F480102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 772 | 346 | 772 | 112 |
Family's Representative Sequence
| Representative Sequence | 3300000546|LJNas_1026590|LJNas_10265902 |
| Length | 117 |
| Sequence | MRESSETLSGSTWDVEQLLTDALRPIEPPERLTGRFEDTLSAVTQAAAAELSDWAEELSESELRALRDPRNWVRPVVAVGAGSVATGALVLIELRRRSKNKGESGLRALSGGLRSRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 184 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 198 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 199 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 342 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 344 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 345 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.2 |
| Nodule | 0 |
| Rhizoplane | 10.88 |
| Rhizosphere | 83.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1026590 | 3300000546 | Bacteria | 619 |
| 2 | JGI24746J21847_1000082 | 3300001977 | Bacteria | 10321 |
| 3 | JGI24740J21852_10002425 | 3300001979 | Bacteria | 8470 |
| 4 | JGI24034J26672_10000100 | 3300002239 | Bacteria | 14378 |
| 5 | JGI25406J46586_10071415 | 3300003203 | Bacteria | 1088 |
| 6 | JGI25407J50210_10114449 | 3300003373 | Bacteria | 665 |
| 7 | JGI25404J52841_10093533 | 3300003659 | Bacteria | 629 |
| 8 | Ga0065707_10778225 | 3300005295 | Bacteria | 600 |
| 9 | Ga0070658_10173125 | 3300005327 | Bacteria | 1814 |
| 10 | Ga0070683_100001949 | 3300005329 | Bacteria | 16174 |
| 11 | Ga0070683_100004000 | 3300005329 | Bacteria | 12072 |
| 12 | Ga0070683_100012150 | 3300005329 | Bacteria | 7473 |
| 13 | Ga0070683_100127418 | 3300005329 | Bacteria | 2407 |
| 14 | Ga0070683_100132343 | 3300005329 | Bacteria | 2361 |
| 15 | Ga0070683_100166516 | 3300005329 | Bacteria | 2091 |
| 16 | Ga0070683_100499763 | 3300005329 | Bacteria | 1162 |
| 17 | Ga0070690_100264005 | 3300005330 | Bacteria | 1222 |
| 18 | Ga0070690_101317765 | 3300005330 | Bacteria | 579 |
| 19 | Ga0070670_100346520 | 3300005331 | Bacteria | 1304 |
| 20 | Ga0070677_10000515 | 3300005333 | Bacteria | 13266 |
| 21 | Ga0068869_100175188 | 3300005334 | Bacteria | 1678 |
| 22 | Ga0070666_10010679 | 3300005335 | Bacteria | 5749 |
| 23 | Ga0070666_10010680 | 3300005335 | Bacteria | 5749 |
| 24 | Ga0070680_100385948 | 3300005336 | Bacteria | 1193 |
| 25 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 26 | Ga0070682_100016669 | 3300005337 | Bacteria | 4276 |
| 27 | Ga0070682_101349262 | 3300005337 | Bacteria | 608 |
| 28 | Ga0068868_100003592 | 3300005338 | Bacteria | 10807 |
| 29 | Ga0068868_100117677 | 3300005338 | Bacteria | 2165 |
| 30 | Ga0070660_100000254 | 3300005339 | Bacteria | 35147 |
| 31 | Ga0070660_100539046 | 3300005339 | Bacteria | 973 |
| 32 | Ga0070660_100752835 | 3300005339 | Bacteria | 818 |
| 33 | Ga0070689_100090411 | 3300005340 | Bacteria | 2412 |
| 34 | Ga0070689_100171111 | 3300005340 | Bacteria | 1760 |
| 35 | Ga0070691_10000046 | 3300005341 | Bacteria | 35659 |
| 36 | Ga0070691_10085429 | 3300005341 | Bacteria | 1550 |
| 37 | Ga0070691_10447236 | 3300005341 | Bacteria | 737 |
| 38 | Ga0070687_100299903 | 3300005343 | Bacteria | 1019 |
| 39 | Ga0070661_100000279 | 3300005344 | Bacteria | 41265 |
| 40 | Ga0070661_100724244 | 3300005344 | Bacteria | 812 |
| 41 | Ga0070692_10033559 | 3300005345 | Bacteria | 2587 |
| 42 | Ga0070692_10309891 | 3300005345 | Bacteria | 967 |
| 43 | Ga0070669_100271469 | 3300005353 | Bacteria | 1356 |
| 44 | Ga0070675_100000069 | 3300005354 | Bacteria | 59717 |
| 45 | Ga0070671_101707048 | 3300005355 | Bacteria | 559 |
| 46 | Ga0070674_100000074 | 3300005356 | Bacteria | 46384 |
| 47 | Ga0070674_101297920 | 3300005356 | Bacteria | 649 |
| 48 | Ga0070673_101771310 | 3300005364 | Bacteria | 585 |
| 49 | Ga0070688_100000211 | 3300005365 | Bacteria | 30817 |
| 50 | Ga0070688_100006275 | 3300005365 | Bacteria | 6342 |
| 51 | Ga0070688_100016289 | 3300005365 | Bacteria | 4247 |
| 52 | Ga0070688_100370127 | 3300005365 | Bacteria | 1054 |
| 53 | Ga0070659_100003627 | 3300005366 | Bacteria | 10992 |
| 54 | Ga0070659_100010404 | 3300005366 | Bacteria | 6842 |
| 55 | Ga0070659_100087161 | 3300005366 | Bacteria | 2499 |
| 56 | Ga0070667_100007228 | 3300005367 | Bacteria | 9225 |
| 57 | Ga0070667_100073843 | 3300005367 | Bacteria | 2909 |
| 58 | Ga0070667_100966986 | 3300005367 | Bacteria | 794 |
| 59 | Ga0070709_10749187 | 3300005434 | Bacteria | 763 |
| 60 | Ga0070714_100037764 | 3300005435 | Bacteria | 4060 |
| 61 | Ga0070714_101089448 | 3300005435 | Bacteria | 778 |
| 62 | Ga0070713_100000023 | 3300005436 | Bacteria | 98528 |
| 63 | Ga0070713_100051767 | 3300005436 | Bacteria | 3397 |
| 64 | Ga0070701_10184007 | 3300005438 | Bacteria | 1225 |
| 65 | Ga0070701_10447142 | 3300005438 | Bacteria | 829 |
| 66 | Ga0070711_100001230 | 3300005439 | Bacteria | 13841 |
| 67 | Ga0070711_100235786 | 3300005439 | Bacteria | 1428 |
| 68 | Ga0070711_100788892 | 3300005439 | Bacteria | 805 |
| 69 | Ga0070705_101006704 | 3300005440 | Bacteria | 677 |
| 70 | Ga0070700_100011692 | 3300005441 | Bacteria | 4870 |
| 71 | Ga0070700_100068842 | 3300005441 | Bacteria | 2252 |
| 72 | Ga0070700_100291468 | 3300005441 | Bacteria | 1187 |
| 73 | Ga0070663_100004452 | 3300005455 | Bacteria | 8240 |
| 74 | Ga0070663_100082479 | 3300005455 | Bacteria | 2365 |
| 75 | Ga0070663_101012510 | 3300005455 | Bacteria | 723 |
| 76 | Ga0070663_102110783 | 3300005455 | Bacteria | 508 |
| 77 | Ga0070678_100102651 | 3300005456 | Bacteria | 2220 |
| 78 | Ga0070678_100622074 | 3300005456 | Bacteria | 966 |
| 79 | Ga0070662_100018204 | 3300005457 | Bacteria | 4748 |
| 80 | Ga0070662_101176802 | 3300005457 | Bacteria | 659 |
| 81 | Ga0070681_10235753 | 3300005458 | Bacteria | 1744 |
| 82 | Ga0070681_11294148 | 3300005458 | Bacteria | 652 |
| 83 | Ga0068867_100023035 | 3300005459 | Bacteria | 4457 |
| 84 | Ga0068867_100855966 | 3300005459 | Bacteria | 815 |
| 85 | Ga0070685_10000032 | 3300005466 | Bacteria | 84253 |
| 86 | Ga0070685_10000540 | 3300005466 | Bacteria | 21390 |
| 87 | Ga0070685_10068347 | 3300005466 | Bacteria | 2099 |
| 88 | Ga0070679_100018595 | 3300005530 | Bacteria | 6746 |
| 89 | Ga0070679_100133381 | 3300005530 | Bacteria | 2465 |
| 90 | Ga0070684_100000542 | 3300005535 | Bacteria | 25958 |
| 91 | Ga0070684_100012296 | 3300005535 | Bacteria | 6854 |
| 92 | Ga0070684_100023153 | 3300005535 | Bacteria | 5189 |
| 93 | Ga0070684_100361092 | 3300005535 | Bacteria | 1337 |
| 94 | Ga0070684_100390520 | 3300005535 | Bacteria | 1282 |
| 95 | Ga0070684_100468753 | 3300005535 | Bacteria | 1165 |
| 96 | Ga0070684_100585640 | 3300005535 | Bacteria | 1037 |
| 97 | Ga0070684_100627573 | 3300005535 | Bacteria | 1000 |
| 98 | Ga0070684_101901207 | 3300005535 | Bacteria | 562 |
| 99 | Ga0068853_100013341 | 3300005539 | Bacteria | 6709 |
| 100 | Ga0068853_100025791 | 3300005539 | Bacteria | 4934 |
| 101 | Ga0068853_100370538 | 3300005539 | Bacteria | 1336 |
| 102 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 103 | Ga0070672_100052973 | 3300005543 | Bacteria | 3171 |
| 104 | Ga0070686_100008940 | 3300005544 | Bacteria | 5614 |
| 105 | Ga0070686_100268702 | 3300005544 | Bacteria | 1253 |
| 106 | Ga0070686_101298358 | 3300005544 | Bacteria | 608 |
| 107 | Ga0070695_100037702 | 3300005545 | Bacteria | 3048 |
| 108 | Ga0070695_100195199 | 3300005545 | Bacteria | 1443 |
| 109 | Ga0070693_100217393 | 3300005547 | Bacteria | 1250 |
| 110 | Ga0070693_101286222 | 3300005547 | Unclassified | 565 |
| 111 | Ga0070665_100001182 | 3300005548 | Bacteria | 31862 |
| 112 | Ga0070665_100127161 | 3300005548 | Bacteria | 2551 |
| 113 | Ga0070665_100175868 | 3300005548 | Bacteria | 2141 |
| 114 | Ga0070665_100965378 | 3300005548 | Bacteria | 865 |
| 115 | Ga0070665_101288792 | 3300005548 | Bacteria | 741 |
| 116 | Ga0068855_100496369 | 3300005563 | Bacteria | 1327 |
| 117 | Ga0070664_100048993 | 3300005564 | Bacteria | 3572 |
| 118 | Ga0070664_100068063 | 3300005564 | Bacteria | 3044 |
| 119 | Ga0070664_101369951 | 3300005564 | Bacteria | 668 |
| 120 | Ga0068857_100099628 | 3300005577 | Bacteria | 2607 |
| 121 | Ga0068857_100210379 | 3300005577 | Bacteria | 1775 |
| 122 | Ga0068857_100901832 | 3300005577 | Bacteria | 848 |
| 123 | Ga0068854_100000094 | 3300005578 | Bacteria | 62790 |
| 124 | Ga0068854_100029841 | 3300005578 | Bacteria | 3779 |
| 125 | Ga0068856_100001548 | 3300005614 | Bacteria | 24057 |
| 126 | Ga0068856_100014086 | 3300005614 | Bacteria | 7731 |
| 127 | Ga0068856_100092123 | 3300005614 | Bacteria | 3015 |
| 128 | Ga0070702_100012454 | 3300005615 | Bacteria | 4263 |
| 129 | Ga0070702_100989786 | 3300005615 | Bacteria | 665 |
| 130 | Ga0068852_100000595 | 3300005616 | Bacteria | 23764 |
| 131 | Ga0068852_100008522 | 3300005616 | Bacteria | 7563 |
| 132 | Ga0068859_101781622 | 3300005617 | Bacteria | 680 |
| 133 | Ga0068864_100142292 | 3300005618 | Bacteria | 2165 |
| 134 | Ga0068866_10000349 | 3300005718 | Bacteria | 21712 |
| 135 | Ga0068866_10045476 | 3300005718 | Bacteria | 2202 |
| 136 | Ga0068866_10562748 | 3300005718 | Bacteria | 764 |
| 137 | Ga0068861_100304376 | 3300005719 | Bacteria | 1382 |
| 138 | Ga0068861_100429499 | 3300005719 | Bacteria | 1179 |
| 139 | Ga0068861_100713821 | 3300005719 | Bacteria | 933 |
| 140 | Ga0068851_10006008 | 3300005834 | Bacteria | 5532 |
| 141 | Ga0068851_10009469 | 3300005834 | Bacteria | 4532 |
| 142 | Ga0068851_10021879 | 3300005834 | Bacteria | 3108 |
| 143 | Ga0068870_10139754 | 3300005840 | Bacteria | 1416 |
| 144 | Ga0068870_10237800 | 3300005840 | Bacteria | 1123 |
| 145 | Ga0068863_100000229 | 3300005841 | Bacteria | 59324 |
| 146 | Ga0068863_100194056 | 3300005841 | Bacteria | 1952 |
| 147 | Ga0068863_101134523 | 3300005841 | Bacteria | 787 |
| 148 | Ga0068858_100000017 | 3300005842 | Bacteria | 186913 |
| 149 | Ga0068858_100322246 | 3300005842 | Bacteria | 1477 |
| 150 | Ga0068860_100128482 | 3300005843 | Bacteria | 2430 |
| 151 | Ga0068860_100699832 | 3300005843 | Bacteria | 1023 |
| 152 | Ga0068860_101231060 | 3300005843 | Bacteria | 769 |
| 153 | Ga0068862_100017083 | 3300005844 | Bacteria | 6038 |
| 154 | Ga0081455_10015052 | 3300005937 | Bacteria | 7533 |
| 155 | Ga0081455_10182740 | 3300005937 | Bacteria | 1586 |
| 156 | Ga0081455_10524826 | 3300005937 | Bacteria | 789 |
| 157 | Ga0081538_10022789 | 3300005981 | Bacteria | 4523 |
| 158 | Ga0081540_1000046 | 3300005983 | Bacteria | 131375 |
| 159 | Ga0081539_10002029 | 3300005985 | Bacteria | 30518 |
| 160 | Ga0075365_10004268 | 3300006038 | Bacteria | 7543 |
| 161 | Ga0075363_100011280 | 3300006048 | Bacteria | 4275 |
| 162 | Ga0075364_10027080 | 3300006051 | Bacteria | 3660 |
| 163 | Ga0075364_10221070 | 3300006051 | Bacteria | 1285 |
| 164 | Ga0075364_10392574 | 3300006051 | Bacteria | 947 |
| 165 | Ga0070715_10104200 | 3300006163 | Bacteria | 1328 |
| 166 | Ga0070716_100059536 | 3300006173 | Bacteria | 2202 |
| 167 | Ga0070712_100004870 | 3300006175 | Bacteria | 8303 |
| 168 | Ga0075367_10134744 | 3300006178 | Bacteria | 1528 |
| 169 | Ga0068871_100619970 | 3300006358 | Bacteria | 985 |
| 170 | Ga0075433_10012873 | 3300006852 | Bacteria | 6778 |
| 171 | Ga0068865_100000293 | 3300006881 | Bacteria | 27538 |
| 172 | Ga0068865_100015784 | 3300006881 | Bacteria | 4819 |
| 173 | Ga0068865_102023360 | 3300006881 | Bacteria | 523 |
| 174 | Ga0097620_101781395 | 3300006931 | Bacteria | 680 |
| 175 | Ga0075435_100504652 | 3300007076 | Bacteria | 1046 |
| 176 | Ga0105240_12218355 | 3300009093 | Bacteria | 569 |
| 177 | Ga0111539_10044614 | 3300009094 | Bacteria | 5311 |
| 178 | Ga0111539_12142115 | 3300009094 | Unclassified | 649 |
| 179 | Ga0105245_10000249 | 3300009098 | Bacteria | 51282 |
| 180 | Ga0105245_10000330 | 3300009098 | Bacteria | 44516 |
| 181 | Ga0105245_10001943 | 3300009098 | Bacteria | 18774 |
| 182 | Ga0105245_10042800 | 3300009098 | Bacteria | 4040 |
| 183 | Ga0105245_11813389 | 3300009098 | Bacteria | 663 |
| 184 | Ga0105247_10000629 | 3300009101 | Bacteria | 28167 |
| 185 | Ga0105247_10296170 | 3300009101 | Bacteria | 1121 |
| 186 | Ga0105243_10018797 | 3300009148 | Bacteria | 5236 |
| 187 | Ga0105243_10060666 | 3300009148 | Bacteria | 3021 |
| 188 | Ga0105243_10161333 | 3300009148 | Bacteria | 1933 |
| 189 | Ga0105243_10509838 | 3300009148 | Bacteria | 1142 |
| 190 | Ga0105241_10165675 | 3300009174 | Bacteria | 1821 |
| 191 | Ga0105242_10000139 | 3300009176 | Bacteria | 52585 |
| 192 | Ga0105242_10000264 | 3300009176 | Bacteria | 41690 |
| 193 | Ga0105242_10044641 | 3300009176 | Bacteria | 3590 |
| 194 | Ga0105242_10767097 | 3300009176 | Bacteria | 951 |
| 195 | Ga0105242_10968143 | 3300009176 | Bacteria | 856 |
| 196 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 197 | Ga0105248_11539962 | 3300009177 | Bacteria | 753 |
| 198 | Ga0105237_12336532 | 3300009545 | Bacteria | 545 |
| 199 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 200 | Ga0105238_10136897 | 3300009551 | Bacteria | 2427 |
| 201 | Ga0105238_10171646 | 3300009551 | Bacteria | 2145 |
| 202 | Ga0105249_10000054 | 3300009553 | Bacteria | 162883 |
| 203 | Ga0105249_10629008 | 3300009553 | Bacteria | 1130 |
| 204 | Ga0105239_10092973 | 3300010375 | Bacteria | 3330 |
| 205 | Ga0105239_10195215 | 3300010375 | Bacteria | 2267 |
| 206 | Ga0105246_10705072 | 3300011119 | Bacteria | 885 |
| 207 | Ga0157371_10005742 | 3300013102 | Bacteria | 10396 |
| 208 | Ga0157370_10007930 | 3300013104 | Bacteria | 11498 |
| 209 | Ga0157370_10070465 | 3300013104 | Bacteria | 3300 |
| 210 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 211 | Ga0157374_10000242 | 3300013296 | Bacteria | 50857 |
| 212 | Ga0157374_10729583 | 3300013296 | Bacteria | 1005 |
| 213 | Ga0157374_10899664 | 3300013296 | Bacteria | 903 |
| 214 | Ga0157374_11171875 | 3300013296 | Unclassified | 789 |
| 215 | Ga0157378_10035367 | 3300013297 | Bacteria | 4417 |
| 216 | Ga0157378_10244006 | 3300013297 | Bacteria | 1717 |
| 217 | Ga0163162_10257874 | 3300013306 | Bacteria | 1875 |
| 218 | Ga0163162_10829343 | 3300013306 | Bacteria | 1041 |
| 219 | Ga0163162_11205029 | 3300013306 | Bacteria | 859 |
| 220 | Ga0163162_12325988 | 3300013306 | Unclassified | 616 |
| 221 | Ga0157372_10000556 | 3300013307 | Bacteria | 41040 |
| 222 | Ga0157372_10572197 | 3300013307 | Bacteria | 1317 |
| 223 | Ga0157372_11025021 | 3300013307 | Bacteria | 955 |
| 224 | Ga0157375_10000368 | 3300013308 | Bacteria | 41066 |
| 225 | Ga0157375_10007785 | 3300013308 | Bacteria | 9372 |
| 226 | Ga0157375_10144911 | 3300013308 | Bacteria | 2505 |
| 227 | Ga0157375_10258077 | 3300013308 | Bacteria | 1904 |
| 228 | Ga0157375_10456179 | 3300013308 | Unclassified | 1444 |
| 229 | Ga0163163_10265847 | 3300014325 | Unclassified | 1766 |
| 230 | Ga0163163_10418142 | 3300014325 | Bacteria | 1399 |
| 231 | Ga0163163_10907496 | 3300014325 | Bacteria | 944 |
| 232 | Ga0163163_11502968 | 3300014325 | Bacteria | 735 |
| 233 | Ga0157380_10000448 | 3300014326 | Bacteria | 25238 |
| 234 | Ga0157380_10000641 | 3300014326 | Bacteria | 21588 |
| 235 | Ga0157380_10092518 | 3300014326 | Bacteria | 2499 |
| 236 | Ga0157380_10139935 | 3300014326 | Bacteria | 2078 |
| 237 | Ga0157380_11290674 | 3300014326 | Bacteria | 777 |
| 238 | Ga0157377_10002909 | 3300014745 | Bacteria | 7655 |
| 239 | Ga0157377_10697283 | 3300014745 | Bacteria | 737 |
| 240 | Ga0157377_10948756 | 3300014745 | Bacteria | 647 |
| 241 | Ga0157379_10205732 | 3300014968 | Bacteria | 1780 |
| 242 | Ga0157379_12027983 | 3300014968 | Bacteria | 569 |
| 243 | Ga0157376_10072594 | 3300014969 | Bacteria | 2928 |
| 244 | Ga0157376_10693552 | 3300014969 | Bacteria | 1023 |
| 245 | Ga0163161_10000240 | 3300017792 | Bacteria | 49520 |
| 246 | Ga0163161_10093151 | 3300017792 | Bacteria | 2232 |
| 247 | Ga0163161_11113299 | 3300017792 | Bacteria | 679 |
| 248 | Ga0206353_11846088 | 3300020082 | Bacteria | 956 |
| 249 | Ga0206353_12016716 | 3300020082 | Bacteria | 644 |
| 250 | Ga0207656_10000372 | 3300025321 | Bacteria | 15020 |
| 251 | Ga0207656_10013051 | 3300025321 | Bacteria | 3168 |
| 252 | Ga0207656_10040792 | 3300025321 | Bacteria | 1969 |
| 253 | Ga0207653_10223232 | 3300025885 | Bacteria | 716 |
| 254 | Ga0207682_10001663 | 3300025893 | Bacteria | 10194 |
| 255 | Ga0207642_10000109 | 3300025899 | Bacteria | 22332 |
| 256 | Ga0207642_10190004 | 3300025899 | Bacteria | 1126 |
| 257 | Ga0207642_10394536 | 3300025899 | Bacteria | 827 |
| 258 | Ga0207710_10000096 | 3300025900 | Bacteria | 116063 |
| 259 | Ga0207688_10010299 | 3300025901 | Bacteria | 5089 |
| 260 | Ga0207680_10011203 | 3300025903 | Bacteria | 4520 |
| 261 | Ga0207680_10037190 | 3300025903 | Bacteria | 2809 |
| 262 | Ga0207647_10502343 | 3300025904 | Bacteria | 676 |
| 263 | Ga0207647_10568024 | 3300025904 | Bacteria | 628 |
| 264 | Ga0207685_10431402 | 3300025905 | Bacteria | 681 |
| 265 | Ga0207645_10080049 | 3300025907 | Bacteria | 2094 |
| 266 | Ga0207643_10088116 | 3300025908 | Bacteria | 1806 |
| 267 | Ga0207705_10100639 | 3300025909 | Bacteria | 2126 |
| 268 | Ga0207705_10400598 | 3300025909 | Bacteria | 1061 |
| 269 | Ga0207654_10156486 | 3300025911 | Bacteria | 1468 |
| 270 | Ga0207707_10138975 | 3300025912 | Bacteria | 2124 |
| 271 | Ga0207707_11247119 | 3300025912 | Bacteria | 600 |
| 272 | Ga0207695_10633968 | 3300025913 | Bacteria | 950 |
| 273 | Ga0207693_10009775 | 3300025915 | Bacteria | 7810 |
| 274 | Ga0207693_10916695 | 3300025915 | Bacteria | 672 |
| 275 | Ga0207663_10003933 | 3300025916 | Bacteria | 7350 |
| 276 | Ga0207663_10666413 | 3300025916 | Bacteria | 822 |
| 277 | Ga0207660_10355449 | 3300025917 | Bacteria | 1175 |
| 278 | Ga0207662_10075821 | 3300025918 | Bacteria | 2043 |
| 279 | Ga0207657_10000895 | 3300025919 | Bacteria | 31534 |
| 280 | Ga0207657_10076447 | 3300025919 | Bacteria | 2824 |
| 281 | Ga0207657_10131398 | 3300025919 | Bacteria | 2052 |
| 282 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 283 | Ga0207652_10001027 | 3300025921 | Bacteria | 25599 |
| 284 | Ga0207652_10226522 | 3300025921 | Bacteria | 1685 |
| 285 | Ga0207681_10156701 | 3300025923 | Bacteria | 1712 |
| 286 | Ga0207681_10185136 | 3300025923 | Bacteria | 1589 |
| 287 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 288 | Ga0207694_10139289 | 3300025924 | Bacteria | 1950 |
| 289 | Ga0207694_10466642 | 3300025924 | Bacteria | 1055 |
| 290 | Ga0207650_10394434 | 3300025925 | Bacteria | 1145 |
| 291 | Ga0207650_10952763 | 3300025925 | Bacteria | 729 |
| 292 | Ga0207659_10000126 | 3300025926 | Bacteria | 45034 |
| 293 | Ga0207659_10100378 | 3300025926 | Bacteria | 2181 |
| 294 | Ga0207687_10000094 | 3300025927 | Bacteria | 64753 |
| 295 | Ga0207687_10000106 | 3300025927 | Bacteria | 61275 |
| 296 | Ga0207687_10000211 | 3300025927 | Bacteria | 39509 |
| 297 | Ga0207687_10071643 | 3300025927 | Bacteria | 2477 |
| 298 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 299 | Ga0207700_10027642 | 3300025928 | Bacteria | 3977 |
| 300 | Ga0207700_11927132 | 3300025928 | Bacteria | 517 |
| 301 | Ga0207664_10031461 | 3300025929 | Bacteria | 4060 |
| 302 | Ga0207644_11400983 | 3300025931 | Bacteria | 587 |
| 303 | Ga0207690_10002156 | 3300025932 | Bacteria | 12029 |
| 304 | Ga0207690_10013969 | 3300025932 | Bacteria | 4839 |
| 305 | Ga0207690_10026329 | 3300025932 | Bacteria | 3661 |
| 306 | Ga0207706_10005227 | 3300025933 | Bacteria | 12115 |
| 307 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 308 | Ga0207686_10000242 | 3300025934 | Bacteria | 41739 |
| 309 | Ga0207686_10012305 | 3300025934 | Bacteria | 4702 |
| 310 | Ga0207686_10455476 | 3300025934 | Bacteria | 985 |
| 311 | Ga0207686_11089416 | 3300025934 | Bacteria | 651 |
| 312 | Ga0207709_10005413 | 3300025935 | Bacteria | 7257 |
| 313 | Ga0207709_10136361 | 3300025935 | Bacteria | 1681 |
| 314 | Ga0207709_10145526 | 3300025935 | Bacteria | 1634 |
| 315 | Ga0207670_10054052 | 3300025936 | Bacteria | 2708 |
| 316 | Ga0207670_10064975 | 3300025936 | Bacteria | 2503 |
| 317 | Ga0207670_10470094 | 3300025936 | Bacteria | 1017 |
| 318 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 319 | Ga0207669_10545829 | 3300025937 | Bacteria | 934 |
| 320 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 321 | Ga0207704_10008926 | 3300025938 | Bacteria | 4816 |
| 322 | Ga0207704_10234165 | 3300025938 | Bacteria | 1368 |
| 323 | Ga0207665_10137458 | 3300025939 | Bacteria | 1740 |
| 324 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 325 | Ga0207691_10018193 | 3300025940 | Bacteria | 6656 |
| 326 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 327 | Ga0207711_11029397 | 3300025941 | Bacteria | 763 |
| 328 | Ga0207689_10236944 | 3300025942 | Bacteria | 1508 |
| 329 | Ga0207661_10000348 | 3300025944 | Bacteria | 29705 |
| 330 | Ga0207661_10001988 | 3300025944 | Bacteria | 14066 |
| 331 | Ga0207661_10007679 | 3300025944 | Bacteria | 7674 |
| 332 | Ga0207661_10090051 | 3300025944 | Bacteria | 2554 |
| 333 | Ga0207661_10332112 | 3300025944 | Bacteria | 1368 |
| 334 | Ga0207661_10495629 | 3300025944 | Bacteria | 1116 |
| 335 | Ga0207679_10105381 | 3300025945 | Bacteria | 2214 |
| 336 | Ga0207679_10289241 | 3300025945 | Bacteria | 1408 |
| 337 | Ga0207667_10099967 | 3300025949 | Bacteria | 2992 |
| 338 | Ga0207651_10074933 | 3300025960 | Bacteria | 2412 |
| 339 | Ga0207712_10000032 | 3300025961 | Bacteria | 210628 |
| 340 | Ga0207712_10131246 | 3300025961 | Bacteria | 1909 |
| 341 | Ga0207712_10446929 | 3300025961 | Bacteria | 1095 |
| 342 | Ga0207668_10011738 | 3300025972 | Bacteria | 5337 |
| 343 | Ga0207668_10245003 | 3300025972 | Bacteria | 1452 |
| 344 | Ga0207640_10000077 | 3300025981 | Bacteria | 76155 |
| 345 | Ga0207658_10003057 | 3300025986 | Bacteria | 11974 |
| 346 | Ga0207658_10055754 | 3300025986 | Bacteria | 2930 |
| 347 | Ga0207658_10249685 | 3300025986 | Bacteria | 1507 |
| 348 | Ga0207677_10000551 | 3300026023 | Bacteria | 23665 |
| 349 | Ga0207677_10000817 | 3300026023 | Bacteria | 17805 |
| 350 | Ga0207677_10042336 | 3300026023 | Bacteria | 3019 |
| 351 | Ga0207703_10000030 | 3300026035 | Bacteria | 199014 |
| 352 | Ga0207703_10467639 | 3300026035 | Bacteria | 1180 |
| 353 | Ga0207703_11429211 | 3300026035 | Bacteria | 665 |
| 354 | Ga0207639_10008950 | 3300026041 | Bacteria | 6891 |
| 355 | Ga0207639_10017923 | 3300026041 | Bacteria | 5023 |
| 356 | Ga0207639_10035932 | 3300026041 | Bacteria | 3669 |
| 357 | Ga0207639_10125273 | 3300026041 | Bacteria | 2118 |
| 358 | Ga0207678_10007063 | 3300026067 | Bacteria | 9971 |
| 359 | Ga0207678_10026150 | 3300026067 | Bacteria | 5092 |
| 360 | Ga0207678_10527404 | 3300026067 | Bacteria | 1031 |
| 361 | Ga0207678_11081541 | 3300026067 | Bacteria | 710 |
| 362 | Ga0207708_10001040 | 3300026075 | Bacteria | 20775 |
| 363 | Ga0207708_10367025 | 3300026075 | Bacteria | 1184 |
| 364 | Ga0207702_10000534 | 3300026078 | Bacteria | 42535 |
| 365 | Ga0207702_10020626 | 3300026078 | Bacteria | 5454 |
| 366 | Ga0207702_10046394 | 3300026078 | Bacteria | 3658 |
| 367 | Ga0207702_10457589 | 3300026078 | Bacteria | 1239 |
| 368 | Ga0207702_10742622 | 3300026078 | Bacteria | 969 |
| 369 | Ga0207641_10002613 | 3300026088 | Bacteria | 16523 |
| 370 | Ga0207641_10019958 | 3300026088 | Bacteria | 5501 |
| 371 | Ga0207641_10432371 | 3300026088 | Bacteria | 1269 |
| 372 | Ga0207641_10858440 | 3300026088 | Bacteria | 900 |
| 373 | Ga0207648_10029476 | 3300026089 | Bacteria | 4866 |
| 374 | Ga0207648_11047191 | 3300026089 | Bacteria | 765 |
| 375 | Ga0207674_10088649 | 3300026116 | Bacteria | 3087 |
| 376 | Ga0207674_10331307 | 3300026116 | Bacteria | 1472 |
| 377 | Ga0207674_10446657 | 3300026116 | Bacteria | 1250 |
| 378 | Ga0207675_100335474 | 3300026118 | Bacteria | 1479 |
| 379 | Ga0207675_100624007 | 3300026118 | Bacteria | 1082 |
| 380 | Ga0207675_100772862 | 3300026118 | Bacteria | 973 |
| 381 | Ga0207683_10013190 | 3300026121 | Bacteria | 7050 |
| 382 | Ga0207683_10129353 | 3300026121 | Bacteria | 2270 |
| 383 | Ga0207698_10000450 | 3300026142 | Bacteria | 23764 |
| 384 | Ga0207698_10018467 | 3300026142 | Bacteria | 4752 |
| 385 | Ga0207698_10028769 | 3300026142 | Bacteria | 3968 |
| 386 | Ga0207698_10650956 | 3300026142 | Bacteria | 1044 |
| 387 | Ga0268266_10000781 | 3300028379 | Bacteria | 42591 |
| 388 | Ga0268266_10001302 | 3300028379 | Bacteria | 30313 |
| 389 | Ga0268266_10025581 | 3300028379 | Bacteria | 5021 |
| 390 | Ga0268266_10057962 | 3300028379 | Bacteria | 3334 |
| 391 | Ga0268266_10167561 | 3300028379 | Bacteria | 1991 |
| 392 | Ga0268266_12279305 | 3300028379 | Unclassified | 513 |
| 393 | Ga0268265_10223962 | 3300028380 | Bacteria | 1648 |
| 394 | Ga0268264_10473771 | 3300028381 | Bacteria | 1217 |
| 395 | Ga0265337_1000462 | 3300028556 | Bacteria | 21477 |
| 396 | Ga0265326_10000033 | 3300028558 | Bacteria | 91972 |
| 397 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 398 | Ga0265318_10057725 | 3300028577 | Bacteria | 1450 |
| 399 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 400 | Ga0265336_10015097 | 3300028666 | Bacteria | 2548 |
| 401 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 402 | Ga0265324_10001579 | 3300029957 | Bacteria | 12679 |
| 403 | Ga0307511_10127344 | 3300030521 | Bacteria | 1548 |
| 404 | Ga0265332_10009473 | 3300031238 | Bacteria | 4346 |
| 405 | Ga0265332_10050960 | 3300031238 | Bacteria | 1779 |
| 406 | Ga0265328_10000811 | 3300031239 | Bacteria | 14425 |
| 407 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 408 | Ga0265320_10469816 | 3300031240 | Bacteria | 555 |
| 409 | Ga0265325_10024230 | 3300031241 | Bacteria | 3303 |
| 410 | Ga0265329_10001349 | 3300031242 | Bacteria | 11919 |
| 411 | Ga0265340_10379933 | 3300031247 | Bacteria | 623 |
| 412 | Ga0265339_10334464 | 3300031249 | Unclassified | 716 |
| 413 | Ga0265331_10000549 | 3300031250 | Bacteria | 34013 |
| 414 | Ga0265331_10034893 | 3300031250 | Bacteria | 2478 |
| 415 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 416 | Ga0265327_10206608 | 3300031251 | Bacteria | 888 |
| 417 | Ga0265316_10057316 | 3300031344 | Bacteria | 3038 |
| 418 | Ga0265316_10239578 | 3300031344 | Bacteria | 1334 |
| 419 | Ga0307513_10771902 | 3300031456 | Bacteria | 667 |
| 420 | Ga0316579_10617453 | 3300031691 | Bacteria | 525 |
| 421 | Ga0265314_10006416 | 3300031711 | Bacteria | 10420 |
| 422 | Ga0265342_10064498 | 3300031712 | Bacteria | 2149 |
| 423 | Ga0265342_10135058 | 3300031712 | Bacteria | 1379 |
| 424 | Ga0307415_100019193 | 3300032126 | Bacteria | 4145 |
| 425 | Ga0373953_0204583 | 3300035117 | Bacteria | 854 |
| 426 | Ga0373955_0340332 | 3300035172 | Bacteria | 908 |
| 427 | Ga0316574_0007154 | 3300035398 | Bacteria | 6100 |
| 428 | Ga0373924_0320616 | 3300035410 | Bacteria | 689 |
| 429 | Ga0373931_0562274 | 3300035691 | Unclassified | 742 |
| 430 | Ga0373947_0467276 | 3300035725 | Bacteria | 855 |
| 431 | Ga0373937_0052434 | 3300036401 | Bacteria | 3740 |
| 432 | Ga0373937_0161694 | 3300036401 | Bacteria | 2099 |
| 433 | Ga0316582_0856350 | 3300036647 | Unclassified | 622 |
| 434 | Ga0395901_0350635 | 3300038443 | Bacteria | 1523 |
| 435 | Ga0451804_1135842 | 3300041463 | Unclassified | 512 |
| 436 | Ga0451807_1046215 | 3300041486 | Bacteria | 709 |
| 437 | Ga0451839_1259115 | 3300041496 | Bacteria | 751 |
| 438 | Ga0451853_2362759 | 3300041512 | Bacteria | 1354 |
| 439 | Ga0466963_0000548 | 3300044694 | Bacteria | 17637 |
| 440 | Ga0466963_0716143 | 3300044694 | Bacteria | 706 |
| 441 | Ga0466957_0001600 | 3300044842 | Bacteria | 11888 |
| 442 | Ga0466960_0095017 | 3300044901 | Bacteria | 1526 |
| 443 | Ga0466958_0029643 | 3300045836 | Bacteria | 3247 |
| 444 | Ga0466967_0000012 | 3300045976 | Bacteria | 104270 |
| 445 | Ga0466967_0134346 | 3300045976 | Bacteria | 2300 |
| 446 | Ga0466967_0353777 | 3300045976 | Bacteria | 1422 |
| 447 | Ga0495592_0032908 | 3300046454 | Bacteria | 3911 |
| 448 | Ga0495592_0227223 | 3300046454 | Bacteria | 1244 |
| 449 | Ga0495592_0257617 | 3300046454 | Bacteria | 1150 |
| 450 | Ga0495592_0319266 | 3300046454 | Bacteria | 1004 |
| 451 | Ga0495603_0001342 | 3300046455 | Bacteria | 14292 |
| 452 | Ga0495603_0004246 | 3300046455 | Bacteria | 8534 |
| 453 | Ga0495603_0131153 | 3300046455 | Bacteria | 1459 |
| 454 | Ga0495629_0000421 | 3300046459 | Bacteria | 35460 |
| 455 | Ga0495629_0001522 | 3300046459 | Bacteria | 18233 |
| 456 | Ga0495629_0007414 | 3300046459 | Bacteria | 8085 |
| 457 | Ga0495629_0755210 | 3300046459 | Bacteria | 643 |
| 458 | Ga0495638_0034168 | 3300046460 | Bacteria | 3247 |
| 459 | Ga0495641_0000440 | 3300046461 | Bacteria | 34775 |
| 460 | Ga0495641_0008689 | 3300046461 | Bacteria | 6145 |
| 461 | Ga0495641_0054791 | 3300046461 | Bacteria | 1811 |
| 462 | Ga0495641_0088197 | 3300046461 | Bacteria | 1388 |
| 463 | Ga0495653_0035156 | 3300046463 | Bacteria | 3956 |
| 464 | Ga0495653_0122373 | 3300046463 | Bacteria | 1852 |
| 465 | Ga0495653_0186821 | 3300046463 | Bacteria | 1417 |
| 466 | Ga0495653_0261498 | 3300046463 | Bacteria | 1144 |
| 467 | Ga0495662_0003232 | 3300046476 | Bacteria | 8230 |
| 468 | Ga0495662_0262372 | 3300046476 | Bacteria | 850 |
| 469 | Ga0495662_0307837 | 3300046476 | Bacteria | 779 |
| 470 | Ga0495664_0195461 | 3300046477 | Bacteria | 1226 |
| 471 | Ga0495594_0000166 | 3300046499 | Bacteria | 31439 |
| 472 | Ga0495596_0210647 | 3300046500 | Bacteria | 755 |
| 473 | Ga0495606_0000908 | 3300046507 | Bacteria | 43982 |
| 474 | Ga0495608_0000071 | 3300046511 | Bacteria | 77182 |
| 475 | Ga0495608_0000346 | 3300046511 | Bacteria | 32424 |
| 476 | Ga0495608_0106249 | 3300046511 | Bacteria | 1807 |
| 477 | Ga0495610_0245770 | 3300046512 | Bacteria | 711 |
| 478 | Ga0495618_0000218 | 3300046514 | Bacteria | 41741 |
| 479 | Ga0495618_0456444 | 3300046514 | Bacteria | 775 |
| 480 | Ga0495620_0000947 | 3300046515 | Bacteria | 17886 |
| 481 | Ga0495620_0026815 | 3300046515 | Bacteria | 2705 |
| 482 | Ga0495628_0000663 | 3300046516 | Bacteria | 31565 |
| 483 | Ga0495628_0031836 | 3300046516 | Bacteria | 4263 |
| 484 | Ga0495628_0104500 | 3300046516 | Bacteria | 2183 |
| 485 | Ga0495628_0116471 | 3300046516 | Bacteria | 2052 |
| 486 | Ga0495628_0142305 | 3300046516 | Bacteria | 1830 |
| 487 | Ga0495630_0000592 | 3300046517 | Bacteria | 26406 |
| 488 | Ga0495630_0000752 | 3300046517 | Bacteria | 22843 |
| 489 | Ga0495630_0016660 | 3300046517 | Bacteria | 5374 |
| 490 | Ga0495630_0381863 | 3300046517 | Bacteria | 1079 |
| 491 | Ga0495630_0747779 | 3300046517 | Bacteria | 747 |
| 492 | Ga0495644_0006894 | 3300046523 | Bacteria | 4398 |
| 493 | Ga0495652_0000009 | 3300046529 | Bacteria | 311000 |
| 494 | Ga0495652_0008072 | 3300046529 | Bacteria | 9640 |
| 495 | Ga0495652_0561378 | 3300046529 | Bacteria | 784 |
| 496 | Ga0495586_0000359 | 3300046535 | Bacteria | 28382 |
| 497 | Ga0495586_0093922 | 3300046535 | Bacteria | 1659 |
| 498 | Ga0495587_0006597 | 3300046536 | Bacteria | 7556 |
| 499 | Ga0495587_0027615 | 3300046536 | Bacteria | 3456 |
| 500 | Ga0495587_0217029 | 3300046536 | Bacteria | 1079 |
| 501 | Ga0495587_0371127 | 3300046536 | Bacteria | 796 |
| 502 | Ga0495621_0000491 | 3300046539 | Bacteria | 9742 |
| 503 | Ga0495645_0031530 | 3300046543 | Bacteria | 3863 |
| 504 | Ga0495645_0247128 | 3300046543 | Bacteria | 1187 |
| 505 | Ga0495622_0000076 | 3300046557 | Bacteria | 86777 |
| 506 | Ga0495633_0040611 | 3300046558 | Bacteria | 2215 |
| 507 | Ga0495667_0000019 | 3300046559 | Bacteria | 181645 |
| 508 | Ga0495667_0070832 | 3300046559 | Bacteria | 2274 |
| 509 | Ga0495667_0845848 | 3300046559 | Bacteria | 563 |
| 510 | Ga0495656_0000204 | 3300046615 | Bacteria | 21157 |
| 511 | Ga0495634_0000558 | 3300046642 | Bacteria | 36397 |
| 512 | Ga0495634_0000933 | 3300046642 | Bacteria | 27697 |
| 513 | Ga0495634_0008513 | 3300046642 | Bacteria | 7627 |
| 514 | Ga0495625_0000395 | 3300046660 | Bacteria | 66640 |
| 515 | Ga0495635_0015400 | 3300046663 | Bacteria | 5349 |
| 516 | Ga0495588_0000647 | 3300046674 | Bacteria | 16200 |
| 517 | Ga0495657_0000096 | 3300046675 | Bacteria | 77239 |
| 518 | Ga0495657_0011081 | 3300046675 | Bacteria | 6759 |
| 519 | Ga0495657_0114221 | 3300046675 | Bacteria | 1707 |
| 520 | Ga0495599_0181345 | 3300046678 | Bacteria | 1298 |
| 521 | Ga0495623_0159064 | 3300046679 | Bacteria | 1329 |
| 522 | Ga0495647_0000028 | 3300046681 | Bacteria | 56683 |
| 523 | Ga0495647_0000310 | 3300046681 | Bacteria | 13667 |
| 524 | Ga0495647_0126280 | 3300046681 | Bacteria | 1080 |
| 525 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 526 | Ga0495658_0001763 | 3300046683 | Bacteria | 11187 |
| 527 | Ga0495658_0409302 | 3300046683 | Bacteria | 865 |
| 528 | Ga0495669_0125527 | 3300046684 | Bacteria | 1205 |
| 529 | Ga0495669_0148389 | 3300046684 | Bacteria | 1109 |
| 530 | Ga0495669_0380223 | 3300046684 | Bacteria | 683 |
| 531 | Ga0495613_0000132 | 3300046689 | Bacteria | 74233 |
| 532 | Ga0495613_0002052 | 3300046689 | Bacteria | 15307 |
| 533 | Ga0495624_0000711 | 3300046690 | Bacteria | 26091 |
| 534 | Ga0495624_0002444 | 3300046690 | Bacteria | 14095 |
| 535 | Ga0495624_0265433 | 3300046690 | Bacteria | 1037 |
| 536 | Ga0495670_0210453 | 3300046691 | Bacteria | 1031 |
| 537 | Ga0495649_0006549 | 3300046694 | Bacteria | 7244 |
| 538 | Ga0495600_0006449 | 3300046809 | Bacteria | 7144 |
| 539 | Ga0495600_0278797 | 3300046809 | Bacteria | 1059 |
| 540 | Ga0495600_0335310 | 3300046809 | Bacteria | 949 |
| 541 | Ga0495600_0472057 | 3300046809 | Bacteria | 774 |
| 542 | Ga0495604_0000104 | 3300047317 | Bacteria | 71390 |
| 543 | Ga0495604_0000527 | 3300047317 | Bacteria | 33774 |
| 544 | Ga0495604_0225629 | 3300047317 | Bacteria | 1287 |
| 545 | Ga0495674_0000024 | 3300047319 | Bacteria | 141746 |
| 546 | Ga0495672_0123531 | 3300047320 | Bacteria | 1372 |
| 547 | Ga0495676_0008324 | 3300047321 | Bacteria | 9511 |
| 548 | Ga0495680_0002158 | 3300047322 | Bacteria | 20383 |
| 549 | Ga0495680_0066079 | 3300047322 | Bacteria | 2769 |
| 550 | Ga0495675_0000715 | 3300047444 | Bacteria | 20721 |
| 551 | Ga0495679_035991 | 3300047446 | Bacteria | 1566 |
| 552 | Ga0495685_017187 | 3300047447 | Bacteria | 2476 |
| 553 | Ga0495684_0088553 | 3300047471 | Bacteria | 2346 |
| 554 | Ga0495686_0252841 | 3300047472 | Bacteria | 990 |
| 555 | Ga0495593_0009754 | 3300047673 | Bacteria | 5568 |
| 556 | Ga0495593_0041504 | 3300047673 | Bacteria | 2473 |
| 557 | Ga0495602_0000641 | 3300048088 | Bacteria | 32698 |
| 558 | Ga0495602_0000911 | 3300048088 | Bacteria | 28599 |
| 559 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 560 | Ga0496100_0017081 | 3300048903 | Bacteria | 4276 |
| 561 | Ga0496100_0510723 | 3300048903 | Bacteria | 927 |
| 562 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 563 | Ga0496101_0277394 | 3300048904 | Bacteria | 1309 |
| 564 | Ga0496102_0000438 | 3300048905 | Bacteria | 47526 |
| 565 | Ga0496102_0005175 | 3300048905 | Bacteria | 11068 |
| 566 | Ga0496102_0041706 | 3300048905 | Bacteria | 4158 |
| 567 | Ga0496102_0078416 | 3300048905 | Bacteria | 3041 |
| 568 | Ga0496102_0136538 | 3300048905 | Bacteria | 2298 |
| 569 | Ga0496102_0673693 | 3300048905 | Bacteria | 957 |
| 570 | Ga0496102_0676220 | 3300048905 | Bacteria | 955 |
| 571 | Ga0496102_1608250 | 3300048905 | Bacteria | 568 |
| 572 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 573 | Ga0496103_0003939 | 3300048906 | Bacteria | 9020 |
| 574 | Ga0496103_0073809 | 3300048906 | Bacteria | 2137 |
| 575 | Ga0496103_0378309 | 3300048906 | Bacteria | 910 |
| 576 | Ga0496103_0789426 | 3300048906 | Bacteria | 599 |
| 577 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 578 | Ga0496104_0002977 | 3300048907 | Bacteria | 14597 |
| 579 | Ga0496104_0081146 | 3300048907 | Bacteria | 3093 |
| 580 | Ga0496104_0106136 | 3300048907 | Bacteria | 2691 |
| 581 | Ga0496104_0324894 | 3300048907 | Bacteria | 1451 |
| 582 | Ga0496104_0342447 | 3300048907 | Bacteria | 1408 |
| 583 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 584 | Ga0496105_0002572 | 3300048908 | Bacteria | 13183 |
| 585 | Ga0496105_0002721 | 3300048908 | Bacteria | 12894 |
| 586 | Ga0496105_0088315 | 3300048908 | Bacteria | 2561 |
| 587 | Ga0496105_0156207 | 3300048908 | Bacteria | 1873 |
| 588 | Ga0496105_0359162 | 3300048908 | Bacteria | 1162 |
| 589 | Ga0496106_0000033 | 3300048909 | Bacteria | 131412 |
| 590 | Ga0496106_0000137 | 3300048909 | Bacteria | 54395 |
| 591 | Ga0496106_0007514 | 3300048909 | Bacteria | 8057 |
| 592 | Ga0496106_0008110 | 3300048909 | Bacteria | 7759 |
| 593 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 594 | Ga0496107_0013937 | 3300048910 | Bacteria | 5623 |
| 595 | Ga0496107_0050875 | 3300048910 | Bacteria | 2987 |
| 596 | Ga0496107_0053158 | 3300048910 | Bacteria | 2922 |
| 597 | Ga0496107_0055180 | 3300048910 | Bacteria | 2870 |
| 598 | Ga0496107_0363081 | 3300048910 | Bacteria | 1077 |
| 599 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 600 | Ga0496108_0000349 | 3300048911 | Bacteria | 39032 |
| 601 | Ga0496108_0000413 | 3300048911 | Bacteria | 34974 |
| 602 | Ga0496108_0005020 | 3300048911 | Bacteria | 10693 |
| 603 | Ga0496108_0007240 | 3300048911 | Bacteria | 8995 |
| 604 | Ga0496108_0013024 | 3300048911 | Bacteria | 6776 |
| 605 | Ga0496108_0028457 | 3300048911 | Bacteria | 4624 |
| 606 | Ga0496108_0509956 | 3300048911 | Bacteria | 1050 |
| 607 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 608 | Ga0496109_0000031 | 3300048912 | Bacteria | 163998 |
| 609 | Ga0496109_0000307 | 3300048912 | Bacteria | 46191 |
| 610 | Ga0496109_0000333 | 3300048912 | Bacteria | 44006 |
| 611 | Ga0496109_0003508 | 3300048912 | Bacteria | 13101 |
| 612 | Ga0496109_0024868 | 3300048912 | Bacteria | 5330 |
| 613 | Ga0496109_0279353 | 3300048912 | Bacteria | 1574 |
| 614 | Ga0496109_0310543 | 3300048912 | Bacteria | 1487 |
| 615 | Ga0496110_0000166 | 3300048913 | Bacteria | 40195 |
| 616 | Ga0496110_0014143 | 3300048913 | Bacteria | 6619 |
| 617 | Ga0496110_0023581 | 3300048913 | Bacteria | 5236 |
| 618 | Ga0496110_0316736 | 3300048913 | Unclassified | 1421 |
| 619 | Ga0496110_1524238 | 3300048913 | Bacteria | 578 |
| 620 | Ga0496111_0000046 | 3300048914 | Bacteria | 48246 |
| 621 | Ga0496111_0016446 | 3300048914 | Bacteria | 5096 |
| 622 | Ga0496111_0036062 | 3300048914 | Bacteria | 3536 |
| 623 | Ga0496111_0359217 | 3300048914 | Bacteria | 1078 |
| 624 | Ga0496111_0533691 | 3300048914 | Bacteria | 862 |
| 625 | Ga0496111_1266739 | 3300048914 | Bacteria | 520 |
| 626 | Ga0496112_0000002 | 3300048915 | Bacteria | 782039 |
| 627 | Ga0496112_0256798 | 3300048915 | Bacteria | 1698 |
| 628 | Ga0496112_0890495 | 3300048915 | Bacteria | 812 |
| 629 | Ga0496113_0000382 | 3300048916 | Bacteria | 21412 |
| 630 | Ga0496113_0003337 | 3300048916 | Bacteria | 9589 |
| 631 | Ga0496113_0086377 | 3300048916 | Bacteria | 2410 |
| 632 | Ga0496113_0559065 | 3300048916 | Bacteria | 917 |
| 633 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 634 | Ga0496114_0005493 | 3300048917 | Bacteria | 9922 |
| 635 | Ga0496114_0006238 | 3300048917 | Bacteria | 9383 |
| 636 | Ga0496114_0162625 | 3300048917 | Bacteria | 1942 |
| 637 | Ga0496114_0179527 | 3300048917 | Bacteria | 1848 |
| 638 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 639 | Ga0496115_0000027 | 3300048918 | Bacteria | 145505 |
| 640 | Ga0496115_0066821 | 3300048918 | Bacteria | 2906 |
| 641 | Ga0496116_0000120 | 3300048919 | Bacteria | 166804 |
| 642 | Ga0496117_0003475 | 3300048920 | Bacteria | 18288 |
| 643 | Ga0496118_0001146 | 3300048921 | Bacteria | 40888 |
| 644 | Ga0496118_0128472 | 3300048921 | Bacteria | 1633 |
| 645 | Ga0496118_0283129 | 3300048921 | Bacteria | 921 |
| 646 | Ga0496119_0003031 | 3300048922 | Bacteria | 17784 |
| 647 | Ga0496119_0008829 | 3300048922 | Bacteria | 8768 |
| 648 | Ga0496119_0024921 | 3300048922 | Bacteria | 4192 |
| 649 | Ga0496119_0058284 | 3300048922 | Bacteria | 2328 |
| 650 | Ga0496120_0002373 | 3300048923 | Bacteria | 19225 |
| 651 | Ga0496120_0026562 | 3300048923 | Bacteria | 3573 |
| 652 | Ga0496121_0010929 | 3300048924 | Bacteria | 10140 |
| 653 | Ga0496121_0022712 | 3300048924 | Bacteria | 6072 |
| 654 | Ga0496121_0149043 | 3300048924 | Bacteria | 1724 |
| 655 | Ga0496121_0377222 | 3300048924 | Unclassified | 936 |
| 656 | Ga0496124_0150244 | 3300048927 | Bacteria | 1828 |
| 657 | Ga0496124_0371783 | 3300048927 | Bacteria | 1003 |
| 658 | Ga0496124_0726129 | 3300048927 | Bacteria | 626 |
| 659 | Ga0496125_0082356 | 3300048928 | Bacteria | 2453 |
| 660 | Ga0496125_0183625 | 3300048928 | Bacteria | 1390 |
| 661 | Ga0496126_0485724 | 3300048929 | Bacteria | 989 |
| 662 | Ga0501031_0304132 | 3300049568 | Bacteria | 1033 |
| 663 | Ga0501031_0550248 | 3300049568 | Bacteria | 743 |
| 664 | Ga0501033_0045821 | 3300049570 | Bacteria | 3253 |
| 665 | Ga0501034_0091793 | 3300049571 | Bacteria | 3034 |
| 666 | Ga0501034_0158767 | 3300049571 | Bacteria | 2234 |
| 667 | Ga0501034_0177639 | 3300049571 | Bacteria | 2094 |
| 668 | Ga0501034_0411408 | 3300049571 | Bacteria | 1274 |
| 669 | Ga0501038_0055915 | 3300049574 | Bacteria | 3389 |
| 670 | Ga0501039_0538583 | 3300049575 | Bacteria | 916 |
| 671 | Ga0501039_0686785 | 3300049575 | Bacteria | 801 |
| 672 | Ga0501040_0138554 | 3300049576 | Bacteria | 1713 |
| 673 | Ga0501042_0040009 | 3300049578 | Bacteria | 3333 |
| 674 | Ga0501042_0623728 | 3300049578 | Bacteria | 784 |
| 675 | Ga0501043_0089573 | 3300049579 | Bacteria | 2418 |
| 676 | Ga0501043_0291545 | 3300049579 | Bacteria | 1249 |
| 677 | Ga0501043_0432149 | 3300049579 | Bacteria | 991 |
| 678 | Ga0501043_0885003 | 3300049579 | Bacteria | 641 |
| 679 | Ga0501046_0001831 | 3300049580 | Bacteria | 20273 |
| 680 | Ga0501046_1176579 | 3300049580 | Bacteria | 527 |
| 681 | Ga0501047_0023553 | 3300049581 | Bacteria | 5909 |
| 682 | Ga0501047_0039258 | 3300049581 | Bacteria | 4579 |
| 683 | Ga0501047_0237918 | 3300049581 | Bacteria | 1672 |
| 684 | Ga0501047_0300887 | 3300049581 | Bacteria | 1446 |
| 685 | Ga0501047_0864228 | 3300049581 | Bacteria | 718 |
| 686 | Ga0501048_0068919 | 3300049582 | Bacteria | 2498 |
| 687 | Ga0501048_0487639 | 3300049582 | Bacteria | 883 |
| 688 | Ga0501067_0488776 | 3300049583 | Bacteria | 688 |
| 689 | Ga0501068_0039982 | 3300049584 | Bacteria | 2814 |
| 690 | Ga0501068_0111008 | 3300049584 | Bacteria | 1705 |
| 691 | Ga0501069_0343152 | 3300049585 | Bacteria | 879 |
| 692 | Ga0501069_0509205 | 3300049585 | Bacteria | 718 |
| 693 | Ga0501069_0663311 | 3300049585 | Bacteria | 628 |
| 694 | Ga0501070_0004723 | 3300049586 | Bacteria | 11667 |
| 695 | Ga0501070_0021704 | 3300049586 | Bacteria | 5383 |
| 696 | Ga0501070_0105763 | 3300049586 | Bacteria | 2326 |
| 697 | Ga0501070_0199725 | 3300049586 | Bacteria | 1642 |
| 698 | Ga0501070_0239231 | 3300049586 | Bacteria | 1486 |
| 699 | Ga0501070_0309283 | 3300049586 | Bacteria | 1286 |
| 700 | Ga0501071_0044828 | 3300049587 | Bacteria | 3173 |
| 701 | Ga0501073_0135155 | 3300049589 | Bacteria | 1709 |
| 702 | Ga0501074_0020387 | 3300049590 | Bacteria | 4819 |
| 703 | Ga0501074_0417034 | 3300049590 | Bacteria | 952 |
| 704 | Ga0501075_0001204 | 3300049591 | Bacteria | 16745 |
| 705 | Ga0501076_0114901 | 3300049592 | Bacteria | 2178 |
| 706 | Ga0501079_0035824 | 3300049741 | Bacteria | 3820 |
| 707 | Ga0501080_0038591 | 3300049742 | Bacteria | 4458 |
| 708 | Ga0501080_0261243 | 3300049742 | Bacteria | 1578 |
| 709 | Ga0501080_0420653 | 3300049742 | Bacteria | 1200 |
| 710 | Ga0501080_1819758 | 3300049742 | Bacteria | 511 |
| 711 | Ga0501081_1003258 | 3300049743 | Bacteria | 631 |
| 712 | Ga0501083_0007397 | 3300049744 | Bacteria | 7789 |
| 713 | Ga0501083_0056209 | 3300049744 | Bacteria | 2637 |
| 714 | Ga0501083_0082419 | 3300049744 | Bacteria | 2131 |
| 715 | Ga0501035_0028315 | 3300049822 | Bacteria | 5115 |
| 716 | Ga0501035_0048103 | 3300049822 | Bacteria | 3825 |
| 717 | Ga0501035_1110521 | 3300049822 | Bacteria | 617 |
| 718 | Ga0501044_0035974 | 3300049823 | Bacteria | 5182 |
| 719 | Ga0501044_0091449 | 3300049823 | Bacteria | 3069 |
| 720 | Ga0501044_0121114 | 3300049823 | Bacteria | 2617 |
| 721 | Ga0501044_0309804 | 3300049823 | Unclassified | 1506 |
| 722 | Ga0501044_0395448 | 3300049823 | Bacteria | 1295 |
| 723 | Ga0501045_0480926 | 3300049824 | Bacteria | 923 |
| 724 | nmdc:mga03n38_599995_c1 | 3300050490 | Bacteria | 627 |
| 725 | nmdc:mga00v17_31399_c1 | 3300050491 | Bacteria | 3132 |
| 726 | nmdc:mga00v17_415851_c1 | 3300050491 | Bacteria | 873 |
| 727 | nmdc:mga00v17_618390_c1 | 3300050491 | Bacteria | 698 |
| 728 | nmdc:mga00v17_99220_c1 | 3300050491 | Bacteria | 1837 |
| 729 | nmdc:mga0yw44_5758_c1 | 3300050492 | Bacteria | 5905 |
| 730 | nmdc:mga06z11_43278_c1 | 3300050494 | Bacteria | 2264 |
| 731 | nmdc:mga05p37_1337194_c1 | 3300050507 | Bacteria | 727 |
| 732 | nmdc:mga05p37_217112_c1 | 3300050507 | Bacteria | 2309 |
| 733 | nmdc:mga08y16_1471105_c1 | 3300050511 | Unclassified | 642 |
| 734 | nmdc:mga08y16_42807_c1 | 3300050511 | Bacteria | 4742 |
| 735 | nmdc:mga0rr50_340539_c1 | 3300050513 | Bacteria | 1260 |
| 736 | nmdc:mga08x19_206543_c1 | 3300050514 | Bacteria | 1347 |
| 737 | nmdc:mga0a205_4_c1 | 3300050515 | Bacteria | 168154 |
| 738 | nmdc:mga0a205_507_c1 | 3300050515 | Bacteria | 15066 |
| 739 | Ga0495601_0000618 | 3300053077 | Bacteria | 18918 |
| 740 | Ga0495601_0012796 | 3300053077 | Bacteria | 5036 |
| 741 | Ga0495601_0032168 | 3300053077 | Bacteria | 3264 |
| 742 | Ga0495601_0100172 | 3300053077 | Bacteria | 1871 |
| 743 | Ga0495601_0110732 | 3300053077 | Bacteria | 1778 |
| 744 | Ga0495601_0128333 | 3300053077 | Bacteria | 1651 |
| 745 | Ga0495601_0141014 | 3300053077 | Bacteria | 1572 |
| 746 | Ga0495601_0541482 | 3300053077 | Unclassified | 749 |
| 747 | Ga0495612_0001837 | 3300053078 | Bacteria | 8704 |
| 748 | Ga0495612_0010971 | 3300053078 | Bacteria | 3658 |
| 749 | Ga0495612_0018436 | 3300053078 | Bacteria | 2796 |
| 750 | Ga0495612_0044017 | 3300053078 | Bacteria | 1826 |
| 751 | Ga0495612_0149420 | 3300053078 | Bacteria | 1016 |
| 752 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 753 | Ga0495655_0000171 | 3300053083 | Bacteria | 12258 |
| 754 | Ga0495595_0000009 | 3300053084 | Bacteria | 193039 |
| 755 | Ga0495595_0000148 | 3300053084 | Bacteria | 28375 |
| 756 | Ga0495595_0021984 | 3300053084 | Bacteria | 2794 |
| 757 | Ga0495595_0506958 | 3300053084 | Bacteria | 615 |
| 758 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 759 | Ga0495619_0000177 | 3300053085 | Bacteria | 46800 |
| 760 | Ga0495619_0000413 | 3300053085 | Bacteria | 29033 |
| 761 | Ga0495619_0000867 | 3300053085 | Bacteria | 19839 |
| 762 | Ga0495619_0003424 | 3300053085 | Bacteria | 10239 |
| 763 | Ga0495619_0014796 | 3300053085 | Bacteria | 4929 |
| 764 | Ga0495619_0045943 | 3300053085 | Bacteria | 2870 |
| 765 | Ga0495619_0053614 | 3300053085 | Bacteria | 2668 |
| 766 | Ga0495619_0838692 | 3300053085 | Bacteria | 620 |
| 767 | Ga0500566_0002814 | 3300053094 | Bacteria | 10359 |
| 768 | Ga0500595_179189 | 3300053119 | Bacteria | 588 |
| 769 | Ga0500614_001529 | 3300053123 | Bacteria | 5484 |
| 770 | Ga0500628_000039 | 3300053129 | Bacteria | 49907 |
| 771 | Ga0501082_0110513 | 3300060353 | Bacteria | 2379 |
| 772 | Ga0530510_0140972 | 3300061734 | Bacteria | 1776 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009101 | Ga0105247_10296170 | Ga0105247_102961701 | 87 |
| 2 | 3300013297 | Ga0157378_10244006 | Ga0157378_102440062 | 87 |
| 3 | 3300013306 | Ga0163162_12325988 | Ga0163162_123259882 | 87 |
| 4 | 3300013307 | Ga0157372_11025021 | Ga0157372_110250212 | 87 |
| 5 | 3300014325 | Ga0163163_10907496 | Ga0163163_109074961 | 87 |
| 6 | 3300035691 | Ga0373931_0562274 | Ga0373931_0562274_34_363 | 87 |
| 7 | 3300048903 | Ga0496100_0017081 | Ga0496100_0017081_1684_2013 | 87 |
| 8 | 3300048904 | Ga0496101_0277394 | Ga0496101_0277394_963_1292 | 87 |
| 9 | 3300048905 | Ga0496102_0005175 | Ga0496102_0005175_7212_7541 | 87 |
| 10 | 3300048906 | Ga0496103_0003939 | Ga0496103_0003939_6770_7099 | 87 |
| 11 | 3300048907 | Ga0496104_0324894 | Ga0496104_0324894_365_694 | 87 |
| 12 | 3300048908 | Ga0496105_0002572 | Ga0496105_0002572_5769_6098 | 87 |
| 13 | 3300048909 | Ga0496106_0007514 | Ga0496106_0007514_5002_5331 | 87 |
| 14 | 3300048910 | Ga0496107_0013937 | Ga0496107_0013937_477_806 | 87 |
| 15 | 3300048911 | Ga0496108_0028457 | Ga0496108_0028457_2214_2543 | 87 |
| 16 | 3300048912 | Ga0496109_0024868 | Ga0496109_0024868_1225_1554 | 87 |
| 17 | 3300048914 | Ga0496111_0036062 | Ga0496111_0036062_2715_3044 | 87 |
| 18 | 3300048917 | Ga0496114_0006238 | Ga0496114_0006238_3914_4243 | 87 |
| 19 | 3300038443 | Ga0395901_0350635 | Ga0395901_0350635_703_1038 | 92 |
| 20 | 3300044901 | Ga0466960_0095017 | Ga0466960_0095017_406_744 | 92 |
| 21 | 3300005937 | Ga0081455_10182740 | Ga0081455_101827403 | 93 |
| 22 | 3300025923 | Ga0207681_10156701 | Ga0207681_101567013 | 93 |
| 23 | 3300013308 | Ga0157375_10144911 | Ga0157375_101449113 | 94 |
| 24 | 3300046500 | Ga0495596_0210647 | Ga0495596_0210647_284_649 | 94 |
| 25 | 3300053085 | Ga0495619_0014796 | Ga0495619_0014796_1185_1526 | 94 |
| 26 | 3300046499 | Ga0495594_0000166 | Ga0495594_0000166_14444_14770 | 95 |
| 27 | 3300046516 | Ga0495628_0031836 | Ga0495628_0031836_2400_2744 | 95 |
| 28 | 3300049583 | Ga0501067_0488776 | Ga0501067_0488776_228_554 | 95 |
| 29 | 3300049585 | Ga0501069_0663311 | Ga0501069_0663311_254_580 | 95 |
| 30 | 3300061734 | Ga0530510_0140972 | Ga0530510_0140972_54_380 | 95 |
| 31 | 3300005455 | Ga0070663_102110783 | Ga0070663_1021107831 | 97 |
| 32 | 3300044694 | Ga0466963_0000548 | Ga0466963_0000548_2297_2650 | 97 |
| 33 | 3300005439 | Ga0070711_100235786 | Ga0070711_1002357863 | 98 |
| 34 | 3300009098 | Ga0105245_11813389 | Ga0105245_118133892 | 98 |
| 35 | 3300009148 | Ga0105243_10509838 | Ga0105243_105098382 | 98 |
| 36 | 3300014325 | Ga0163163_10418142 | Ga0163163_104181423 | 98 |
| 37 | 3300014326 | Ga0157380_11290674 | Ga0157380_112906742 | 98 |
| 38 | 3300014745 | Ga0157377_10948756 | Ga0157377_109487562 | 98 |
| 39 | 3300046543 | Ga0495645_0031530 | Ga0495645_0031530_2212_2508 | 98 |
| 40 | 3300005436 | Ga0070713_100051767 | Ga0070713_1000517675 | 99 |
| 41 | 3300005615 | Ga0070702_100989786 | Ga0070702_1009897862 | 99 |
| 42 | 3300009551 | Ga0105238_10000016 | Ga0105238_10000016154 | 99 |
| 43 | 3300011119 | Ga0105246_10705072 | Ga0105246_107050721 | 99 |
| 44 | 3300025904 | Ga0207647_10568024 | Ga0207647_105680241 | 99 |
| 45 | 3300025916 | Ga0207663_10666413 | Ga0207663_106664132 | 99 |
| 46 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012268 | 99 |
| 47 | 3300025928 | Ga0207700_10027642 | Ga0207700_100276423 | 99 |
| 48 | 3300047447 | Ga0495685_017187 | Ga0495685_017187_1460_1804 | 99 |
| 49 | 3300009093 | Ga0105240_12218355 | Ga0105240_122183552 | 100 |
| 50 | 3300005339 | Ga0070660_100752835 | Ga0070660_1007528352 | 102 |
| 51 | 3300005366 | Ga0070659_100087161 | Ga0070659_1000871613 | 102 |
| 52 | 3300014326 | Ga0157380_10000641 | Ga0157380_1000064114 | 102 |
| 53 | 3300014969 | Ga0157376_10693552 | Ga0157376_106935522 | 102 |
| 54 | 3300025919 | Ga0207657_10076447 | Ga0207657_100764473 | 102 |
| 55 | 3300025932 | Ga0207690_10026329 | Ga0207690_100263292 | 102 |
| 56 | 3300025936 | Ga0207670_10064975 | Ga0207670_100649752 | 102 |
| 57 | 3300044842 | Ga0466957_0001600 | Ga0466957_0001600_10253_10606 | 102 |
| 58 | 3300046536 | Ga0495587_0027615 | Ga0495587_0027615_2145_2483 | 102 |
| 59 | 3300005439 | Ga0070711_100788892 | Ga0070711_1007888922 | 103 |
| 60 | 3300006358 | Ga0068871_100619970 | Ga0068871_1006199702 | 103 |
| 61 | 3300009553 | Ga0105249_10000054 | Ga0105249_1000005431 | 103 |
| 62 | 3300025961 | Ga0207712_10000032 | Ga0207712_10000032134 | 103 |
| 63 | 3300044694 | Ga0466963_0716143 | Ga0466963_0716143_343_696 | 103 |
| 64 | 3300046523 | Ga0495644_0006894 | Ga0495644_0006894_1756_2097 | 103 |
| 65 | 3300046690 | Ga0495624_0000711 | Ga0495624_0000711_17200_17547 | 103 |
| 66 | 3300047673 | Ga0495593_0041504 | Ga0495593_0041504_500_841 | 103 |
| 67 | 3300005329 | Ga0070683_100499763 | Ga0070683_1004997632 | 104 |
| 68 | 3300005535 | Ga0070684_100468753 | Ga0070684_1004687532 | 104 |
| 69 | 3300005539 | Ga0068853_100025791 | Ga0068853_1000257916 | 104 |
| 70 | 3300005564 | Ga0070664_100068063 | Ga0070664_1000680632 | 104 |
| 71 | 3300005614 | Ga0068856_100092123 | Ga0068856_1000921233 | 104 |
| 72 | 3300005840 | Ga0068870_10237800 | Ga0068870_102378003 | 104 |
| 73 | 3300017792 | Ga0163161_11113299 | Ga0163161_111132992 | 104 |
| 74 | 3300025915 | Ga0207693_10916695 | Ga0207693_109166952 | 104 |
| 75 | 3300025928 | Ga0207700_11927132 | Ga0207700_119271322 | 104 |
| 76 | 3300025944 | Ga0207661_10495629 | Ga0207661_104956292 | 104 |
| 77 | 3300025961 | Ga0207712_10131246 | Ga0207712_101312462 | 104 |
| 78 | 3300026041 | Ga0207639_10017923 | Ga0207639_100179237 | 104 |
| 79 | 3300026078 | Ga0207702_10020626 | Ga0207702_100206265 | 104 |
| 80 | 3300026078 | Ga0207702_10742622 | Ga0207702_107426222 | 104 |
| 81 | 3300028556 | Ga0265337_1000462 | Ga0265337_100046215 | 104 |
| 82 | 3300028558 | Ga0265326_10000033 | Ga0265326_1000003348 | 104 |
| 83 | 3300028654 | Ga0265322_10000005 | Ga0265322_100000052 | 104 |
| 84 | 3300028666 | Ga0265336_10015097 | Ga0265336_100150973 | 104 |
| 85 | 3300029957 | Ga0265324_10001579 | Ga0265324_1000157915 | 104 |
| 86 | 3300031238 | Ga0265332_10009473 | Ga0265332_100094735 | 104 |
| 87 | 3300031239 | Ga0265328_10000811 | Ga0265328_100008118 | 104 |
| 88 | 3300031240 | Ga0265320_10000010 | Ga0265320_1000001048 | 104 |
| 89 | 3300031242 | Ga0265329_10001349 | Ga0265329_1000134910 | 104 |
| 90 | 3300031247 | Ga0265340_10379933 | Ga0265340_103799332 | 104 |
| 91 | 3300031249 | Ga0265339_10334464 | Ga0265339_103344642 | 104 |
| 92 | 3300031250 | Ga0265331_10000549 | Ga0265331_1000054916 | 104 |
| 93 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040259 | 104 |
| 94 | 3300031344 | Ga0265316_10057316 | Ga0265316_100573163 | 104 |
| 95 | 3300031711 | Ga0265314_10006416 | Ga0265314_100064164 | 104 |
| 96 | 3300031712 | Ga0265342_10064498 | Ga0265342_100644982 | 104 |
| 97 | 3300035117 | Ga0373953_0204583 | Ga0373953_0204583_211_555 | 104 |
| 98 | 3300036401 | Ga0373937_0161694 | Ga0373937_0161694_1243_1587 | 104 |
| 99 | 3300045976 | Ga0466967_0134346 | Ga0466967_0134346_720_1034 | 104 |
| 100 | 3300045976 | Ga0466967_0353777 | Ga0466967_0353777_588_902 | 104 |
| 101 | 3300046454 | Ga0495592_0227223 | Ga0495592_0227223_305_619 | 104 |
| 102 | 3300046454 | Ga0495592_0319266 | Ga0495592_0319266_249_563 | 104 |
| 103 | 3300046455 | Ga0495603_0001342 | Ga0495603_0001342_2385_2699 | 104 |
| 104 | 3300046459 | Ga0495629_0755210 | Ga0495629_0755210_191_505 | 104 |
| 105 | 3300046461 | Ga0495641_0000440 | Ga0495641_0000440_25518_25862 | 104 |
| 106 | 3300046461 | Ga0495641_0054791 | Ga0495641_0054791_1345_1659 | 104 |
| 107 | 3300046463 | Ga0495653_0186821 | Ga0495653_0186821_545_889 | 104 |
| 108 | 3300046476 | Ga0495662_0307837 | Ga0495662_0307837_418_732 | 104 |
| 109 | 3300046511 | Ga0495608_0106249 | Ga0495608_0106249_268_612 | 104 |
| 110 | 3300046514 | Ga0495618_0000218 | Ga0495618_0000218_39084_39428 | 104 |
| 111 | 3300046516 | Ga0495628_0104500 | Ga0495628_0104500_54_368 | 104 |
| 112 | 3300046517 | Ga0495630_0381863 | Ga0495630_0381863_302_616 | 104 |
| 113 | 3300046529 | Ga0495652_0008072 | Ga0495652_0008072_3243_3557 | 104 |
| 114 | 3300046529 | Ga0495652_0561378 | Ga0495652_0561378_109_453 | 104 |
| 115 | 3300046543 | Ga0495645_0247128 | Ga0495645_0247128_115_429 | 104 |
| 116 | 3300046557 | Ga0495622_0000076 | Ga0495622_0000076_71945_72298 | 104 |
| 117 | 3300046559 | Ga0495667_0000019 | Ga0495667_0000019_121896_122210 | 104 |
| 118 | 3300046642 | Ga0495634_0000933 | Ga0495634_0000933_22585_22899 | 104 |
| 119 | 3300046642 | Ga0495634_0008513 | Ga0495634_0008513_3541_3855 | 104 |
| 120 | 3300046684 | Ga0495669_0125527 | Ga0495669_0125527_305_619 | 104 |
| 121 | 3300046694 | Ga0495649_0006549 | Ga0495649_0006549_1716_2060 | 104 |
| 122 | 3300046809 | Ga0495600_0006449 | Ga0495600_0006449_1081_1425 | 104 |
| 123 | 3300046809 | Ga0495600_0335310 | Ga0495600_0335310_493_837 | 104 |
| 124 | 3300047322 | Ga0495680_0002158 | Ga0495680_0002158_11267_11581 | 104 |
| 125 | 3300048912 | Ga0496109_0279353 | Ga0496109_0279353_999_1313 | 104 |
| 126 | 3300048915 | Ga0496112_0256798 | Ga0496112_0256798_1212_1526 | 104 |
| 127 | 3300048916 | Ga0496113_0086377 | Ga0496113_0086377_1266_1580 | 104 |
| 128 | 3300048917 | Ga0496114_0005493 | Ga0496114_0005493_2486_2830 | 104 |
| 129 | 3300048918 | Ga0496115_0066821 | Ga0496115_0066821_1347_1661 | 104 |
| 130 | 3300049575 | Ga0501039_0686785 | Ga0501039_0686785_29_343 | 104 |
| 131 | 3300049743 | Ga0501081_1003258 | Ga0501081_1003258_255_569 | 104 |
| 132 | 3300050507 | nmdc:mga05p37_217112_c1 | nmdc:mga05p37_217112_c1_1767_2108 | 104 |
| 133 | 3300053077 | Ga0495601_0128333 | Ga0495601_0128333_997_1311 | 104 |
| 134 | 3300053078 | Ga0495612_0018436 | Ga0495612_0018436_664_978 | 104 |
| 135 | 3300053078 | Ga0495612_0149420 | Ga0495612_0149420_42_356 | 104 |
| 136 | 3300053085 | Ga0495619_0045943 | Ga0495619_0045943_1515_1835 | 104 |
| 137 | 3300053085 | Ga0495619_0838692 | Ga0495619_0838692_86_400 | 104 |
| 138 | 3300053123 | Ga0500614_001529 | Ga0500614_001529_1660_2004 | 104 |
| 139 | 3300005329 | Ga0070683_100004000 | Ga0070683_1000040008 | 105 |
| 140 | 3300005535 | Ga0070684_100012296 | Ga0070684_1000122964 | 105 |
| 141 | 3300005548 | Ga0070665_100127161 | Ga0070665_1001271613 | 105 |
| 142 | 3300013296 | Ga0157374_10000242 | Ga0157374_1000024220 | 105 |
| 143 | 3300025944 | Ga0207661_10000348 | Ga0207661_1000034814 | 105 |
| 144 | 3300028379 | Ga0268266_10057962 | Ga0268266_100579623 | 105 |
| 145 | 3300046455 | Ga0495603_0131153 | Ga0495603_0131153_299_646 | 105 |
| 146 | 3300047320 | Ga0495672_0123531 | Ga0495672_0123531_702_1049 | 105 |
| 147 | 3300048905 | Ga0496102_0673693 | Ga0496102_0673693_580_909 | 105 |
| 148 | 3300048909 | Ga0496106_0000137 | Ga0496106_0000137_3079_3426 | 105 |
| 149 | 3300048910 | Ga0496107_0050875 | Ga0496107_0050875_18_365 | 105 |
| 150 | 3300048910 | Ga0496107_0053158 | Ga0496107_0053158_2544_2873 | 105 |
| 151 | 3300048922 | Ga0496119_0058284 | Ga0496119_0058284_376_705 | 105 |
| 152 | 3300048923 | Ga0496120_0002373 | Ga0496120_0002373_17241_17570 | 105 |
| 153 | 3300048924 | Ga0496121_0149043 | Ga0496121_0149043_303_632 | 105 |
| 154 | 3300048924 | Ga0496121_0377222 | Ga0496121_0377222_546_875 | 105 |
| 155 | 3300048929 | Ga0496126_0485724 | Ga0496126_0485724_274_603 | 105 |
| 156 | 3300049586 | Ga0501070_0004723 | Ga0501070_0004723_7635_7964 | 105 |
| 157 | 3300049744 | Ga0501083_0007397 | Ga0501083_0007397_1493_1822 | 105 |
| 158 | 3300050514 | nmdc:mga08x19_206543_c1 | nmdc:mga08x19_206543_c1_23_340 | 105 |
| 159 | 3300053119 | Ga0500595_179189 | Ga0500595_179189_55_384 | 105 |
| 160 | 3300003373 | JGI25407J50210_10114449 | JGI25407J50210_101144492 | 106 |
| 161 | 3300005981 | Ga0081538_10022789 | Ga0081538_100227893 | 106 |
| 162 | 3300035172 | Ga0373955_0340332 | Ga0373955_0340332_214_540 | 106 |
| 163 | 3300035398 | Ga0316574_0007154 | Ga0316574_0007154_2574_2900 | 106 |
| 164 | 3300035410 | Ga0373924_0320616 | Ga0373924_0320616_338_664 | 106 |
| 165 | 3300036401 | Ga0373937_0052434 | Ga0373937_0052434_1368_1694 | 106 |
| 166 | 3300036647 | Ga0316582_0856350 | Ga0316582_0856350_130_456 | 106 |
| 167 | 3300041463 | Ga0451804_1135842 | Ga0451804_1135842_168_488 | 106 |
| 168 | 3300046463 | Ga0495653_0261498 | Ga0495653_0261498_30_356 | 106 |
| 169 | 3300046517 | Ga0495630_0000752 | Ga0495630_0000752_7117_7443 | 106 |
| 170 | 3300046559 | Ga0495667_0845848 | Ga0495667_0845848_181_501 | 106 |
| 171 | 3300046663 | Ga0495635_0015400 | Ga0495635_0015400_836_1162 | 106 |
| 172 | 3300046675 | Ga0495657_0114221 | Ga0495657_0114221_674_1000 | 106 |
| 173 | 3300046690 | Ga0495624_0265433 | Ga0495624_0265433_98_424 | 106 |
| 174 | 3300046809 | Ga0495600_0472057 | Ga0495600_0472057_302_628 | 106 |
| 175 | 3300053077 | Ga0495601_0012796 | Ga0495601_0012796_3489_3812 | 106 |
| 176 | 3300053077 | Ga0495601_0032168 | Ga0495601_0032168_1718_2044 | 106 |
| 177 | 3300053077 | Ga0495601_0541482 | Ga0495601_0541482_67_399 | 106 |
| 178 | 3300053078 | Ga0495612_0044017 | Ga0495612_0044017_510_836 | 106 |
| 179 | 3300053085 | Ga0495619_0000413 | Ga0495619_0000413_1369_1695 | 106 |
| 180 | 3300053085 | Ga0495619_0053614 | Ga0495619_0053614_1264_1590 | 106 |
| 181 | 3300006051 | Ga0075364_10221070 | Ga0075364_102210702 | 107 |
| 182 | 3300014326 | Ga0157380_10092518 | Ga0157380_100925182 | 107 |
| 183 | 3300026067 | Ga0207678_11081541 | Ga0207678_110815411 | 107 |
| 184 | 3300047317 | Ga0495604_0000104 | Ga0495604_0000104_16500_16844 | 107 |
| 185 | 3300048907 | Ga0496104_0002977 | Ga0496104_0002977_8840_9166 | 107 |
| 186 | 3300048908 | Ga0496105_0002721 | Ga0496105_0002721_6556_6882 | 107 |
| 187 | 3300050490 | nmdc:mga03n38_599995_c1 | nmdc:mga03n38_599995_c1_82_411 | 107 |
| 188 | 3300050491 | nmdc:mga00v17_618390_c1 | nmdc:mga00v17_618390_c1_266_595 | 107 |
| 189 | 3300050491 | nmdc:mga00v17_99220_c1 | nmdc:mga00v17_99220_c1_1339_1668 | 107 |
| 190 | 3300050494 | nmdc:mga06z11_43278_c1 | nmdc:mga06z11_43278_c1_714_1043 | 107 |
| 191 | 3300053077 | Ga0495601_0110732 | Ga0495601_0110732_1130_1456 | 107 |
| 192 | 3300005435 | Ga0070714_101089448 | Ga0070714_1010894481 | 108 |
| 193 | 3300005548 | Ga0070665_101288792 | Ga0070665_1012887922 | 108 |
| 194 | 3300005718 | Ga0068866_10562748 | Ga0068866_105627482 | 108 |
| 195 | 3300005841 | Ga0068863_100000229 | Ga0068863_10000022929 | 108 |
| 196 | 3300005841 | Ga0068863_100194056 | Ga0068863_1001940564 | 108 |
| 197 | 3300009098 | Ga0105245_10000330 | Ga0105245_1000033030 | 108 |
| 198 | 3300009176 | Ga0105242_10000264 | Ga0105242_1000026424 | 108 |
| 199 | 3300013296 | Ga0157374_11171875 | Ga0157374_111718751 | 108 |
| 200 | 3300013308 | Ga0157375_10258077 | Ga0157375_102580773 | 108 |
| 201 | 3300025899 | Ga0207642_10190004 | Ga0207642_101900042 | 108 |
| 202 | 3300025913 | Ga0207695_10633968 | Ga0207695_106339682 | 108 |
| 203 | 3300025934 | Ga0207686_10000035 | Ga0207686_1000003595 | 108 |
| 204 | 3300026088 | Ga0207641_10002613 | Ga0207641_1000261310 | 108 |
| 205 | 3300026088 | Ga0207641_10019958 | Ga0207641_100199585 | 108 |
| 206 | 3300046515 | Ga0495620_0000947 | Ga0495620_0000947_2921_3268 | 108 |
| 207 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_284306_284632 | 108 |
| 208 | 3300048912 | Ga0496109_0000031 | Ga0496109_0000031_130519_130845 | 108 |
| 209 | 3300053083 | Ga0495655_0000010 | Ga0495655_0000010_2411_2764 | 108 |
| 210 | 3300053129 | Ga0500628_000039 | Ga0500628_000039_42091_42444 | 108 |
| 211 | 3300005295 | Ga0065707_10778225 | Ga0065707_107782251 | 109 |
| 212 | 3300005329 | Ga0070683_100166516 | Ga0070683_1001665162 | 109 |
| 213 | 3300005330 | Ga0070690_101317765 | Ga0070690_1013177651 | 109 |
| 214 | 3300005331 | Ga0070670_100346520 | Ga0070670_1003465202 | 109 |
| 215 | 3300005336 | Ga0070680_100385948 | Ga0070680_1003859482 | 109 |
| 216 | 3300005337 | Ga0070682_100016669 | Ga0070682_1000166693 | 109 |
| 217 | 3300005338 | Ga0068868_100117677 | Ga0068868_1001176773 | 109 |
| 218 | 3300005339 | Ga0070660_100000254 | Ga0070660_10000025410 | 109 |
| 219 | 3300005340 | Ga0070689_100171111 | Ga0070689_1001711112 | 109 |
| 220 | 3300005341 | Ga0070691_10447236 | Ga0070691_104472361 | 109 |
| 221 | 3300005345 | Ga0070692_10033559 | Ga0070692_100335592 | 109 |
| 222 | 3300005353 | Ga0070669_100271469 | Ga0070669_1002714692 | 109 |
| 223 | 3300005365 | Ga0070688_100016289 | Ga0070688_1000162896 | 109 |
| 224 | 3300005366 | Ga0070659_100010404 | Ga0070659_1000104045 | 109 |
| 225 | 3300005438 | Ga0070701_10184007 | Ga0070701_101840072 | 109 |
| 226 | 3300005440 | Ga0070705_101006704 | Ga0070705_1010067042 | 109 |
| 227 | 3300005441 | Ga0070700_100011692 | Ga0070700_1000116926 | 109 |
| 228 | 3300005455 | Ga0070663_100004452 | Ga0070663_1000044522 | 109 |
| 229 | 3300005456 | Ga0070678_100102651 | Ga0070678_1001026514 | 109 |
| 230 | 3300005457 | Ga0070662_100018204 | Ga0070662_1000182045 | 109 |
| 231 | 3300005458 | Ga0070681_11294148 | Ga0070681_112941482 | 109 |
| 232 | 3300005459 | Ga0068867_100023035 | Ga0068867_1000230353 | 109 |
| 233 | 3300005530 | Ga0070679_100133381 | Ga0070679_1001333812 | 109 |
| 234 | 3300005535 | Ga0070684_100023153 | Ga0070684_1000231536 | 109 |
| 235 | 3300005539 | Ga0068853_100013341 | Ga0068853_10001334110 | 109 |
| 236 | 3300005543 | Ga0070672_100052973 | Ga0070672_1000529732 | 109 |
| 237 | 3300005544 | Ga0070686_100008940 | Ga0070686_1000089406 | 109 |
| 238 | 3300005545 | Ga0070695_100195199 | Ga0070695_1001951993 | 109 |
| 239 | 3300005547 | Ga0070693_100217393 | Ga0070693_1002173933 | 109 |
| 240 | 3300005563 | Ga0068855_100496369 | Ga0068855_1004963692 | 109 |
| 241 | 3300005564 | Ga0070664_101369951 | Ga0070664_1013699512 | 109 |
| 242 | 3300005577 | Ga0068857_100210379 | Ga0068857_1002103792 | 109 |
| 243 | 3300005578 | Ga0068854_100029841 | Ga0068854_1000298414 | 109 |
| 244 | 3300005615 | Ga0070702_100012454 | Ga0070702_1000124543 | 109 |
| 245 | 3300005616 | Ga0068852_100008522 | Ga0068852_1000085229 | 109 |
| 246 | 3300005617 | Ga0068859_101781622 | Ga0068859_1017816222 | 109 |
| 247 | 3300005618 | Ga0068864_100142292 | Ga0068864_1001422923 | 109 |
| 248 | 3300005718 | Ga0068866_10045476 | Ga0068866_100454762 | 109 |
| 249 | 3300005719 | Ga0068861_100304376 | Ga0068861_1003043762 | 109 |
| 250 | 3300005834 | Ga0068851_10006008 | Ga0068851_100060083 | 109 |
| 251 | 3300005841 | Ga0068863_101134523 | Ga0068863_1011345232 | 109 |
| 252 | 3300005842 | Ga0068858_100322246 | Ga0068858_1003222462 | 109 |
| 253 | 3300005843 | Ga0068860_100128482 | Ga0068860_1001284823 | 109 |
| 254 | 3300005843 | Ga0068860_101231060 | Ga0068860_1012310601 | 109 |
| 255 | 3300005844 | Ga0068862_100017083 | Ga0068862_1000170833 | 109 |
| 256 | 3300005937 | Ga0081455_10524826 | Ga0081455_105248262 | 109 |
| 257 | 3300006038 | Ga0075365_10004268 | Ga0075365_100042688 | 109 |
| 258 | 3300006048 | Ga0075363_100011280 | Ga0075363_1000112803 | 109 |
| 259 | 3300006051 | Ga0075364_10027080 | Ga0075364_100270803 | 109 |
| 260 | 3300006051 | Ga0075364_10392574 | Ga0075364_103925742 | 109 |
| 261 | 3300006178 | Ga0075367_10134744 | Ga0075367_101347442 | 109 |
| 262 | 3300006881 | Ga0068865_100015784 | Ga0068865_1000157843 | 109 |
| 263 | 3300006931 | Ga0097620_101781395 | Ga0097620_1017813952 | 109 |
| 264 | 3300009094 | Ga0111539_10044614 | Ga0111539_100446148 | 109 |
| 265 | 3300009098 | Ga0105245_10042800 | Ga0105245_100428004 | 109 |
| 266 | 3300009148 | Ga0105243_10018797 | Ga0105243_100187976 | 109 |
| 267 | 3300009176 | Ga0105242_10968143 | Ga0105242_109681432 | 109 |
| 268 | 3300009551 | Ga0105238_10171646 | Ga0105238_101716462 | 109 |
| 269 | 3300009553 | Ga0105249_10629008 | Ga0105249_106290081 | 109 |
| 270 | 3300013296 | Ga0157374_10729583 | Ga0157374_107295832 | 109 |
| 271 | 3300013306 | Ga0163162_10257874 | Ga0163162_102578742 | 109 |
| 272 | 3300013307 | Ga0157372_10572197 | Ga0157372_105721972 | 109 |
| 273 | 3300014326 | Ga0157380_10139935 | Ga0157380_101399352 | 109 |
| 274 | 3300014745 | Ga0157377_10002909 | Ga0157377_1000290911 | 109 |
| 275 | 3300014968 | Ga0157379_10205732 | Ga0157379_102057322 | 109 |
| 276 | 3300025321 | Ga0207656_10040792 | Ga0207656_100407922 | 109 |
| 277 | 3300025899 | Ga0207642_10394536 | Ga0207642_103945362 | 109 |
| 278 | 3300025901 | Ga0207688_10010299 | Ga0207688_100102992 | 109 |
| 279 | 3300025904 | Ga0207647_10502343 | Ga0207647_105023431 | 109 |
| 280 | 3300025907 | Ga0207645_10080049 | Ga0207645_100800493 | 109 |
| 281 | 3300025909 | Ga0207705_10400598 | Ga0207705_104005982 | 109 |
| 282 | 3300025912 | Ga0207707_11247119 | Ga0207707_112471191 | 109 |
| 283 | 3300025917 | Ga0207660_10355449 | Ga0207660_103554492 | 109 |
| 284 | 3300025918 | Ga0207662_10075821 | Ga0207662_100758213 | 109 |
| 285 | 3300025919 | Ga0207657_10000895 | Ga0207657_100008958 | 109 |
| 286 | 3300025921 | Ga0207652_10226522 | Ga0207652_102265223 | 109 |
| 287 | 3300025923 | Ga0207681_10185136 | Ga0207681_101851362 | 109 |
| 288 | 3300025924 | Ga0207694_10139289 | Ga0207694_101392893 | 109 |
| 289 | 3300025925 | Ga0207650_10394434 | Ga0207650_103944342 | 109 |
| 290 | 3300025926 | Ga0207659_10100378 | Ga0207659_101003781 | 109 |
| 291 | 3300025927 | Ga0207687_10071643 | Ga0207687_100716432 | 109 |
| 292 | 3300025932 | Ga0207690_10013969 | Ga0207690_100139696 | 109 |
| 293 | 3300025933 | Ga0207706_10005227 | Ga0207706_100052278 | 109 |
| 294 | 3300025934 | Ga0207686_11089416 | Ga0207686_110894161 | 109 |
| 295 | 3300025935 | Ga0207709_10136361 | Ga0207709_101363613 | 109 |
| 296 | 3300025936 | Ga0207670_10470094 | Ga0207670_104700942 | 109 |
| 297 | 3300025937 | Ga0207669_10545829 | Ga0207669_105458291 | 109 |
| 298 | 3300025938 | Ga0207704_10008926 | Ga0207704_100089263 | 109 |
| 299 | 3300025940 | Ga0207691_10018193 | Ga0207691_100181935 | 109 |
| 300 | 3300025944 | Ga0207661_10332112 | Ga0207661_103321123 | 109 |
| 301 | 3300025945 | Ga0207679_10289241 | Ga0207679_102892412 | 109 |
| 302 | 3300025949 | Ga0207667_10099967 | Ga0207667_100999672 | 109 |
| 303 | 3300025960 | Ga0207651_10074933 | Ga0207651_100749332 | 109 |
| 304 | 3300025961 | Ga0207712_10446929 | Ga0207712_104469291 | 109 |
| 305 | 3300025972 | Ga0207668_10011738 | Ga0207668_100117385 | 109 |
| 306 | 3300026023 | Ga0207677_10042336 | Ga0207677_100423362 | 109 |
| 307 | 3300026035 | Ga0207703_11429211 | Ga0207703_114292111 | 109 |
| 308 | 3300026041 | Ga0207639_10008950 | Ga0207639_100089508 | 109 |
| 309 | 3300026067 | Ga0207678_10007063 | Ga0207678_1000706313 | 109 |
| 310 | 3300026075 | Ga0207708_10001040 | Ga0207708_100010409 | 109 |
| 311 | 3300026088 | Ga0207641_10432371 | Ga0207641_104323711 | 109 |
| 312 | 3300026089 | Ga0207648_10029476 | Ga0207648_100294765 | 109 |
| 313 | 3300026116 | Ga0207674_10088649 | Ga0207674_100886492 | 109 |
| 314 | 3300026118 | Ga0207675_100335474 | Ga0207675_1003354743 | 109 |
| 315 | 3300026121 | Ga0207683_10129353 | Ga0207683_101293532 | 109 |
| 316 | 3300026142 | Ga0207698_10028769 | Ga0207698_100287693 | 109 |
| 317 | 3300028380 | Ga0268265_10223962 | Ga0268265_102239623 | 109 |
| 318 | 3300028381 | Ga0268264_10473771 | Ga0268264_104737712 | 109 |
| 319 | 3300048903 | Ga0496100_0510723 | Ga0496100_0510723_483_818 | 109 |
| 320 | 3300048905 | Ga0496102_0041706 | Ga0496102_0041706_2135_2470 | 109 |
| 321 | 3300048905 | Ga0496102_0078416 | Ga0496102_0078416_2453_2806 | 109 |
| 322 | 3300048906 | Ga0496103_0378309 | Ga0496103_0378309_302_637 | 109 |
| 323 | 3300048909 | Ga0496106_0008110 | Ga0496106_0008110_3740_4075 | 109 |
| 324 | 3300048910 | Ga0496107_0055180 | Ga0496107_0055180_1924_2259 | 109 |
| 325 | 3300048911 | Ga0496108_0013024 | Ga0496108_0013024_1787_2122 | 109 |
| 326 | 3300048912 | Ga0496109_0003508 | Ga0496109_0003508_789_1124 | 109 |
| 327 | 3300048913 | Ga0496110_0023581 | Ga0496110_0023581_1082_1417 | 109 |
| 328 | 3300048916 | Ga0496113_0559065 | Ga0496113_0559065_493_828 | 109 |
| 329 | 3300050491 | nmdc:mga00v17_31399_c1 | nmdc:mga00v17_31399_c1_2136_2471 | 109 |
| 330 | 3300050491 | nmdc:mga00v17_415851_c1 | nmdc:mga00v17_415851_c1_366_704 | 109 |
| 331 | 3300050492 | nmdc:mga0yw44_5758_c1 | nmdc:mga0yw44_5758_c1_1877_2212 | 109 |
| 332 | 3300050511 | nmdc:mga08y16_42807_c1 | nmdc:mga08y16_42807_c1_3785_4120 | 109 |
| 333 | 3300005329 | Ga0070683_100132343 | Ga0070683_1001323434 | 111 |
| 334 | 3300005344 | Ga0070661_100000279 | Ga0070661_10000027924 | 111 |
| 335 | 3300005344 | Ga0070661_100724244 | Ga0070661_1007242442 | 111 |
| 336 | 3300005455 | Ga0070663_100082479 | Ga0070663_1000824793 | 111 |
| 337 | 3300005458 | Ga0070681_10235753 | Ga0070681_102357532 | 111 |
| 338 | 3300005530 | Ga0070679_100018595 | Ga0070679_1000185953 | 111 |
| 339 | 3300005535 | Ga0070684_100361092 | Ga0070684_1003610922 | 111 |
| 340 | 3300014969 | Ga0157376_10072594 | Ga0157376_100725942 | 111 |
| 341 | 3300020082 | Ga0206353_11846088 | Ga0206353_118460882 | 111 |
| 342 | 3300025912 | Ga0207707_10138975 | Ga0207707_101389753 | 111 |
| 343 | 3300025920 | Ga0207649_10000015 | Ga0207649_10000015154 | 111 |
| 344 | 3300025921 | Ga0207652_10001027 | Ga0207652_100010271 | 111 |
| 345 | 3300026067 | Ga0207678_10026150 | Ga0207678_100261504 | 111 |
| 346 | 3300049571 | Ga0501034_0091793 | Ga0501034_0091793_539_880 | 111 |
| 347 | 3300049571 | Ga0501034_0158767 | Ga0501034_0158767_1572_1910 | 111 |
| 348 | 3300049579 | Ga0501043_0291545 | Ga0501043_0291545_172_513 | 111 |
| 349 | 3300049579 | Ga0501043_0885003 | Ga0501043_0885003_84_422 | 111 |
| 350 | 3300049581 | Ga0501047_0237918 | Ga0501047_0237918_87_425 | 111 |
| 351 | 3300049581 | Ga0501047_0300887 | Ga0501047_0300887_1081_1422 | 111 |
| 352 | 3300049581 | Ga0501047_0864228 | Ga0501047_0864228_256_600 | 111 |
| 353 | 3300049585 | Ga0501069_0343152 | Ga0501069_0343152_412_753 | 111 |
| 354 | 3300049586 | Ga0501070_0105763 | Ga0501070_0105763_1499_1843 | 111 |
| 355 | 3300049586 | Ga0501070_0309283 | Ga0501070_0309283_434_775 | 111 |
| 356 | 3300049587 | Ga0501071_0044828 | Ga0501071_0044828_582_923 | 111 |
| 357 | 3300049590 | Ga0501074_0020387 | Ga0501074_0020387_3189_3533 | 111 |
| 358 | 3300049741 | Ga0501079_0035824 | Ga0501079_0035824_827_1168 | 111 |
| 359 | 3300049742 | Ga0501080_0038591 | Ga0501080_0038591_2489_2830 | 111 |
| 360 | 3300049742 | Ga0501080_1819758 | Ga0501080_1819758_31_369 | 111 |
| 361 | 3300049744 | Ga0501083_0056209 | Ga0501083_0056209_186_527 | 111 |
| 362 | 3300049822 | Ga0501035_1110521 | Ga0501035_1110521_261_605 | 111 |
| 363 | 3300049823 | Ga0501044_0121114 | Ga0501044_0121114_2133_2474 | 111 |
| 364 | 3300049823 | Ga0501044_0309804 | Ga0501044_0309804_1158_1496 | 111 |
| 365 | 3300049823 | Ga0501044_0395448 | Ga0501044_0395448_207_545 | 111 |
| 366 | 3300005329 | Ga0070683_100012150 | Ga0070683_1000121507 | 112 |
| 367 | 3300005335 | Ga0070666_10010680 | Ga0070666_100106803 | 112 |
| 368 | 3300005355 | Ga0070671_101707048 | Ga0070671_1017070481 | 112 |
| 369 | 3300005367 | Ga0070667_100007228 | Ga0070667_1000072284 | 112 |
| 370 | 3300005434 | Ga0070709_10749187 | Ga0070709_107491872 | 112 |
| 371 | 3300005535 | Ga0070684_100000542 | Ga0070684_10000054211 | 112 |
| 372 | 3300005548 | Ga0070665_100175868 | Ga0070665_1001758683 | 112 |
| 373 | 3300005843 | Ga0068860_100699832 | Ga0068860_1006998322 | 112 |
| 374 | 3300005937 | Ga0081455_10015052 | Ga0081455_100150524 | 112 |
| 375 | 3300009545 | Ga0105237_12336532 | Ga0105237_123365321 | 112 |
| 376 | 3300009551 | Ga0105238_10136897 | Ga0105238_101368973 | 112 |
| 377 | 3300010375 | Ga0105239_10195215 | Ga0105239_101952153 | 112 |
| 378 | 3300013306 | Ga0163162_10829343 | Ga0163162_108293432 | 112 |
| 379 | 3300014325 | Ga0163163_10265847 | Ga0163163_102658472 | 112 |
| 380 | 3300025903 | Ga0207680_10011203 | Ga0207680_100112033 | 112 |
| 381 | 3300025924 | Ga0207694_10466642 | Ga0207694_104666421 | 112 |
| 382 | 3300025931 | Ga0207644_11400983 | Ga0207644_114009832 | 112 |
| 383 | 3300025944 | Ga0207661_10007679 | Ga0207661_100076794 | 112 |
| 384 | 3300025986 | Ga0207658_10003057 | Ga0207658_100030575 | 112 |
| 385 | 3300026035 | Ga0207703_10467639 | Ga0207703_104676392 | 112 |
| 386 | 3300026088 | Ga0207641_10858440 | Ga0207641_108584402 | 112 |
| 387 | 3300026142 | Ga0207698_10650956 | Ga0207698_106509562 | 112 |
| 388 | 3300028379 | Ga0268266_10000781 | Ga0268266_1000078126 | 112 |
| 389 | 3300028379 | Ga0268266_10167561 | Ga0268266_101675612 | 112 |
| 390 | 3300046535 | Ga0495586_0093922 | Ga0495586_0093922_1296_1634 | 112 |
| 391 | 3300046539 | Ga0495621_0000491 | Ga0495621_0000491_8582_8920 | 112 |
| 392 | 3300048905 | Ga0496102_0136538 | Ga0496102_0136538_361_711 | 112 |
| 393 | 3300048905 | Ga0496102_0676220 | Ga0496102_0676220_552_890 | 112 |
| 394 | 3300048906 | Ga0496103_0073809 | Ga0496103_0073809_1044_1394 | 112 |
| 395 | 3300048906 | Ga0496103_0789426 | Ga0496103_0789426_171_518 | 112 |
| 396 | 3300048907 | Ga0496104_0106136 | Ga0496104_0106136_686_1033 | 112 |
| 397 | 3300048908 | Ga0496105_0088315 | Ga0496105_0088315_773_1120 | 112 |
| 398 | 3300048910 | Ga0496107_0363081 | Ga0496107_0363081_317_664 | 112 |
| 399 | 3300048911 | Ga0496108_0509956 | Ga0496108_0509956_94_441 | 112 |
| 400 | 3300048913 | Ga0496110_0316736 | Ga0496110_0316736_1015_1356 | 112 |
| 401 | 3300048914 | Ga0496111_0359217 | Ga0496111_0359217_592_933 | 112 |
| 402 | 3300048915 | Ga0496112_0000002 | Ga0496112_0000002_21642_21980 | 112 |
| 403 | 3300048919 | Ga0496116_0000120 | Ga0496116_0000120_42490_42840 | 112 |
| 404 | 3300048920 | Ga0496117_0003475 | Ga0496117_0003475_3182_3532 | 112 |
| 405 | 3300048921 | Ga0496118_0001146 | Ga0496118_0001146_15771_16121 | 112 |
| 406 | 3300048921 | Ga0496118_0128472 | Ga0496118_0128472_728_1078 | 112 |
| 407 | 3300048921 | Ga0496118_0283129 | Ga0496118_0283129_103_453 | 112 |
| 408 | 3300048922 | Ga0496119_0003031 | Ga0496119_0003031_13605_13952 | 112 |
| 409 | 3300048922 | Ga0496119_0008829 | Ga0496119_0008829_3824_4174 | 112 |
| 410 | 3300048924 | Ga0496121_0010929 | Ga0496121_0010929_9273_9620 | 112 |
| 411 | 3300048924 | Ga0496121_0022712 | Ga0496121_0022712_79_429 | 112 |
| 412 | 3300048927 | Ga0496124_0150244 | Ga0496124_0150244_627_974 | 112 |
| 413 | 3300048927 | Ga0496124_0371783 | Ga0496124_0371783_608_955 | 112 |
| 414 | 3300048928 | Ga0496125_0082356 | Ga0496125_0082356_2032_2382 | 112 |
| 415 | 3300048928 | Ga0496125_0183625 | Ga0496125_0183625_223_570 | 112 |
| 416 | 3300049568 | Ga0501031_0304132 | Ga0501031_0304132_59_406 | 112 |
| 417 | 3300049568 | Ga0501031_0550248 | Ga0501031_0550248_364_711 | 112 |
| 418 | 3300049570 | Ga0501033_0045821 | Ga0501033_0045821_994_1341 | 112 |
| 419 | 3300049571 | Ga0501034_0177639 | Ga0501034_0177639_728_1075 | 112 |
| 420 | 3300049571 | Ga0501034_0411408 | Ga0501034_0411408_34_381 | 112 |
| 421 | 3300049574 | Ga0501038_0055915 | Ga0501038_0055915_1548_1895 | 112 |
| 422 | 3300049575 | Ga0501039_0538583 | Ga0501039_0538583_477_824 | 112 |
| 423 | 3300049576 | Ga0501040_0138554 | Ga0501040_0138554_144_491 | 112 |
| 424 | 3300049579 | Ga0501043_0089573 | Ga0501043_0089573_1573_1920 | 112 |
| 425 | 3300049579 | Ga0501043_0432149 | Ga0501043_0432149_582_929 | 112 |
| 426 | 3300049580 | Ga0501046_0001831 | Ga0501046_0001831_17198_17545 | 112 |
| 427 | 3300049580 | Ga0501046_1176579 | Ga0501046_1176579_13_360 | 112 |
| 428 | 3300049581 | Ga0501047_0023553 | Ga0501047_0023553_3271_3618 | 112 |
| 429 | 3300049581 | Ga0501047_0039258 | Ga0501047_0039258_3271_3618 | 112 |
| 430 | 3300049582 | Ga0501048_0068919 | Ga0501048_0068919_140_487 | 112 |
| 431 | 3300049582 | Ga0501048_0487639 | Ga0501048_0487639_504_851 | 112 |
| 432 | 3300049584 | Ga0501068_0111008 | Ga0501068_0111008_319_666 | 112 |
| 433 | 3300049585 | Ga0501069_0509205 | Ga0501069_0509205_168_515 | 112 |
| 434 | 3300049586 | Ga0501070_0021704 | Ga0501070_0021704_1993_2340 | 112 |
| 435 | 3300049586 | Ga0501070_0199725 | Ga0501070_0199725_779_1126 | 112 |
| 436 | 3300049589 | Ga0501073_0135155 | Ga0501073_0135155_1289_1636 | 112 |
| 437 | 3300049590 | Ga0501074_0417034 | Ga0501074_0417034_504_851 | 112 |
| 438 | 3300049592 | Ga0501076_0114901 | Ga0501076_0114901_1652_1996 | 112 |
| 439 | 3300049742 | Ga0501080_0261243 | Ga0501080_0261243_271_621 | 112 |
| 440 | 3300049742 | Ga0501080_0420653 | Ga0501080_0420653_40_387 | 112 |
| 441 | 3300049744 | Ga0501083_0082419 | Ga0501083_0082419_1698_2045 | 112 |
| 442 | 3300049822 | Ga0501035_0028315 | Ga0501035_0028315_995_1342 | 112 |
| 443 | 3300049822 | Ga0501035_0048103 | Ga0501035_0048103_2459_2806 | 112 |
| 444 | 3300049823 | Ga0501044_0035974 | Ga0501044_0035974_3774_4121 | 112 |
| 445 | 3300049823 | Ga0501044_0091449 | Ga0501044_0091449_995_1342 | 112 |
| 446 | 3300060353 | Ga0501082_0110513 | Ga0501082_0110513_1936_2283 | 112 |
| 447 | 3300001977 | JGI24746J21847_1000082 | JGI24746J21847_10000823 | 113 |
| 448 | 3300005356 | Ga0070674_101297920 | Ga0070674_1012979201 | 113 |
| 449 | 3300005439 | Ga0070711_100001230 | Ga0070711_10000123011 | 113 |
| 450 | 3300005441 | Ga0070700_100068842 | Ga0070700_1000688423 | 113 |
| 451 | 3300005457 | Ga0070662_101176802 | Ga0070662_1011768022 | 113 |
| 452 | 3300005535 | Ga0070684_100390520 | Ga0070684_1003905202 | 113 |
| 453 | 3300006881 | Ga0068865_102023360 | Ga0068865_1020233602 | 113 |
| 454 | 3300009094 | Ga0111539_12142115 | Ga0111539_121421152 | 113 |
| 455 | 3300025916 | Ga0207663_10003933 | Ga0207663_100039335 | 113 |
| 456 | 3300026078 | Ga0207702_10457589 | Ga0207702_104575892 | 113 |
| 457 | 3300046516 | Ga0495628_0142305 | Ga0495628_0142305_923_1264 | 113 |
| 458 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_277757_278098 | 113 |
| 459 | 3300046809 | Ga0495600_0278797 | Ga0495600_0278797_684_1025 | 113 |
| 460 | 3300047472 | Ga0495686_0252841 | Ga0495686_0252841_471_821 | 113 |
| 461 | 3300048905 | Ga0496102_1608250 | Ga0496102_1608250_196_540 | 113 |
| 462 | 3300048907 | Ga0496104_0342447 | Ga0496104_0342447_781_1122 | 113 |
| 463 | 3300048908 | Ga0496105_0156207 | Ga0496105_0156207_535_876 | 113 |
| 464 | 3300048913 | Ga0496110_0014143 | Ga0496110_0014143_5254_5595 | 113 |
| 465 | 3300048913 | Ga0496110_1524238 | Ga0496110_1524238_134_478 | 113 |
| 466 | 3300048914 | Ga0496111_0016446 | Ga0496111_0016446_3148_3489 | 113 |
| 467 | 3300048914 | Ga0496111_1266739 | Ga0496111_1266739_138_482 | 113 |
| 468 | 3300048915 | Ga0496112_0890495 | Ga0496112_0890495_322_663 | 113 |
| 469 | 3300048927 | Ga0496124_0726129 | Ga0496124_0726129_29_370 | 113 |
| 470 | 3300049591 | Ga0501075_0001204 | Ga0501075_0001204_8662_9003 | 113 |
| 471 | 3300050507 | nmdc:mga05p37_1337194_c1 | nmdc:mga05p37_1337194_c1_309_653 | 113 |
| 472 | 3300050511 | nmdc:mga08y16_1471105_c1 | nmdc:mga08y16_1471105_c1_188_529 | 113 |
| 473 | 3300053077 | Ga0495601_0100172 | Ga0495601_0100172_592_933 | 113 |
| 474 | 3300053078 | Ga0495612_0001837 | Ga0495612_0001837_1602_1943 | 113 |
| 475 | 3300053084 | Ga0495595_0506958 | Ga0495595_0506958_181_522 | 113 |
| 476 | 3300005341 | Ga0070691_10000046 | Ga0070691_1000004622 | 114 |
| 477 | 3300005356 | Ga0070674_100000074 | Ga0070674_1000000748 | 114 |
| 478 | 3300005441 | Ga0070700_100291468 | Ga0070700_1002914682 | 114 |
| 479 | 3300005545 | Ga0070695_100037702 | Ga0070695_1000377022 | 114 |
| 480 | 3300005718 | Ga0068866_10000349 | Ga0068866_100003498 | 114 |
| 481 | 3300006852 | Ga0075433_10012873 | Ga0075433_100128733 | 114 |
| 482 | 3300009148 | Ga0105243_10161333 | Ga0105243_101613332 | 114 |
| 483 | 3300009176 | Ga0105242_10767097 | Ga0105242_107670972 | 114 |
| 484 | 3300014325 | Ga0163163_11502968 | Ga0163163_115029682 | 114 |
| 485 | 3300014326 | Ga0157380_10000448 | Ga0157380_1000044823 | 114 |
| 486 | 3300017792 | Ga0163161_10000240 | Ga0163161_1000024024 | 114 |
| 487 | 3300020082 | Ga0206353_12016716 | Ga0206353_120167162 | 114 |
| 488 | 3300025885 | Ga0207653_10223232 | Ga0207653_102232322 | 114 |
| 489 | 3300025899 | Ga0207642_10000109 | Ga0207642_1000010918 | 114 |
| 490 | 3300025934 | Ga0207686_10455476 | Ga0207686_104554762 | 114 |
| 491 | 3300025935 | Ga0207709_10145526 | Ga0207709_101455262 | 114 |
| 492 | 3300025937 | Ga0207669_10000002 | Ga0207669_100000028 | 114 |
| 493 | 3300026023 | Ga0207677_10000551 | Ga0207677_1000055112 | 114 |
| 494 | 3300026075 | Ga0207708_10367025 | Ga0207708_103670252 | 114 |
| 495 | 3300030521 | Ga0307511_10127344 | Ga0307511_101273443 | 114 |
| 496 | 3300046455 | Ga0495603_0004246 | Ga0495603_0004246_3431_3775 | 114 |
| 497 | 3300046463 | Ga0495653_0122373 | Ga0495653_0122373_852_1196 | 114 |
| 498 | 3300046511 | Ga0495608_0000346 | Ga0495608_0000346_29756_30100 | 114 |
| 499 | 3300046517 | Ga0495630_0016660 | Ga0495630_0016660_2208_2552 | 114 |
| 500 | 3300046536 | Ga0495587_0006597 | Ga0495587_0006597_4829_5173 | 114 |
| 501 | 3300046558 | Ga0495633_0040611 | Ga0495633_0040611_336_680 | 114 |
| 502 | 3300046615 | Ga0495656_0000204 | Ga0495656_0000204_15918_16262 | 114 |
| 503 | 3300046675 | Ga0495657_0011081 | Ga0495657_0011081_2260_2604 | 114 |
| 504 | 3300046681 | Ga0495647_0126280 | Ga0495647_0126280_202_546 | 114 |
| 505 | 3300046683 | Ga0495658_0409302 | Ga0495658_0409302_76_420 | 114 |
| 506 | 3300046684 | Ga0495669_0380223 | Ga0495669_0380223_85_429 | 114 |
| 507 | 3300046689 | Ga0495613_0002052 | Ga0495613_0002052_3979_4323 | 114 |
| 508 | 3300046691 | Ga0495670_0210453 | Ga0495670_0210453_526_870 | 114 |
| 509 | 3300048911 | Ga0496108_0007240 | Ga0496108_0007240_4624_4968 | 114 |
| 510 | 3300048916 | Ga0496113_0003337 | Ga0496113_0003337_2988_3332 | 114 |
| 511 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_341321_341665 | 114 |
| 512 | 3300048918 | Ga0496115_0000027 | Ga0496115_0000027_67608_67952 | 114 |
| 513 | 3300049578 | Ga0501042_0623728 | Ga0501042_0623728_324_668 | 114 |
| 514 | 3300049586 | Ga0501070_0239231 | Ga0501070_0239231_710_1054 | 114 |
| 515 | 3300050515 | nmdc:mga0a205_4_c1 | nmdc:mga0a205_4_c1_18122_18466 | 114 |
| 516 | 3300050515 | nmdc:mga0a205_507_c1 | nmdc:mga0a205_507_c1_8194_8538 | 114 |
| 517 | 3300053084 | Ga0495595_0000148 | Ga0495595_0000148_8504_8848 | 114 |
| 518 | 3300053085 | Ga0495619_0000177 | Ga0495619_0000177_7349_7693 | 114 |
| 519 | 3300002239 | JGI24034J26672_10000100 | JGI24034J26672_1000010016 | 115 |
| 520 | 3300005333 | Ga0070677_10000515 | Ga0070677_100005155 | 115 |
| 521 | 3300005334 | Ga0068869_100175188 | Ga0068869_1001751883 | 115 |
| 522 | 3300005455 | Ga0070663_101012510 | Ga0070663_1010125102 | 115 |
| 523 | 3300005544 | Ga0070686_100268702 | Ga0070686_1002687023 | 115 |
| 524 | 3300005842 | Ga0068858_100000017 | Ga0068858_100000017101 | 115 |
| 525 | 3300006173 | Ga0070716_100059536 | Ga0070716_1000595363 | 115 |
| 526 | 3300009176 | Ga0105242_10044641 | Ga0105242_100446414 | 115 |
| 527 | 3300013104 | Ga0157370_10007930 | Ga0157370_1000793012 | 115 |
| 528 | 3300013308 | Ga0157375_10000368 | Ga0157375_1000036839 | 115 |
| 529 | 3300025893 | Ga0207682_10001663 | Ga0207682_100016636 | 115 |
| 530 | 3300025925 | Ga0207650_10952763 | Ga0207650_109527632 | 115 |
| 531 | 3300025927 | Ga0207687_10000094 | Ga0207687_1000009431 | 115 |
| 532 | 3300025934 | Ga0207686_10012305 | Ga0207686_100123055 | 115 |
| 533 | 3300025939 | Ga0207665_10137458 | Ga0207665_101374583 | 115 |
| 534 | 3300025942 | Ga0207689_10236944 | Ga0207689_102369443 | 115 |
| 535 | 3300026035 | Ga0207703_10000030 | Ga0207703_1000003099 | 115 |
| 536 | 3300035725 | Ga0373947_0467276 | Ga0373947_0467276_338_685 | 115 |
| 537 | 3300046463 | Ga0495653_0035156 | Ga0495653_0035156_1138_1485 | 115 |
| 538 | 3300046476 | Ga0495662_0262372 | Ga0495662_0262372_242_589 | 115 |
| 539 | 3300046516 | Ga0495628_0116471 | Ga0495628_0116471_1444_1791 | 115 |
| 540 | 3300046517 | Ga0495630_0747779 | Ga0495630_0747779_193_540 | 115 |
| 541 | 3300046535 | Ga0495586_0000359 | Ga0495586_0000359_25528_25875 | 115 |
| 542 | 3300046559 | Ga0495667_0070832 | Ga0495667_0070832_650_997 | 115 |
| 543 | 3300046642 | Ga0495634_0000558 | Ga0495634_0000558_25971_26318 | 115 |
| 544 | 3300046679 | Ga0495623_0159064 | Ga0495623_0159064_234_581 | 115 |
| 545 | 3300046681 | Ga0495647_0000028 | Ga0495647_0000028_32732_33079 | 115 |
| 546 | 3300047471 | Ga0495684_0088553 | Ga0495684_0088553_1947_2294 | 115 |
| 547 | 3300048908 | Ga0496105_0359162 | Ga0496105_0359162_293_643 | 115 |
| 548 | 3300048911 | Ga0496108_0000413 | Ga0496108_0000413_18234_18581 | 115 |
| 549 | 3300048912 | Ga0496109_0000333 | Ga0496109_0000333_12966_13313 | 115 |
| 550 | 3300049824 | Ga0501045_0480926 | Ga0501045_0480926_64_411 | 115 |
| 551 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_275506_275853 | 115 |
| 552 | 3300001979 | JGI24740J21852_10002425 | JGI24740J21852_100024253 | 116 |
| 553 | 3300003203 | JGI25406J46586_10071415 | JGI25406J46586_100714152 | 116 |
| 554 | 3300005329 | Ga0070683_100127418 | Ga0070683_1001274184 | 116 |
| 555 | 3300005338 | Ga0068868_100003592 | Ga0068868_10000359211 | 116 |
| 556 | 3300005364 | Ga0070673_101771310 | Ga0070673_1017713101 | 116 |
| 557 | 3300005365 | Ga0070688_100000211 | Ga0070688_10000021112 | 116 |
| 558 | 3300005466 | Ga0070685_10000540 | Ga0070685_100005406 | 116 |
| 559 | 3300005535 | Ga0070684_100585640 | Ga0070684_1005856402 | 116 |
| 560 | 3300005564 | Ga0070664_100048993 | Ga0070664_1000489933 | 116 |
| 561 | 3300005840 | Ga0068870_10139754 | Ga0068870_101397543 | 116 |
| 562 | 3300005985 | Ga0081539_10002029 | Ga0081539_1000202926 | 116 |
| 563 | 3300007076 | Ga0075435_100504652 | Ga0075435_1005046522 | 116 |
| 564 | 3300009101 | Ga0105247_10000629 | Ga0105247_1000062912 | 116 |
| 565 | 3300009148 | Ga0105243_10060666 | Ga0105243_100606663 | 116 |
| 566 | 3300009176 | Ga0105242_10000139 | Ga0105242_1000013925 | 116 |
| 567 | 3300025900 | Ga0207710_10000096 | Ga0207710_1000009637 | 116 |
| 568 | 3300025908 | Ga0207643_10088116 | Ga0207643_100881162 | 116 |
| 569 | 3300025934 | Ga0207686_10000242 | Ga0207686_1000024225 | 116 |
| 570 | 3300025935 | Ga0207709_10005413 | Ga0207709_100054133 | 116 |
| 571 | 3300025944 | Ga0207661_10090051 | Ga0207661_100900515 | 116 |
| 572 | 3300025945 | Ga0207679_10105381 | Ga0207679_101053814 | 116 |
| 573 | 3300026023 | Ga0207677_10000817 | Ga0207677_1000081719 | 116 |
| 574 | 3300028379 | Ga0268266_10025581 | Ga0268266_100255813 | 116 |
| 575 | 3300031691 | Ga0316579_10617453 | Ga0316579_106174531 | 116 |
| 576 | 3300046460 | Ga0495638_0034168 | Ga0495638_0034168_536_886 | 116 |
| 577 | 3300046512 | Ga0495610_0245770 | Ga0495610_0245770_162_512 | 116 |
| 578 | 3300046514 | Ga0495618_0456444 | Ga0495618_0456444_250_600 | 116 |
| 579 | 3300046515 | Ga0495620_0026815 | Ga0495620_0026815_313_663 | 116 |
| 580 | 3300046536 | Ga0495587_0371127 | Ga0495587_0371127_45_395 | 116 |
| 581 | 3300046660 | Ga0495625_0000395 | Ga0495625_0000395_2678_3028 | 116 |
| 582 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_430789_431139 | 116 |
| 583 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_430789_431139 | 116 |
| 584 | 3300048922 | Ga0496119_0024921 | Ga0496119_0024921_911_1261 | 116 |
| 585 | 3300048923 | Ga0496120_0026562 | Ga0496120_0026562_2678_3028 | 116 |
| 586 | 3300050513 | nmdc:mga0rr50_340539_c1 | nmdc:mga0rr50_340539_c1_352_702 | 116 |
| 587 | 3300000546 | LJNas_1026590 | LJNas_10265902 | 117 |
| 588 | 3300003659 | JGI25404J52841_10093533 | JGI25404J52841_100935331 | 117 |
| 589 | 3300005327 | Ga0070658_10173125 | Ga0070658_101731253 | 117 |
| 590 | 3300005329 | Ga0070683_100001949 | Ga0070683_10000194916 | 117 |
| 591 | 3300005330 | Ga0070690_100264005 | Ga0070690_1002640053 | 117 |
| 592 | 3300005335 | Ga0070666_10010679 | Ga0070666_100106795 | 117 |
| 593 | 3300005337 | Ga0070682_100000061 | Ga0070682_1000000614 | 117 |
| 594 | 3300005337 | Ga0070682_101349262 | Ga0070682_1013492621 | 117 |
| 595 | 3300005339 | Ga0070660_100539046 | Ga0070660_1005390462 | 117 |
| 596 | 3300005340 | Ga0070689_100090411 | Ga0070689_1000904112 | 117 |
| 597 | 3300005341 | Ga0070691_10085429 | Ga0070691_100854293 | 117 |
| 598 | 3300005343 | Ga0070687_100299903 | Ga0070687_1002999031 | 117 |
| 599 | 3300005345 | Ga0070692_10309891 | Ga0070692_103098912 | 117 |
| 600 | 3300005354 | Ga0070675_100000069 | Ga0070675_10000006927 | 117 |
| 601 | 3300005365 | Ga0070688_100006275 | Ga0070688_1000062753 | 117 |
| 602 | 3300005365 | Ga0070688_100370127 | Ga0070688_1003701272 | 117 |
| 603 | 3300005366 | Ga0070659_100003627 | Ga0070659_1000036275 | 117 |
| 604 | 3300005367 | Ga0070667_100073843 | Ga0070667_1000738431 | 117 |
| 605 | 3300005367 | Ga0070667_100966986 | Ga0070667_1009669862 | 117 |
| 606 | 3300005435 | Ga0070714_100037764 | Ga0070714_1000377644 | 117 |
| 607 | 3300005436 | Ga0070713_100000023 | Ga0070713_10000002338 | 117 |
| 608 | 3300005438 | Ga0070701_10447142 | Ga0070701_104471422 | 117 |
| 609 | 3300005456 | Ga0070678_100622074 | Ga0070678_1006220742 | 117 |
| 610 | 3300005459 | Ga0068867_100855966 | Ga0068867_1008559662 | 117 |
| 611 | 3300005466 | Ga0070685_10000032 | Ga0070685_1000003265 | 117 |
| 612 | 3300005466 | Ga0070685_10068347 | Ga0070685_100683472 | 117 |
| 613 | 3300005535 | Ga0070684_100627573 | Ga0070684_1006275733 | 117 |
| 614 | 3300005535 | Ga0070684_101901207 | Ga0070684_1019012071 | 117 |
| 615 | 3300005539 | Ga0068853_100370538 | Ga0068853_1003705382 | 117 |
| 616 | 3300005543 | Ga0070672_100000005 | Ga0070672_10000000511 | 117 |
| 617 | 3300005544 | Ga0070686_101298358 | Ga0070686_1012983582 | 117 |
| 618 | 3300005547 | Ga0070693_101286222 | Ga0070693_1012862221 | 117 |
| 619 | 3300005548 | Ga0070665_100001182 | Ga0070665_10000118223 | 117 |
| 620 | 3300005548 | Ga0070665_100965378 | Ga0070665_1009653782 | 117 |
| 621 | 3300005577 | Ga0068857_100099628 | Ga0068857_1000996284 | 117 |
| 622 | 3300005577 | Ga0068857_100901832 | Ga0068857_1009018322 | 117 |
| 623 | 3300005578 | Ga0068854_100000094 | Ga0068854_10000009429 | 117 |
| 624 | 3300005614 | Ga0068856_100001548 | Ga0068856_10000154822 | 117 |
| 625 | 3300005614 | Ga0068856_100014086 | Ga0068856_1000140868 | 117 |
| 626 | 3300005616 | Ga0068852_100000595 | Ga0068852_10000059525 | 117 |
| 627 | 3300005719 | Ga0068861_100429499 | Ga0068861_1004294993 | 117 |
| 628 | 3300005719 | Ga0068861_100713821 | Ga0068861_1007138211 | 117 |
| 629 | 3300005834 | Ga0068851_10009469 | Ga0068851_100094695 | 117 |
| 630 | 3300005834 | Ga0068851_10021879 | Ga0068851_100218795 | 117 |
| 631 | 3300005983 | Ga0081540_1000046 | Ga0081540_100004663 | 117 |
| 632 | 3300006163 | Ga0070715_10104200 | Ga0070715_101042002 | 117 |
| 633 | 3300006175 | Ga0070712_100004870 | Ga0070712_10000487011 | 117 |
| 634 | 3300006881 | Ga0068865_100000293 | Ga0068865_10000029312 | 117 |
| 635 | 3300009098 | Ga0105245_10000249 | Ga0105245_1000024931 | 117 |
| 636 | 3300009098 | Ga0105245_10001943 | Ga0105245_100019433 | 117 |
| 637 | 3300009174 | Ga0105241_10165675 | Ga0105241_101656753 | 117 |
| 638 | 3300009177 | Ga0105248_10000017 | Ga0105248_10000017188 | 117 |
| 639 | 3300009177 | Ga0105248_11539962 | Ga0105248_115399622 | 117 |
| 640 | 3300010375 | Ga0105239_10092973 | Ga0105239_100929735 | 117 |
| 641 | 3300013102 | Ga0157371_10005742 | Ga0157371_100057422 | 117 |
| 642 | 3300013104 | Ga0157370_10070465 | Ga0157370_100704653 | 117 |
| 643 | 3300013105 | Ga0157369_10000105 | Ga0157369_10000105120 | 117 |
| 644 | 3300013296 | Ga0157374_10899664 | Ga0157374_108996641 | 117 |
| 645 | 3300013297 | Ga0157378_10035367 | Ga0157378_100353674 | 117 |
| 646 | 3300013306 | Ga0163162_11205029 | Ga0163162_112050292 | 117 |
| 647 | 3300013307 | Ga0157372_10000556 | Ga0157372_1000055613 | 117 |
| 648 | 3300013308 | Ga0157375_10007785 | Ga0157375_1000778512 | 117 |
| 649 | 3300013308 | Ga0157375_10456179 | Ga0157375_104561791 | 117 |
| 650 | 3300014745 | Ga0157377_10697283 | Ga0157377_106972832 | 117 |
| 651 | 3300014968 | Ga0157379_12027983 | Ga0157379_120279831 | 117 |
| 652 | 3300017792 | Ga0163161_10093151 | Ga0163161_100931515 | 117 |
| 653 | 3300025321 | Ga0207656_10000372 | Ga0207656_1000037213 | 117 |
| 654 | 3300025321 | Ga0207656_10013051 | Ga0207656_100130512 | 117 |
| 655 | 3300025903 | Ga0207680_10037190 | Ga0207680_100371904 | 117 |
| 656 | 3300025905 | Ga0207685_10431402 | Ga0207685_104314021 | 117 |
| 657 | 3300025909 | Ga0207705_10100639 | Ga0207705_101006393 | 117 |
| 658 | 3300025911 | Ga0207654_10156486 | Ga0207654_101564861 | 117 |
| 659 | 3300025915 | Ga0207693_10009775 | Ga0207693_100097752 | 117 |
| 660 | 3300025919 | Ga0207657_10131398 | Ga0207657_101313982 | 117 |
| 661 | 3300025926 | Ga0207659_10000126 | Ga0207659_1000012624 | 117 |
| 662 | 3300025927 | Ga0207687_10000106 | Ga0207687_1000010631 | 117 |
| 663 | 3300025927 | Ga0207687_10000211 | Ga0207687_1000021129 | 117 |
| 664 | 3300025928 | Ga0207700_10000003 | Ga0207700_1000000338 | 117 |
| 665 | 3300025929 | Ga0207664_10031461 | Ga0207664_100314613 | 117 |
| 666 | 3300025932 | Ga0207690_10002156 | Ga0207690_100021566 | 117 |
| 667 | 3300025936 | Ga0207670_10054052 | Ga0207670_100540525 | 117 |
| 668 | 3300025938 | Ga0207704_10000018 | Ga0207704_1000001834 | 117 |
| 669 | 3300025938 | Ga0207704_10234165 | Ga0207704_102341652 | 117 |
| 670 | 3300025940 | Ga0207691_10000028 | Ga0207691_10000028119 | 117 |
| 671 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011235 | 117 |
| 672 | 3300025941 | Ga0207711_11029397 | Ga0207711_110293972 | 117 |
| 673 | 3300025944 | Ga0207661_10001988 | Ga0207661_100019884 | 117 |
| 674 | 3300025972 | Ga0207668_10245003 | Ga0207668_102450033 | 117 |
| 675 | 3300025981 | Ga0207640_10000077 | Ga0207640_1000007755 | 117 |
| 676 | 3300025986 | Ga0207658_10055754 | Ga0207658_100557542 | 117 |
| 677 | 3300025986 | Ga0207658_10249685 | Ga0207658_102496853 | 117 |
| 678 | 3300026041 | Ga0207639_10035932 | Ga0207639_100359322 | 117 |
| 679 | 3300026041 | Ga0207639_10125273 | Ga0207639_101252732 | 117 |
| 680 | 3300026067 | Ga0207678_10527404 | Ga0207678_105274042 | 117 |
| 681 | 3300026078 | Ga0207702_10000534 | Ga0207702_1000053422 | 117 |
| 682 | 3300026078 | Ga0207702_10046394 | Ga0207702_100463942 | 117 |
| 683 | 3300026089 | Ga0207648_11047191 | Ga0207648_110471912 | 117 |
| 684 | 3300026116 | Ga0207674_10331307 | Ga0207674_103313072 | 117 |
| 685 | 3300026116 | Ga0207674_10446657 | Ga0207674_104466573 | 117 |
| 686 | 3300026118 | Ga0207675_100624007 | Ga0207675_1006240072 | 117 |
| 687 | 3300026118 | Ga0207675_100772862 | Ga0207675_1007728623 | 117 |
| 688 | 3300026121 | Ga0207683_10013190 | Ga0207683_100131907 | 117 |
| 689 | 3300026142 | Ga0207698_10000450 | Ga0207698_100004504 | 117 |
| 690 | 3300026142 | Ga0207698_10018467 | Ga0207698_100184671 | 117 |
| 691 | 3300028379 | Ga0268266_10001302 | Ga0268266_1000130214 | 117 |
| 692 | 3300028379 | Ga0268266_12279305 | Ga0268266_122793052 | 117 |
| 693 | 3300028563 | Ga0265319_1000010 | Ga0265319_1000010196 | 117 |
| 694 | 3300028577 | Ga0265318_10057725 | Ga0265318_100577252 | 117 |
| 695 | 3300028800 | Ga0265338_10000051 | Ga0265338_1000005190 | 117 |
| 696 | 3300031238 | Ga0265332_10050960 | Ga0265332_100509602 | 117 |
| 697 | 3300031240 | Ga0265320_10469816 | Ga0265320_104698162 | 117 |
| 698 | 3300031241 | Ga0265325_10024230 | Ga0265325_100242303 | 117 |
| 699 | 3300031250 | Ga0265331_10034893 | Ga0265331_100348934 | 117 |
| 700 | 3300031251 | Ga0265327_10206608 | Ga0265327_102066082 | 117 |
| 701 | 3300031344 | Ga0265316_10239578 | Ga0265316_102395783 | 117 |
| 702 | 3300031456 | Ga0307513_10771902 | Ga0307513_107719022 | 117 |
| 703 | 3300031712 | Ga0265342_10135058 | Ga0265342_101350582 | 117 |
| 704 | 3300032126 | Ga0307415_100019193 | Ga0307415_1000191932 | 117 |
| 705 | 3300041486 | Ga0451807_1046215 | Ga0451807_1046215_85_438 | 117 |
| 706 | 3300041496 | Ga0451839_1259115 | Ga0451839_1259115_293_646 | 117 |
| 707 | 3300041512 | Ga0451853_2362759 | Ga0451853_2362759_119_472 | 117 |
| 708 | 3300045836 | Ga0466958_0029643 | Ga0466958_0029643_136_489 | 117 |
| 709 | 3300045976 | Ga0466967_0000012 | Ga0466967_0000012_19292_19645 | 117 |
| 710 | 3300046454 | Ga0495592_0032908 | Ga0495592_0032908_3261_3614 | 117 |
| 711 | 3300046454 | Ga0495592_0257617 | Ga0495592_0257617_404_757 | 117 |
| 712 | 3300046459 | Ga0495629_0000421 | Ga0495629_0000421_9873_10226 | 117 |
| 713 | 3300046459 | Ga0495629_0001522 | Ga0495629_0001522_7924_8277 | 117 |
| 714 | 3300046459 | Ga0495629_0007414 | Ga0495629_0007414_6734_7087 | 117 |
| 715 | 3300046461 | Ga0495641_0008689 | Ga0495641_0008689_5410_5763 | 117 |
| 716 | 3300046461 | Ga0495641_0088197 | Ga0495641_0088197_414_767 | 117 |
| 717 | 3300046476 | Ga0495662_0003232 | Ga0495662_0003232_3734_4087 | 117 |
| 718 | 3300046477 | Ga0495664_0195461 | Ga0495664_0195461_506_859 | 117 |
| 719 | 3300046507 | Ga0495606_0000908 | Ga0495606_0000908_9885_10238 | 117 |
| 720 | 3300046511 | Ga0495608_0000071 | Ga0495608_0000071_60626_60979 | 117 |
| 721 | 3300046516 | Ga0495628_0000663 | Ga0495628_0000663_18340_18693 | 117 |
| 722 | 3300046517 | Ga0495630_0000592 | Ga0495630_0000592_23136_23489 | 117 |
| 723 | 3300046529 | Ga0495652_0000009 | Ga0495652_0000009_27632_27985 | 117 |
| 724 | 3300046536 | Ga0495587_0217029 | Ga0495587_0217029_566_919 | 117 |
| 725 | 3300046674 | Ga0495588_0000647 | Ga0495588_0000647_12001_12354 | 117 |
| 726 | 3300046675 | Ga0495657_0000096 | Ga0495657_0000096_60683_61036 | 117 |
| 727 | 3300046678 | Ga0495599_0181345 | Ga0495599_0181345_612_965 | 117 |
| 728 | 3300046681 | Ga0495647_0000310 | Ga0495647_0000310_3487_3840 | 117 |
| 729 | 3300046683 | Ga0495658_0001763 | Ga0495658_0001763_4419_4772 | 117 |
| 730 | 3300046684 | Ga0495669_0148389 | Ga0495669_0148389_377_730 | 117 |
| 731 | 3300046689 | Ga0495613_0000132 | Ga0495613_0000132_3411_3764 | 117 |
| 732 | 3300046690 | Ga0495624_0002444 | Ga0495624_0002444_4008_4361 | 117 |
| 733 | 3300047317 | Ga0495604_0000527 | Ga0495604_0000527_3405_3758 | 117 |
| 734 | 3300047317 | Ga0495604_0225629 | Ga0495604_0225629_751_1104 | 117 |
| 735 | 3300047319 | Ga0495674_0000024 | Ga0495674_0000024_47808_48161 | 117 |
| 736 | 3300047321 | Ga0495676_0008324 | Ga0495676_0008324_361_714 | 117 |
| 737 | 3300047322 | Ga0495680_0066079 | Ga0495680_0066079_1295_1648 | 117 |
| 738 | 3300047444 | Ga0495675_0000715 | Ga0495675_0000715_4165_4518 | 117 |
| 739 | 3300047446 | Ga0495679_035991 | Ga0495679_035991_1191_1544 | 117 |
| 740 | 3300047673 | Ga0495593_0009754 | Ga0495593_0009754_3408_3761 | 117 |
| 741 | 3300048088 | Ga0495602_0000641 | Ga0495602_0000641_28930_29283 | 117 |
| 742 | 3300048088 | Ga0495602_0000911 | Ga0495602_0000911_22014_22367 | 117 |
| 743 | 3300048903 | Ga0496100_0000019 | Ga0496100_0000019_54515_54868 | 117 |
| 744 | 3300048904 | Ga0496101_0000005 | Ga0496101_0000005_54515_54868 | 117 |
| 745 | 3300048905 | Ga0496102_0000438 | Ga0496102_0000438_18223_18576 | 117 |
| 746 | 3300048906 | Ga0496103_0000001 | Ga0496103_0000001_614140_614493 | 117 |
| 747 | 3300048907 | Ga0496104_0081146 | Ga0496104_0081146_2274_2627 | 117 |
| 748 | 3300048909 | Ga0496106_0000033 | Ga0496106_0000033_4504_4857 | 117 |
| 749 | 3300048910 | Ga0496107_0000004 | Ga0496107_0000004_54732_55085 | 117 |
| 750 | 3300048911 | Ga0496108_0000349 | Ga0496108_0000349_35303_35656 | 117 |
| 751 | 3300048911 | Ga0496108_0005020 | Ga0496108_0005020_971_1324 | 117 |
| 752 | 3300048912 | Ga0496109_0000011 | Ga0496109_0000011_105970_106323 | 117 |
| 753 | 3300048912 | Ga0496109_0000307 | Ga0496109_0000307_35294_35647 | 117 |
| 754 | 3300048912 | Ga0496109_0310543 | Ga0496109_0310543_52_405 | 117 |
| 755 | 3300048913 | Ga0496110_0000166 | Ga0496110_0000166_36517_36870 | 117 |
| 756 | 3300048914 | Ga0496111_0000046 | Ga0496111_0000046_15083_15436 | 117 |
| 757 | 3300048914 | Ga0496111_0533691 | Ga0496111_0533691_495_848 | 117 |
| 758 | 3300048916 | Ga0496113_0000382 | Ga0496113_0000382_4134_4487 | 117 |
| 759 | 3300048917 | Ga0496114_0162625 | Ga0496114_0162625_1479_1832 | 117 |
| 760 | 3300048917 | Ga0496114_0179527 | Ga0496114_0179527_157_510 | 117 |
| 761 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_60171_60524 | 117 |
| 762 | 3300049578 | Ga0501042_0040009 | Ga0501042_0040009_150_503 | 117 |
| 763 | 3300049584 | Ga0501068_0039982 | Ga0501068_0039982_1238_1591 | 117 |
| 764 | 3300053077 | Ga0495601_0000618 | Ga0495601_0000618_15170_15526 | 117 |
| 765 | 3300053077 | Ga0495601_0141014 | Ga0495601_0141014_237_590 | 117 |
| 766 | 3300053078 | Ga0495612_0010971 | Ga0495612_0010971_1907_2260 | 117 |
| 767 | 3300053083 | Ga0495655_0000171 | Ga0495655_0000171_8296_8649 | 117 |
| 768 | 3300053084 | Ga0495595_0000009 | Ga0495595_0000009_16204_16557 | 117 |
| 769 | 3300053084 | Ga0495595_0021984 | Ga0495595_0021984_208_561 | 117 |
| 770 | 3300053085 | Ga0495619_0000867 | Ga0495619_0000867_3283_3636 | 117 |
| 771 | 3300053085 | Ga0495619_0003424 | Ga0495619_0003424_4297_4650 | 117 |
| 772 | 3300053094 | Ga0500566_0002814 | Ga0500566_0002814_2039_2392 | 117 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar