_077472 | Ga0500553_077472_264_788 | 174 |
| 700 | 3300053107 | Ga0500560_010149 | Ga0500560_010149_760_1284 | 174 |
| 701 | 3300053107 | Ga0500560_024191 | Ga0500560_024191_687_1211 | 174 |
| 702 | 3300053109 | Ga0500569_003921 | Ga0500569_003921_1418_1942 | 174 |
| 703 | 3300053111 | Ga0500572_006235 | Ga0500572_006235_1015_1539 | 174 |
| 704 | 3300053118 | Ga0500594_0128135 | Ga0500594_0128135_91_615 | 174 |
| 705 | 3300053124 | Ga0500617_112577 | Ga0500617_112577_131_655 | 174 |
| 706 | 3300053129 | Ga0500628_002210 | Ga0500628_002210_748_1272 | 174 |
| 707 | 3300053131 | Ga0500652_003648 | Ga0500652_003648_889_1413 | 174 |
| 708 | 3300053134 | Ga0500658_0001635 | Ga0500658_0001635_3413_3937 | 174 |
| 709 | 3300053136 | Ga0500559_0003914 | Ga0500559_0003914_3711_4235 | 174 |
| 710 | 3300053137 | Ga0500561_0002416 | Ga0500561_0002416_594_1118 | 174 |
| 711 | 3300053139 | Ga0500568_0140902 | Ga0500568_0140902_318_842 | 174 |
| 712 | 3300053140 | Ga0500573_0037191 | Ga0500573_0037191_847_1371 | 174 |
| 713 | 3300053140 | Ga0500573_0089299 | Ga0500573_0089299_229_753 | 174 |
| 714 | 3300053142 | Ga0500577_0014784 | Ga0500577_0014784_1575_2102 | 174 |
| 715 | 3300053142 | Ga0500577_0111670 | Ga0500577_0111670_510_1034 | 174 |
| 716 | 3300053143 | Ga0500579_087240 | Ga0500579_087240_121_645 | 174 |
| 717 | 3300053146 | Ga0500588_0002851 | Ga0500588_0002851_1189_1713 | 174 |
| 718 | 3300053146 | Ga0500588_0277734 | Ga0500588_0277734_89_613 | 174 |
| 719 | 3300053149 | Ga0500600_0019800 | Ga0500600_0019800_3185_3709 | 174 |
| 720 | 3300053153 | Ga0500616_0336230 | Ga0500616_0336230_17_541 | 174 |
| 721 | 3300053156 | Ga0500622_0235644 | Ga0500622_0235644_51_575 | 174 |
| 722 | 3300053160 | Ga0500633_0038105 | Ga0500633_0038105_946_1470 | 174 |
| 723 | 3300053161 | Ga0500634_0009835 | Ga0500634_0009835_3279_3803 | 174 |
| 724 | 3300053161 | Ga0500634_0177886 | Ga0500634_0177886_42_566 | 174 |
| 725 | 3300053732 | Ga0500656_000596 | Ga0500656_000596_543_1067 | 174 |
| 726 | 3300053739 | Ga0500587_002964 | Ga0500587_002964_282_806 | 174 |
| 727 | 3300054114 | Ga0501084_0100963 | Ga0501084_0100963_1763_2296 | 174 |
| 728 | 3300059628 | Ga0587122_011395 | Ga0587122_011395_227_751 | 174 |
| 729 | 3300060353 | Ga0501082_0051593 | Ga0501082_0051593_1524_2048 | 174 |
| 730 | 3300061719 | Ga0466962_0000168 | Ga0466962_0000168_19323_19847 | 174 |
| 731 | 3300061719 | Ga0466962_0110057 | Ga0466962_0110057_451_975 | 174 |
| 732 | 3300061719 | Ga0466962_0192325 | Ga0466962_0192325_254_778 | 174 |
| 733 | 3300061734 | Ga0530510_0148368 | Ga0530510_0148368_911_1435 | 174 |
| 734 | 3300025944 | Ga0207661_10815200 | Ga0207661_108152002 | 175 |
| 735 | iso_pu_bacteria | 2784746763 | 2785341498 | 176 |
| 736 | iso_pu_bacteria | 2795385472 | 2795791863 | 176 |
| 737 | 3300009551 | Ga0105238_10057832 | Ga0105238_100578322 | 177 |
| 738 | 3300046457 | Ga0495590_0025435 | Ga0495590_0025435_546_1079 | 177 |
| 739 | 3300046475 | Ga0495639_0578428 | Ga0495639_0578428_10_543 | 177 |
| 740 | 3300047471 | Ga0495684_0447525 | Ga0495684_0447525_137_670 | 177 |
| 741 | 3300049571 | Ga0501034_0088988 | Ga0501034_0088988_1790_2323 | 177 |
| 742 | 3300049572 | Ga0501036_0672406 | Ga0501036_0672406_264_797 | 177 |
| 743 | 3300049575 | Ga0501039_0611561 | Ga0501039_0611561_196_738 | 177 |
| 744 | 3300049581 | Ga0501047_0008070 | Ga0501047_0008070_874_1407 | 177 |
| 745 | 3300049582 | Ga0501048_0070219 | Ga0501048_0070219_1377_1910 | 177 |
| 746 | 3300049822 | Ga0501035_0198038 | Ga0501035_0198038_519_1052 | 177 |
| 747 | 3300030732 | Ga0316176_1221328 | Ga0316176_12213281 | 179 |
| 748 | 3300001989 | JGI24739J22299_10005676 | JGI24739J22299_100056761 | 180 |
| 749 | 3300001990 | JGI24737J22298_10036687 | JGI24737J22298_100366872 | 180 |
| 750 | 3300005330 | Ga0070690_100025937 | Ga0070690_1000259373 | 180 |
| 751 | 3300005563 | Ga0068855_100861886 | Ga0068855_1008618861 | 180 |
| 752 | 3300005614 | Ga0068856_100938836 | Ga0068856_1009388362 | 180 |
| 753 | 3300025904 | Ga0207647_10003438 | Ga0207647_100034386 | 180 |
| 754 | 3300025912 | Ga0207707_10279892 | Ga0207707_102798922 | 180 |
| 755 | 3300025949 | Ga0207667_10671126 | Ga0207667_106711262 | 180 |
| 756 | 3300030500 | Ga0268256_1047276 | Ga0268256_10472761 | 180 |
| 757 | 3300030732 | Ga0316176_1044666 | Ga0316176_10446661 | 180 |
| 758 | 3300030733 | Ga0314311_1107895 | Ga0314311_11078952 | 180 |
| 759 | 3300031456 | Ga0307513_10281300 | Ga0307513_102813002 | 180 |
| 760 | 3300031507 | Ga0307509_10148111 | Ga0307509_101481112 | 180 |
| 761 | 3300031616 | Ga0307508_10009182 | Ga0307508_100091827 | 180 |
| 762 | 3300042008 | Ga0439450_068271 | Ga0439450_068271_165_710 | 180 |
| 763 | 3300044656 | Ga0466969_0099970 | Ga0466969_0099970_548_1093 | 180 |
| 764 | 3300049571 | Ga0501034_0158505 | Ga0501034_0158505_541_1083 | 180 |
| 765 | 3300049573 | Ga0501037_0320433 | Ga0501037_0320433_130_672 | 180 |
| 766 | 3300049581 | Ga0501047_0192917 | Ga0501047_0192917_1173_1715 | 180 |
| 767 | 3300049582 | Ga0501048_0215026 | Ga0501048_0215026_463_1005 | 180 |
| 768 | 3300049590 | Ga0501074_0221398 | Ga0501074_0221398_541_1083 | 180 |
| 769 | 3300049742 | Ga0501080_0275758 | Ga0501080_0275758_964_1506 | 180 |
| 770 | 3300049823 | Ga0501044_0053364 | Ga0501044_0053364_1925_2467 | 180 |
| 771 | iso_pu_bacteria | 3006486233 | 3006486432 | 180 |
| 772 | iso_pu_bacteria | 8008558824 | 8008562467 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h20-assembly1.cif.gz_A-2 | x-ray structure of padr-like transcription factor from bacteroid fragilis | 0.8916 | 3 | 88 |
| 3elk-assembly1.cif.gz_B | crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum | 0.8916 | 3 | 87 |
| 6fuu-assembly1.cif.gz_A | transcriptional regulator lmrr with bound heme | 0.8814 | 1 | 88 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.8803 | 5 | 88 |
| 6abt-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.8604 | 4 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5h20A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8916 | 3 | 88 | 1.10.10.10 |
| 6fuuA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8814 | 1 | 88 | 1.10.10.10 |
| 2p4wB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8812 | 9 | 77 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8803 | 5 | 88 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8786 | 9 | 94 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q2CT39-F1-model_v4 | PadR family transcriptional regulator | 0.9498 | 10 | 178 |
|
| AF-A0A3M0I7D0-F1-model_v4 | PadR family transcriptional regulator | 0.942 | 8 | 87 |
|
| AF-A0A7W7R6U0-F1-model_v4 | DNA-binding PadR family transcriptional regulator | 0.9371 | 8 | 87 |
GO:0003677
|
| AF-A0A3R9UWV8-F1-model_v4 | PadR family transcriptional regulator | 0.9367 | 8 | 87 |
|
| AF-A0A506YBI8-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9354 | 10 | 87 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar