F480102

General Info

Members Datasets Scaffolds Average Seq Length
772 346 772 112

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1026590|LJNas_10265902
Length 117
Sequence MRESSETLSGSTWDVEQLLTDALRPIEPPERLTGRFEDTLSAVTQAAAAELSDWAEELSESELRALRDPRNWVRPVVAVGAGSVATGALVLIELRRRSKNKGESGLRALSGGLRSRL

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
180 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
181 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
182 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
183 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
337 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
338 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
343 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
344 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
345 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
346 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 10.88
Rhizosphere 83.68
Stem 0
Stem Tuber 0
Unclassified 3.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1026590 3300000546 Bacteria 619
2 JGI24746J21847_1000082 3300001977 Bacteria 10321
3 JGI24740J21852_10002425 3300001979 Bacteria 8470
4 JGI24034J26672_10000100 3300002239 Bacteria 14378
5 JGI25406J46586_10071415 3300003203 Bacteria 1088
6 JGI25407J50210_10114449 3300003373 Bacteria 665
7 JGI25404J52841_10093533 3300003659 Bacteria 629
8 Ga0065707_10778225 3300005295 Bacteria 600
9 Ga0070658_10173125 3300005327 Bacteria 1814
10 Ga0070683_100001949 3300005329 Bacteria 16174
11 Ga0070683_100004000 3300005329 Bacteria 12072
12 Ga0070683_100012150 3300005329 Bacteria 7473
13 Ga0070683_100127418 3300005329 Bacteria 2407
14 Ga0070683_100132343 3300005329 Bacteria 2361
15 Ga0070683_100166516 3300005329 Bacteria 2091
16 Ga0070683_100499763 3300005329 Bacteria 1162
17 Ga0070690_100264005 3300005330 Bacteria 1222
18 Ga0070690_101317765 3300005330 Bacteria 579
19 Ga0070670_100346520 3300005331 Bacteria 1304
20 Ga0070677_10000515 3300005333 Bacteria 13266
21 Ga0068869_100175188 3300005334 Bacteria 1678
22 Ga0070666_10010679 3300005335 Bacteria 5749
23 Ga0070666_10010680 3300005335 Bacteria 5749
24 Ga0070680_100385948 3300005336 Bacteria 1193
25 Ga0070682_100000061 3300005337 Bacteria 105134
26 Ga0070682_100016669 3300005337 Bacteria 4276
27 Ga0070682_101349262 3300005337 Bacteria 608
28 Ga0068868_100003592 3300005338 Bacteria 10807
29 Ga0068868_100117677 3300005338 Bacteria 2165
30 Ga0070660_100000254 3300005339 Bacteria 35147
31 Ga0070660_100539046 3300005339 Bacteria 973
32 Ga0070660_100752835 3300005339 Bacteria 818
33 Ga0070689_100090411 3300005340 Bacteria 2412
34 Ga0070689_100171111 3300005340 Bacteria 1760
35 Ga0070691_10000046 3300005341 Bacteria 35659
36 Ga0070691_10085429 3300005341 Bacteria 1550
37 Ga0070691_10447236 3300005341 Bacteria 737
38 Ga0070687_100299903 3300005343 Bacteria 1019
39 Ga0070661_100000279 3300005344 Bacteria 41265
40 Ga0070661_100724244 3300005344 Bacteria 812
41 Ga0070692_10033559 3300005345 Bacteria 2587
42 Ga0070692_10309891 3300005345 Bacteria 967
43 Ga0070669_100271469 3300005353 Bacteria 1356
44 Ga0070675_100000069 3300005354 Bacteria 59717
45 Ga0070671_101707048 3300005355 Bacteria 559
46 Ga0070674_100000074 3300005356 Bacteria 46384
47 Ga0070674_101297920 3300005356 Bacteria 649
48 Ga0070673_101771310 3300005364 Bacteria 585
49 Ga0070688_100000211 3300005365 Bacteria 30817
50 Ga0070688_100006275 3300005365 Bacteria 6342
51 Ga0070688_100016289 3300005365 Bacteria 4247
52 Ga0070688_100370127 3300005365 Bacteria 1054
53 Ga0070659_100003627 3300005366 Bacteria 10992
54 Ga0070659_100010404 3300005366 Bacteria 6842
55 Ga0070659_100087161 3300005366 Bacteria 2499
56 Ga0070667_100007228 3300005367 Bacteria 9225
57 Ga0070667_100073843 3300005367 Bacteria 2909
58 Ga0070667_100966986 3300005367 Bacteria 794
59 Ga0070709_10749187 3300005434 Bacteria 763
60 Ga0070714_100037764 3300005435 Bacteria 4060
61 Ga0070714_101089448 3300005435 Bacteria 778
62 Ga0070713_100000023 3300005436 Bacteria 98528
63 Ga0070713_100051767 3300005436 Bacteria 3397
64 Ga0070701_10184007 3300005438 Bacteria 1225
65 Ga0070701_10447142 3300005438 Bacteria 829
66 Ga0070711_100001230 3300005439 Bacteria 13841
67 Ga0070711_100235786 3300005439 Bacteria 1428
68 Ga0070711_100788892 3300005439 Bacteria 805
69 Ga0070705_101006704 3300005440 Bacteria 677
70 Ga0070700_100011692 3300005441 Bacteria 4870
71 Ga0070700_100068842 3300005441 Bacteria 2252
72 Ga0070700_100291468 3300005441 Bacteria 1187
73 Ga0070663_100004452 3300005455 Bacteria 8240
74 Ga0070663_100082479 3300005455 Bacteria 2365
75 Ga0070663_101012510 3300005455 Bacteria 723
76 Ga0070663_102110783 3300005455 Bacteria 508
77 Ga0070678_100102651 3300005456 Bacteria 2220
78 Ga0070678_100622074 3300005456 Bacteria 966
79 Ga0070662_100018204 3300005457 Bacteria 4748
80 Ga0070662_101176802 3300005457 Bacteria 659
81 Ga0070681_10235753 3300005458 Bacteria 1744
82 Ga0070681_11294148 3300005458 Bacteria 652
83 Ga0068867_100023035 3300005459 Bacteria 4457
84 Ga0068867_100855966 3300005459 Bacteria 815
85 Ga0070685_10000032 3300005466 Bacteria 84253
86 Ga0070685_10000540 3300005466 Bacteria 21390
87 Ga0070685_10068347 3300005466 Bacteria 2099
88 Ga0070679_100018595 3300005530 Bacteria 6746
89 Ga0070679_100133381 3300005530 Bacteria 2465
90 Ga0070684_100000542 3300005535 Bacteria 25958
91 Ga0070684_100012296 3300005535 Bacteria 6854
92 Ga0070684_100023153 3300005535 Bacteria 5189
93 Ga0070684_100361092 3300005535 Bacteria 1337
94 Ga0070684_100390520 3300005535 Bacteria 1282
95 Ga0070684_100468753 3300005535 Bacteria 1165
96 Ga0070684_100585640 3300005535 Bacteria 1037
97 Ga0070684_100627573 3300005535 Bacteria 1000
98 Ga0070684_101901207 3300005535 Bacteria 562
99 Ga0068853_100013341 3300005539 Bacteria 6709
100 Ga0068853_100025791 3300005539 Bacteria 4934
101 Ga0068853_100370538 3300005539 Bacteria 1336
102 Ga0070672_100000005 3300005543 Bacteria 121014
103 Ga0070672_100052973 3300005543 Bacteria 3171
104 Ga0070686_100008940 3300005544 Bacteria 5614
105 Ga0070686_100268702 3300005544 Bacteria 1253
106 Ga0070686_101298358 3300005544 Bacteria 608
107 Ga0070695_100037702 3300005545 Bacteria 3048
108 Ga0070695_100195199 3300005545 Bacteria 1443
109 Ga0070693_100217393 3300005547 Bacteria 1250
110 Ga0070693_101286222 3300005547 Unclassified 565
111 Ga0070665_100001182 3300005548 Bacteria 31862
112 Ga0070665_100127161 3300005548 Bacteria 2551
113 Ga0070665_100175868 3300005548 Bacteria 2141
114 Ga0070665_100965378 3300005548 Bacteria 865
115 Ga0070665_101288792 3300005548 Bacteria 741
116 Ga0068855_100496369 3300005563 Bacteria 1327
117 Ga0070664_100048993 3300005564 Bacteria 3572
118 Ga0070664_100068063 3300005564 Bacteria 3044
119 Ga0070664_101369951 3300005564 Bacteria 668
120 Ga0068857_100099628 3300005577 Bacteria 2607
121 Ga0068857_100210379 3300005577 Bacteria 1775
122 Ga0068857_100901832 3300005577 Bacteria 848
123 Ga0068854_100000094 3300005578 Bacteria 62790
124 Ga0068854_100029841 3300005578 Bacteria 3779
125 Ga0068856_100001548 3300005614 Bacteria 24057
126 Ga0068856_100014086 3300005614 Bacteria 7731
127 Ga0068856_100092123 3300005614 Bacteria 3015
128 Ga0070702_100012454 3300005615 Bacteria 4263
129 Ga0070702_100989786 3300005615 Bacteria 665
130 Ga0068852_100000595 3300005616 Bacteria 23764
131 Ga0068852_100008522 3300005616 Bacteria 7563
132 Ga0068859_101781622 3300005617 Bacteria 680
133 Ga0068864_100142292 3300005618 Bacteria 2165
134 Ga0068866_10000349 3300005718 Bacteria 21712
135 Ga0068866_10045476 3300005718 Bacteria 2202
136 Ga0068866_10562748 3300005718 Bacteria 764
137 Ga0068861_100304376 3300005719 Bacteria 1382
138 Ga0068861_100429499 3300005719 Bacteria 1179
139 Ga0068861_100713821 3300005719 Bacteria 933
140 Ga0068851_10006008 3300005834 Bacteria 5532
141 Ga0068851_10009469 3300005834 Bacteria 4532
142 Ga0068851_10021879 3300005834 Bacteria 3108
143 Ga0068870_10139754 3300005840 Bacteria 1416
144 Ga0068870_10237800 3300005840 Bacteria 1123
145 Ga0068863_100000229 3300005841 Bacteria 59324
146 Ga0068863_100194056 3300005841 Bacteria 1952
147 Ga0068863_101134523 3300005841 Bacteria 787
148 Ga0068858_100000017 3300005842 Bacteria 186913
149 Ga0068858_100322246 3300005842 Bacteria 1477
150 Ga0068860_100128482 3300005843 Bacteria 2430
151 Ga0068860_100699832 3300005843 Bacteria 1023
152 Ga0068860_101231060 3300005843 Bacteria 769
153 Ga0068862_100017083 3300005844 Bacteria 6038
154 Ga0081455_10015052 3300005937 Bacteria 7533
155 Ga0081455_10182740 3300005937 Bacteria 1586
156 Ga0081455_10524826 3300005937 Bacteria 789
157 Ga0081538_10022789 3300005981 Bacteria 4523
158 Ga0081540_1000046 3300005983 Bacteria 131375
159 Ga0081539_10002029 3300005985 Bacteria 30518
160 Ga0075365_10004268 3300006038 Bacteria 7543
161 Ga0075363_100011280 3300006048 Bacteria 4275
162 Ga0075364_10027080 3300006051 Bacteria 3660
163 Ga0075364_10221070 3300006051 Bacteria 1285
164 Ga0075364_10392574 3300006051 Bacteria 947
165 Ga0070715_10104200 3300006163 Bacteria 1328
166 Ga0070716_100059536 3300006173 Bacteria 2202
167 Ga0070712_100004870 3300006175 Bacteria 8303
168 Ga0075367_10134744 3300006178 Bacteria 1528
169 Ga0068871_100619970 3300006358 Bacteria 985
170 Ga0075433_10012873 3300006852 Bacteria 6778
171 Ga0068865_100000293 3300006881 Bacteria 27538
172 Ga0068865_100015784 3300006881 Bacteria 4819
173 Ga0068865_102023360 3300006881 Bacteria 523
174 Ga0097620_101781395 3300006931 Bacteria 680
175 Ga0075435_100504652 3300007076 Bacteria 1046
176 Ga0105240_12218355 3300009093 Bacteria 569
177 Ga0111539_10044614 3300009094 Bacteria 5311
178 Ga0111539_12142115 3300009094 Unclassified 649
179 Ga0105245_10000249 3300009098 Bacteria 51282
180 Ga0105245_10000330 3300009098 Bacteria 44516
181 Ga0105245_10001943 3300009098 Bacteria 18774
182 Ga0105245_10042800 3300009098 Bacteria 4040
183 Ga0105245_11813389 3300009098 Bacteria 663
184 Ga0105247_10000629 3300009101 Bacteria 28167
185 Ga0105247_10296170 3300009101 Bacteria 1121
186 Ga0105243_10018797 3300009148 Bacteria 5236
187 Ga0105243_10060666 3300009148 Bacteria 3021
188 Ga0105243_10161333 3300009148 Bacteria 1933
189 Ga0105243_10509838 3300009148 Bacteria 1142
190 Ga0105241_10165675 3300009174 Bacteria 1821
191 Ga0105242_10000139 3300009176 Bacteria 52585
192 Ga0105242_10000264 3300009176 Bacteria 41690
193 Ga0105242_10044641 3300009176 Bacteria 3590
194 Ga0105242_10767097 3300009176 Bacteria 951
195 Ga0105242_10968143 3300009176 Bacteria 856
196 Ga0105248_10000017 3300009177 Bacteria 298089
197 Ga0105248_11539962 3300009177 Bacteria 753
198 Ga0105237_12336532 3300009545 Bacteria 545
199 Ga0105238_10000016 3300009551 Bacteria 236218
200 Ga0105238_10136897 3300009551 Bacteria 2427
201 Ga0105238_10171646 3300009551 Bacteria 2145
202 Ga0105249_10000054 3300009553 Bacteria 162883
203 Ga0105249_10629008 3300009553 Bacteria 1130
204 Ga0105239_10092973 3300010375 Bacteria 3330
205 Ga0105239_10195215 3300010375 Bacteria 2267
206 Ga0105246_10705072 3300011119 Bacteria 885
207 Ga0157371_10005742 3300013102 Bacteria 10396
208 Ga0157370_10007930 3300013104 Bacteria 11498
209 Ga0157370_10070465 3300013104 Bacteria 3300
210 Ga0157369_10000105 3300013105 Bacteria 117996
211 Ga0157374_10000242 3300013296 Bacteria 50857
212 Ga0157374_10729583 3300013296 Bacteria 1005
213 Ga0157374_10899664 3300013296 Bacteria 903
214 Ga0157374_11171875 3300013296 Unclassified 789
215 Ga0157378_10035367 3300013297 Bacteria 4417
216 Ga0157378_10244006 3300013297 Bacteria 1717
217 Ga0163162_10257874 3300013306 Bacteria 1875
218 Ga0163162_10829343 3300013306 Bacteria 1041
219 Ga0163162_11205029 3300013306 Bacteria 859
220 Ga0163162_12325988 3300013306 Unclassified 616
221 Ga0157372_10000556 3300013307 Bacteria 41040
222 Ga0157372_10572197 3300013307 Bacteria 1317
223 Ga0157372_11025021 3300013307 Bacteria 955
224 Ga0157375_10000368 3300013308 Bacteria 41066
225 Ga0157375_10007785 3300013308 Bacteria 9372
226 Ga0157375_10144911 3300013308 Bacteria 2505
227 Ga0157375_10258077 3300013308 Bacteria 1904
228 Ga0157375_10456179 3300013308 Unclassified 1444
229 Ga0163163_10265847 3300014325 Unclassified 1766
230 Ga0163163_10418142 3300014325 Bacteria 1399
231 Ga0163163_10907496 3300014325 Bacteria 944
232 Ga0163163_11502968 3300014325 Bacteria 735
233 Ga0157380_10000448 3300014326 Bacteria 25238
234 Ga0157380_10000641 3300014326 Bacteria 21588
235 Ga0157380_10092518 3300014326 Bacteria 2499
236 Ga0157380_10139935 3300014326 Bacteria 2078
237 Ga0157380_11290674 3300014326 Bacteria 777
238 Ga0157377_10002909 3300014745 Bacteria 7655
239 Ga0157377_10697283 3300014745 Bacteria 737
240 Ga0157377_10948756 3300014745 Bacteria 647
241 Ga0157379_10205732 3300014968 Bacteria 1780
242 Ga0157379_12027983 3300014968 Bacteria 569
243 Ga0157376_10072594 3300014969 Bacteria 2928
244 Ga0157376_10693552 3300014969 Bacteria 1023
245 Ga0163161_10000240 3300017792 Bacteria 49520
246 Ga0163161_10093151 3300017792 Bacteria 2232
247 Ga0163161_11113299 3300017792 Bacteria 679
248 Ga0206353_11846088 3300020082 Bacteria 956
249 Ga0206353_12016716 3300020082 Bacteria 644
250 Ga0207656_10000372 3300025321 Bacteria 15020
251 Ga0207656_10013051 3300025321 Bacteria 3168
252 Ga0207656_10040792 3300025321 Bacteria 1969
253 Ga0207653_10223232 3300025885 Bacteria 716
254 Ga0207682_10001663 3300025893 Bacteria 10194
255 Ga0207642_10000109 3300025899 Bacteria 22332
256 Ga0207642_10190004 3300025899 Bacteria 1126
257 Ga0207642_10394536 3300025899 Bacteria 827
258 Ga0207710_10000096 3300025900 Bacteria 116063
259 Ga0207688_10010299 3300025901 Bacteria 5089
260 Ga0207680_10011203 3300025903 Bacteria 4520
261 Ga0207680_10037190 3300025903 Bacteria 2809
262 Ga0207647_10502343 3300025904 Bacteria 676
263 Ga0207647_10568024 3300025904 Bacteria 628
264 Ga0207685_10431402 3300025905 Bacteria 681
265 Ga0207645_10080049 3300025907 Bacteria 2094
266 Ga0207643_10088116 3300025908 Bacteria 1806
267 Ga0207705_10100639 3300025909 Bacteria 2126
268 Ga0207705_10400598 3300025909 Bacteria 1061
269 Ga0207654_10156486 3300025911 Bacteria 1468
270 Ga0207707_10138975 3300025912 Bacteria 2124
271 Ga0207707_11247119 3300025912 Bacteria 600
272 Ga0207695_10633968 3300025913 Bacteria 950
273 Ga0207693_10009775 3300025915 Bacteria 7810
274 Ga0207693_10916695 3300025915 Bacteria 672
275 Ga0207663_10003933 3300025916 Bacteria 7350
276 Ga0207663_10666413 3300025916 Bacteria 822
277 Ga0207660_10355449 3300025917 Bacteria 1175
278 Ga0207662_10075821 3300025918 Bacteria 2043
279 Ga0207657_10000895 3300025919 Bacteria 31534
280 Ga0207657_10076447 3300025919 Bacteria 2824
281 Ga0207657_10131398 3300025919 Bacteria 2052
282 Ga0207649_10000015 3300025920 Bacteria 245662
283 Ga0207652_10001027 3300025921 Bacteria 25599
284 Ga0207652_10226522 3300025921 Bacteria 1685
285 Ga0207681_10156701 3300025923 Bacteria 1712
286 Ga0207681_10185136 3300025923 Bacteria 1589
287 Ga0207694_10000012 3300025924 Bacteria 411218
288 Ga0207694_10139289 3300025924 Bacteria 1950
289 Ga0207694_10466642 3300025924 Bacteria 1055
290 Ga0207650_10394434 3300025925 Bacteria 1145
291 Ga0207650_10952763 3300025925 Bacteria 729
292 Ga0207659_10000126 3300025926 Bacteria 45034
293 Ga0207659_10100378 3300025926 Bacteria 2181
294 Ga0207687_10000094 3300025927 Bacteria 64753
295 Ga0207687_10000106 3300025927 Bacteria 61275
296 Ga0207687_10000211 3300025927 Bacteria 39509
297 Ga0207687_10071643 3300025927 Bacteria 2477
298 Ga0207700_10000003 3300025928 Bacteria 500797
299 Ga0207700_10027642 3300025928 Bacteria 3977
300 Ga0207700_11927132 3300025928 Bacteria 517
301 Ga0207664_10031461 3300025929 Bacteria 4060
302 Ga0207644_11400983 3300025931 Bacteria 587
303 Ga0207690_10002156 3300025932 Bacteria 12029
304 Ga0207690_10013969 3300025932 Bacteria 4839
305 Ga0207690_10026329 3300025932 Bacteria 3661
306 Ga0207706_10005227 3300025933 Bacteria 12115
307 Ga0207686_10000035 3300025934 Bacteria 130483
308 Ga0207686_10000242 3300025934 Bacteria 41739
309 Ga0207686_10012305 3300025934 Bacteria 4702
310 Ga0207686_10455476 3300025934 Bacteria 985
311 Ga0207686_11089416 3300025934 Bacteria 651
312 Ga0207709_10005413 3300025935 Bacteria 7257
313 Ga0207709_10136361 3300025935 Bacteria 1681
314 Ga0207709_10145526 3300025935 Bacteria 1634
315 Ga0207670_10054052 3300025936 Bacteria 2708
316 Ga0207670_10064975 3300025936 Bacteria 2503
317 Ga0207670_10470094 3300025936 Bacteria 1017
318 Ga0207669_10000002 3300025937 Bacteria 377651
319 Ga0207669_10545829 3300025937 Bacteria 934
320 Ga0207704_10000018 3300025938 Bacteria 153994
321 Ga0207704_10008926 3300025938 Bacteria 4816
322 Ga0207704_10234165 3300025938 Bacteria 1368
323 Ga0207665_10137458 3300025939 Bacteria 1740
324 Ga0207691_10000028 3300025940 Bacteria 121090
325 Ga0207691_10018193 3300025940 Bacteria 6656
326 Ga0207711_10000011 3300025941 Bacteria 518817
327 Ga0207711_11029397 3300025941 Bacteria 763
328 Ga0207689_10236944 3300025942 Bacteria 1508
329 Ga0207661_10000348 3300025944 Bacteria 29705
330 Ga0207661_10001988 3300025944 Bacteria 14066
331 Ga0207661_10007679 3300025944 Bacteria 7674
332 Ga0207661_10090051 3300025944 Bacteria 2554
333 Ga0207661_10332112 3300025944 Bacteria 1368
334 Ga0207661_10495629 3300025944 Bacteria 1116
335 Ga0207679_10105381 3300025945 Bacteria 2214
336 Ga0207679_10289241 3300025945 Bacteria 1408
337 Ga0207667_10099967 3300025949 Bacteria 2992
338 Ga0207651_10074933 3300025960 Bacteria 2412
339 Ga0207712_10000032 3300025961 Bacteria 210628
340 Ga0207712_10131246 3300025961 Bacteria 1909
341 Ga0207712_10446929 3300025961 Bacteria 1095
342 Ga0207668_10011738 3300025972 Bacteria 5337
343 Ga0207668_10245003 3300025972 Bacteria 1452
344 Ga0207640_10000077 3300025981 Bacteria 76155
345 Ga0207658_10003057 3300025986 Bacteria 11974
346 Ga0207658_10055754 3300025986 Bacteria 2930
347 Ga0207658_10249685 3300025986 Bacteria 1507
348 Ga0207677_10000551 3300026023 Bacteria 23665
349 Ga0207677_10000817 3300026023 Bacteria 17805
350 Ga0207677_10042336 3300026023 Bacteria 3019
351 Ga0207703_10000030 3300026035 Bacteria 199014
352 Ga0207703_10467639 3300026035 Bacteria 1180
353 Ga0207703_11429211 3300026035 Bacteria 665
354 Ga0207639_10008950 3300026041 Bacteria 6891
355 Ga0207639_10017923 3300026041 Bacteria 5023
356 Ga0207639_10035932 3300026041 Bacteria 3669
357 Ga0207639_10125273 3300026041 Bacteria 2118
358 Ga0207678_10007063 3300026067 Bacteria 9971
359 Ga0207678_10026150 3300026067 Bacteria 5092
360 Ga0207678_10527404 3300026067 Bacteria 1031
361 Ga0207678_11081541 3300026067 Bacteria 710
362 Ga0207708_10001040 3300026075 Bacteria 20775
363 Ga0207708_10367025 3300026075 Bacteria 1184
364 Ga0207702_10000534 3300026078 Bacteria 42535
365 Ga0207702_10020626 3300026078 Bacteria 5454
366 Ga0207702_10046394 3300026078 Bacteria 3658
367 Ga0207702_10457589 3300026078 Bacteria 1239
368 Ga0207702_10742622 3300026078 Bacteria 969
369 Ga0207641_10002613 3300026088 Bacteria 16523
370 Ga0207641_10019958 3300026088 Bacteria 5501
371 Ga0207641_10432371 3300026088 Bacteria 1269
372 Ga0207641_10858440 3300026088 Bacteria 900
373 Ga0207648_10029476 3300026089 Bacteria 4866
374 Ga0207648_11047191 3300026089 Bacteria 765
375 Ga0207674_10088649 3300026116 Bacteria 3087
376 Ga0207674_10331307 3300026116 Bacteria 1472
377 Ga0207674_10446657 3300026116 Bacteria 1250
378 Ga0207675_100335474 3300026118 Bacteria 1479
379 Ga0207675_100624007 3300026118 Bacteria 1082
380 Ga0207675_100772862 3300026118 Bacteria 973
381 Ga0207683_10013190 3300026121 Bacteria 7050
382 Ga0207683_10129353 3300026121 Bacteria 2270
383 Ga0207698_10000450 3300026142 Bacteria 23764
384 Ga0207698_10018467 3300026142 Bacteria 4752
385 Ga0207698_10028769 3300026142 Bacteria 3968
386 Ga0207698_10650956 3300026142 Bacteria 1044
387 Ga0268266_10000781 3300028379 Bacteria 42591
388 Ga0268266_10001302 3300028379 Bacteria 30313
389 Ga0268266_10025581 3300028379 Bacteria 5021
390 Ga0268266_10057962 3300028379 Bacteria 3334
391 Ga0268266_10167561 3300028379 Bacteria 1991
392 Ga0268266_12279305 3300028379 Unclassified 513
393 Ga0268265_10223962 3300028380 Bacteria 1648
394 Ga0268264_10473771 3300028381 Bacteria 1217
395 Ga0265337_1000462 3300028556 Bacteria 21477
396 Ga0265326_10000033 3300028558 Bacteria 91972
397 Ga0265319_1000010 3300028563 Bacteria 188773
398 Ga0265318_10057725 3300028577 Bacteria 1450
399 Ga0265322_10000005 3300028654 Bacteria 246112
400 Ga0265336_10015097 3300028666 Bacteria 2548
401 Ga0265338_10000051 3300028800 Bacteria 211202
402 Ga0265324_10001579 3300029957 Bacteria 12679
403 Ga0307511_10127344 3300030521 Bacteria 1548
404 Ga0265332_10009473 3300031238 Bacteria 4346
405 Ga0265332_10050960 3300031238 Bacteria 1779
406 Ga0265328_10000811 3300031239 Bacteria 14425
407 Ga0265320_10000010 3300031240 Bacteria 250501
408 Ga0265320_10469816 3300031240 Bacteria 555
409 Ga0265325_10024230 3300031241 Bacteria 3303
410 Ga0265329_10001349 3300031242 Bacteria 11919
411 Ga0265340_10379933 3300031247 Bacteria 623
412 Ga0265339_10334464 3300031249 Unclassified 716
413 Ga0265331_10000549 3300031250 Bacteria 34013
414 Ga0265331_10034893 3300031250 Bacteria 2478
415 Ga0265327_10000040 3300031251 Bacteria 291052
416 Ga0265327_10206608 3300031251 Bacteria 888
417 Ga0265316_10057316 3300031344 Bacteria 3038
418 Ga0265316_10239578 3300031344 Bacteria 1334
419 Ga0307513_10771902 3300031456 Bacteria 667
420 Ga0316579_10617453 3300031691 Bacteria 525
421 Ga0265314_10006416 3300031711 Bacteria 10420
422 Ga0265342_10064498 3300031712 Bacteria 2149
423 Ga0265342_10135058 3300031712 Bacteria 1379
424 Ga0307415_100019193 3300032126 Bacteria 4145
425 Ga0373953_0204583 3300035117 Bacteria 854
426 Ga0373955_0340332 3300035172 Bacteria 908
427 Ga0316574_0007154 3300035398 Bacteria 6100
428 Ga0373924_0320616 3300035410 Bacteria 689
429 Ga0373931_0562274 3300035691 Unclassified 742
430 Ga0373947_0467276 3300035725 Bacteria 855
431 Ga0373937_0052434 3300036401 Bacteria 3740
432 Ga0373937_0161694 3300036401 Bacteria 2099
433 Ga0316582_0856350 3300036647 Unclassified 622
434 Ga0395901_0350635 3300038443 Bacteria 1523
435 Ga0451804_1135842 3300041463 Unclassified 512
436 Ga0451807_1046215 3300041486 Bacteria 709
437 Ga0451839_1259115 3300041496 Bacteria 751
438 Ga0451853_2362759 3300041512 Bacteria 1354
439 Ga0466963_0000548 3300044694 Bacteria 17637
440 Ga0466963_0716143 3300044694 Bacteria 706
441 Ga0466957_0001600 3300044842 Bacteria 11888
442 Ga0466960_0095017 3300044901 Bacteria 1526
443 Ga0466958_0029643 3300045836 Bacteria 3247
444 Ga0466967_0000012 3300045976 Bacteria 104270
445 Ga0466967_0134346 3300045976 Bacteria 2300
446 Ga0466967_0353777 3300045976 Bacteria 1422
447 Ga0495592_0032908 3300046454 Bacteria 3911
448 Ga0495592_0227223 3300046454 Bacteria 1244
449 Ga0495592_0257617 3300046454 Bacteria 1150
450 Ga0495592_0319266 3300046454 Bacteria 1004
451 Ga0495603_0001342 3300046455 Bacteria 14292
452 Ga0495603_0004246 3300046455 Bacteria 8534
453 Ga0495603_0131153 3300046455 Bacteria 1459
454 Ga0495629_0000421 3300046459 Bacteria 35460
455 Ga0495629_0001522 3300046459 Bacteria 18233
456 Ga0495629_0007414 3300046459 Bacteria 8085
457 Ga0495629_0755210 3300046459 Bacteria 643
458 Ga0495638_0034168 3300046460 Bacteria 3247
459 Ga0495641_0000440 3300046461 Bacteria 34775
460 Ga0495641_0008689 3300046461 Bacteria 6145
461 Ga0495641_0054791 3300046461 Bacteria 1811
462 Ga0495641_0088197 3300046461 Bacteria 1388
463 Ga0495653_0035156 3300046463 Bacteria 3956
464 Ga0495653_0122373 3300046463 Bacteria 1852
465 Ga0495653_0186821 3300046463 Bacteria 1417
466 Ga0495653_0261498 3300046463 Bacteria 1144
467 Ga0495662_0003232 3300046476 Bacteria 8230
468 Ga0495662_0262372 3300046476 Bacteria 850
469 Ga0495662_0307837 3300046476 Bacteria 779
470 Ga0495664_0195461 3300046477 Bacteria 1226
471 Ga0495594_0000166 3300046499 Bacteria 31439
472 Ga0495596_0210647 3300046500 Bacteria 755
473 Ga0495606_0000908 3300046507 Bacteria 43982
474 Ga0495608_0000071 3300046511 Bacteria 77182
475 Ga0495608_0000346 3300046511 Bacteria 32424
476 Ga0495608_0106249 3300046511 Bacteria 1807
477 Ga0495610_0245770 3300046512 Bacteria 711
478 Ga0495618_0000218 3300046514 Bacteria 41741
479 Ga0495618_0456444 3300046514 Bacteria 775
480 Ga0495620_0000947 3300046515 Bacteria 17886
481 Ga0495620_0026815 3300046515 Bacteria 2705
482 Ga0495628_0000663 3300046516 Bacteria 31565
483 Ga0495628_0031836 3300046516 Bacteria 4263
484 Ga0495628_0104500 3300046516 Bacteria 2183
485 Ga0495628_0116471 3300046516 Bacteria 2052
486 Ga0495628_0142305 3300046516 Bacteria 1830
487 Ga0495630_0000592 3300046517 Bacteria 26406
488 Ga0495630_0000752 3300046517 Bacteria 22843
489 Ga0495630_0016660 3300046517 Bacteria 5374
490 Ga0495630_0381863 3300046517 Bacteria 1079
491 Ga0495630_0747779 3300046517 Bacteria 747
492 Ga0495644_0006894 3300046523 Bacteria 4398
493 Ga0495652_0000009 3300046529 Bacteria 311000
494 Ga0495652_0008072 3300046529 Bacteria 9640
495 Ga0495652_0561378 3300046529 Bacteria 784
496 Ga0495586_0000359 3300046535 Bacteria 28382
497 Ga0495586_0093922 3300046535 Bacteria 1659
498 Ga0495587_0006597 3300046536 Bacteria 7556
499 Ga0495587_0027615 3300046536 Bacteria 3456
500 Ga0495587_0217029 3300046536 Bacteria 1079
501 Ga0495587_0371127 3300046536 Bacteria 796
502 Ga0495621_0000491 3300046539 Bacteria 9742
503 Ga0495645_0031530 3300046543 Bacteria 3863
504 Ga0495645_0247128 3300046543 Bacteria 1187
505 Ga0495622_0000076 3300046557 Bacteria 86777
506 Ga0495633_0040611 3300046558 Bacteria 2215
507 Ga0495667_0000019 3300046559 Bacteria 181645
508 Ga0495667_0070832 3300046559 Bacteria 2274
509 Ga0495667_0845848 3300046559 Bacteria 563
510 Ga0495656_0000204 3300046615 Bacteria 21157
511 Ga0495634_0000558 3300046642 Bacteria 36397
512 Ga0495634_0000933 3300046642 Bacteria 27697
513 Ga0495634_0008513 3300046642 Bacteria 7627
514 Ga0495625_0000395 3300046660 Bacteria 66640
515 Ga0495635_0015400 3300046663 Bacteria 5349
516 Ga0495588_0000647 3300046674 Bacteria 16200
517 Ga0495657_0000096 3300046675 Bacteria 77239
518 Ga0495657_0011081 3300046675 Bacteria 6759
519 Ga0495657_0114221 3300046675 Bacteria 1707
520 Ga0495599_0181345 3300046678 Bacteria 1298
521 Ga0495623_0159064 3300046679 Bacteria 1329
522 Ga0495647_0000028 3300046681 Bacteria 56683
523 Ga0495647_0000310 3300046681 Bacteria 13667
524 Ga0495647_0126280 3300046681 Bacteria 1080
525 Ga0495658_0000001 3300046683 Bacteria 385362
526 Ga0495658_0001763 3300046683 Bacteria 11187
527 Ga0495658_0409302 3300046683 Bacteria 865
528 Ga0495669_0125527 3300046684 Bacteria 1205
529 Ga0495669_0148389 3300046684 Bacteria 1109
530 Ga0495669_0380223 3300046684 Bacteria 683
531 Ga0495613_0000132 3300046689 Bacteria 74233
532 Ga0495613_0002052 3300046689 Bacteria 15307
533 Ga0495624_0000711 3300046690 Bacteria 26091
534 Ga0495624_0002444 3300046690 Bacteria 14095
535 Ga0495624_0265433 3300046690 Bacteria 1037
536 Ga0495670_0210453 3300046691 Bacteria 1031
537 Ga0495649_0006549 3300046694 Bacteria 7244
538 Ga0495600_0006449 3300046809 Bacteria 7144
539 Ga0495600_0278797 3300046809 Bacteria 1059
540 Ga0495600_0335310 3300046809 Bacteria 949
541 Ga0495600_0472057 3300046809 Bacteria 774
542 Ga0495604_0000104 3300047317 Bacteria 71390
543 Ga0495604_0000527 3300047317 Bacteria 33774
544 Ga0495604_0225629 3300047317 Bacteria 1287
545 Ga0495674_0000024 3300047319 Bacteria 141746
546 Ga0495672_0123531 3300047320 Bacteria 1372
547 Ga0495676_0008324 3300047321 Bacteria 9511
548 Ga0495680_0002158 3300047322 Bacteria 20383
549 Ga0495680_0066079 3300047322 Bacteria 2769
550 Ga0495675_0000715 3300047444 Bacteria 20721
551 Ga0495679_035991 3300047446 Bacteria 1566
552 Ga0495685_017187 3300047447 Bacteria 2476
553 Ga0495684_0088553 3300047471 Bacteria 2346
554 Ga0495686_0252841 3300047472 Bacteria 990
555 Ga0495593_0009754 3300047673 Bacteria 5568
556 Ga0495593_0041504 3300047673 Bacteria 2473
557 Ga0495602_0000641 3300048088 Bacteria 32698
558 Ga0495602_0000911 3300048088 Bacteria 28599
559 Ga0496100_0000019 3300048903 Bacteria 149995
560 Ga0496100_0017081 3300048903 Bacteria 4276
561 Ga0496100_0510723 3300048903 Bacteria 927
562 Ga0496101_0000005 3300048904 Bacteria 331455
563 Ga0496101_0277394 3300048904 Bacteria 1309
564 Ga0496102_0000438 3300048905 Bacteria 47526
565 Ga0496102_0005175 3300048905 Bacteria 11068
566 Ga0496102_0041706 3300048905 Bacteria 4158
567 Ga0496102_0078416 3300048905 Bacteria 3041
568 Ga0496102_0136538 3300048905 Bacteria 2298
569 Ga0496102_0673693 3300048905 Bacteria 957
570 Ga0496102_0676220 3300048905 Bacteria 955
571 Ga0496102_1608250 3300048905 Bacteria 568
572 Ga0496103_0000001 3300048906 Bacteria 643471
573 Ga0496103_0003939 3300048906 Bacteria 9020
574 Ga0496103_0073809 3300048906 Bacteria 2137
575 Ga0496103_0378309 3300048906 Bacteria 910
576 Ga0496103_0789426 3300048906 Bacteria 599
577 Ga0496104_0000010 3300048907 Bacteria 475255
578 Ga0496104_0002977 3300048907 Bacteria 14597
579 Ga0496104_0081146 3300048907 Bacteria 3093
580 Ga0496104_0106136 3300048907 Bacteria 2691
581 Ga0496104_0324894 3300048907 Bacteria 1451
582 Ga0496104_0342447 3300048907 Bacteria 1408
583 Ga0496105_0000005 3300048908 Bacteria 475797
584 Ga0496105_0002572 3300048908 Bacteria 13183
585 Ga0496105_0002721 3300048908 Bacteria 12894
586 Ga0496105_0088315 3300048908 Bacteria 2561
587 Ga0496105_0156207 3300048908 Bacteria 1873
588 Ga0496105_0359162 3300048908 Bacteria 1162
589 Ga0496106_0000033 3300048909 Bacteria 131412
590 Ga0496106_0000137 3300048909 Bacteria 54395
591 Ga0496106_0007514 3300048909 Bacteria 8057
592 Ga0496106_0008110 3300048909 Bacteria 7759
593 Ga0496107_0000004 3300048910 Bacteria 297680
594 Ga0496107_0013937 3300048910 Bacteria 5623
595 Ga0496107_0050875 3300048910 Bacteria 2987
596 Ga0496107_0053158 3300048910 Bacteria 2922
597 Ga0496107_0055180 3300048910 Bacteria 2870
598 Ga0496107_0363081 3300048910 Bacteria 1077
599 Ga0496108_0000004 3300048911 Bacteria 545055
600 Ga0496108_0000349 3300048911 Bacteria 39032
601 Ga0496108_0000413 3300048911 Bacteria 34974
602 Ga0496108_0005020 3300048911 Bacteria 10693
603 Ga0496108_0007240 3300048911 Bacteria 8995
604 Ga0496108_0013024 3300048911 Bacteria 6776
605 Ga0496108_0028457 3300048911 Bacteria 4624
606 Ga0496108_0509956 3300048911 Bacteria 1050
607 Ga0496109_0000011 3300048912 Bacteria 234908
608 Ga0496109_0000031 3300048912 Bacteria 163998
609 Ga0496109_0000307 3300048912 Bacteria 46191
610 Ga0496109_0000333 3300048912 Bacteria 44006
611 Ga0496109_0003508 3300048912 Bacteria 13101
612 Ga0496109_0024868 3300048912 Bacteria 5330
613 Ga0496109_0279353 3300048912 Bacteria 1574
614 Ga0496109_0310543 3300048912 Bacteria 1487
615 Ga0496110_0000166 3300048913 Bacteria 40195
616 Ga0496110_0014143 3300048913 Bacteria 6619
617 Ga0496110_0023581 3300048913 Bacteria 5236
618 Ga0496110_0316736 3300048913 Unclassified 1421
619 Ga0496110_1524238 3300048913 Bacteria 578
620 Ga0496111_0000046 3300048914 Bacteria 48246
621 Ga0496111_0016446 3300048914 Bacteria 5096
622 Ga0496111_0036062 3300048914 Bacteria 3536
623 Ga0496111_0359217 3300048914 Bacteria 1078
624 Ga0496111_0533691 3300048914 Bacteria 862
625 Ga0496111_1266739 3300048914 Bacteria 520
626 Ga0496112_0000002 3300048915 Bacteria 782039
627 Ga0496112_0256798 3300048915 Bacteria 1698
628 Ga0496112_0890495 3300048915 Bacteria 812
629 Ga0496113_0000382 3300048916 Bacteria 21412
630 Ga0496113_0003337 3300048916 Bacteria 9589
631 Ga0496113_0086377 3300048916 Bacteria 2410
632 Ga0496113_0559065 3300048916 Bacteria 917
633 Ga0496114_0000003 3300048917 Bacteria 630981
634 Ga0496114_0005493 3300048917 Bacteria 9922
635 Ga0496114_0006238 3300048917 Bacteria 9383
636 Ga0496114_0162625 3300048917 Bacteria 1942
637 Ga0496114_0179527 3300048917 Bacteria 1848
638 Ga0496115_0000022 3300048918 Bacteria 164224
639 Ga0496115_0000027 3300048918 Bacteria 145505
640 Ga0496115_0066821 3300048918 Bacteria 2906
641 Ga0496116_0000120 3300048919 Bacteria 166804
642 Ga0496117_0003475 3300048920 Bacteria 18288
643 Ga0496118_0001146 3300048921 Bacteria 40888
644 Ga0496118_0128472 3300048921 Bacteria 1633
645 Ga0496118_0283129 3300048921 Bacteria 921
646 Ga0496119_0003031 3300048922 Bacteria 17784
647 Ga0496119_0008829 3300048922 Bacteria 8768
648 Ga0496119_0024921 3300048922 Bacteria 4192
649 Ga0496119_0058284 3300048922 Bacteria 2328
650 Ga0496120_0002373 3300048923 Bacteria 19225
651 Ga0496120_0026562 3300048923 Bacteria 3573
652 Ga0496121_0010929 3300048924 Bacteria 10140
653 Ga0496121_0022712 3300048924 Bacteria 6072
654 Ga0496121_0149043 3300048924 Bacteria 1724
655 Ga0496121_0377222 3300048924 Unclassified 936
656 Ga0496124_0150244 3300048927 Bacteria 1828
657 Ga0496124_0371783 3300048927 Bacteria 1003
658 Ga0496124_0726129 3300048927 Bacteria 626
659 Ga0496125_0082356 3300048928 Bacteria 2453
660 Ga0496125_0183625 3300048928 Bacteria 1390
661 Ga0496126_0485724 3300048929 Bacteria 989
662 Ga0501031_0304132 3300049568 Bacteria 1033
663 Ga0501031_0550248 3300049568 Bacteria 743
664 Ga0501033_0045821 3300049570 Bacteria 3253
665 Ga0501034_0091793 3300049571 Bacteria 3034
666 Ga0501034_0158767 3300049571 Bacteria 2234
667 Ga0501034_0177639 3300049571 Bacteria 2094
668 Ga0501034_0411408 3300049571 Bacteria 1274
669 Ga0501038_0055915 3300049574 Bacteria 3389
670 Ga0501039_0538583 3300049575 Bacteria 916
671 Ga0501039_0686785 3300049575 Bacteria 801
672 Ga0501040_0138554 3300049576 Bacteria 1713
673 Ga0501042_0040009 3300049578 Bacteria 3333
674 Ga0501042_0623728 3300049578 Bacteria 784
675 Ga0501043_0089573 3300049579 Bacteria 2418
676 Ga0501043_0291545 3300049579 Bacteria 1249
677 Ga0501043_0432149 3300049579 Bacteria 991
678 Ga0501043_0885003 3300049579 Bacteria 641
679 Ga0501046_0001831 3300049580 Bacteria 20273
680 Ga0501046_1176579 3300049580 Bacteria 527
681 Ga0501047_0023553 3300049581 Bacteria 5909
682 Ga0501047_0039258 3300049581 Bacteria 4579
683 Ga0501047_0237918 3300049581 Bacteria 1672
684 Ga0501047_0300887 3300049581 Bacteria 1446
685 Ga0501047_0864228 3300049581 Bacteria 718
686 Ga0501048_0068919 3300049582 Bacteria 2498
687 Ga0501048_0487639 3300049582 Bacteria 883
688 Ga0501067_0488776 3300049583 Bacteria 688
689 Ga0501068_0039982 3300049584 Bacteria 2814
690 Ga0501068_0111008 3300049584 Bacteria 1705
691 Ga0501069_0343152 3300049585 Bacteria 879
692 Ga0501069_0509205 3300049585 Bacteria 718
693 Ga0501069_0663311 3300049585 Bacteria 628
694 Ga0501070_0004723 3300049586 Bacteria 11667
695 Ga0501070_0021704 3300049586 Bacteria 5383
696 Ga0501070_0105763 3300049586 Bacteria 2326
697 Ga0501070_0199725 3300049586 Bacteria 1642
698 Ga0501070_0239231 3300049586 Bacteria 1486
699 Ga0501070_0309283 3300049586 Bacteria 1286
700 Ga0501071_0044828 3300049587 Bacteria 3173
701 Ga0501073_0135155 3300049589 Bacteria 1709
702 Ga0501074_0020387 3300049590 Bacteria 4819
703 Ga0501074_0417034 3300049590 Bacteria 952
704 Ga0501075_0001204 3300049591 Bacteria 16745
705 Ga0501076_0114901 3300049592 Bacteria 2178
706 Ga0501079_0035824 3300049741 Bacteria 3820
707 Ga0501080_0038591 3300049742 Bacteria 4458
708 Ga0501080_0261243 3300049742 Bacteria 1578
709 Ga0501080_0420653 3300049742 Bacteria 1200
710 Ga0501080_1819758 3300049742 Bacteria 511
711 Ga0501081_1003258 3300049743 Bacteria 631
712 Ga0501083_0007397 3300049744 Bacteria 7789
713 Ga0501083_0056209 3300049744 Bacteria 2637
714 Ga0501083_0082419 3300049744 Bacteria 2131
715 Ga0501035_0028315 3300049822 Bacteria 5115
716 Ga0501035_0048103 3300049822 Bacteria 3825
717 Ga0501035_1110521 3300049822 Bacteria 617
718 Ga0501044_0035974 3300049823 Bacteria 5182
719 Ga0501044_0091449 3300049823 Bacteria 3069
720 Ga0501044_0121114 3300049823 Bacteria 2617
721 Ga0501044_0309804 3300049823 Unclassified 1506
722 Ga0501044_0395448 3300049823 Bacteria 1295
723 Ga0501045_0480926 3300049824 Bacteria 923
724 nmdc:mga03n38_599995_c1 3300050490 Bacteria 627
725 nmdc:mga00v17_31399_c1 3300050491 Bacteria 3132
726 nmdc:mga00v17_415851_c1 3300050491 Bacteria 873
727 nmdc:mga00v17_618390_c1 3300050491 Bacteria 698
728 nmdc:mga00v17_99220_c1 3300050491 Bacteria 1837
729 nmdc:mga0yw44_5758_c1 3300050492 Bacteria 5905
730 nmdc:mga06z11_43278_c1 3300050494 Bacteria 2264
731 nmdc:mga05p37_1337194_c1 3300050507 Bacteria 727
732 nmdc:mga05p37_217112_c1 3300050507 Bacteria 2309
733 nmdc:mga08y16_1471105_c1 3300050511 Unclassified 642
734 nmdc:mga08y16_42807_c1 3300050511 Bacteria 4742
735 nmdc:mga0rr50_340539_c1 3300050513 Bacteria 1260
736 nmdc:mga08x19_206543_c1 3300050514 Bacteria 1347
737 nmdc:mga0a205_4_c1 3300050515 Bacteria 168154
738 nmdc:mga0a205_507_c1 3300050515 Bacteria 15066
739 Ga0495601_0000618 3300053077 Bacteria 18918
740 Ga0495601_0012796 3300053077 Bacteria 5036
741 Ga0495601_0032168 3300053077 Bacteria 3264
742 Ga0495601_0100172 3300053077 Bacteria 1871
743 Ga0495601_0110732 3300053077 Bacteria 1778
744 Ga0495601_0128333 3300053077 Bacteria 1651
745 Ga0495601_0141014 3300053077 Bacteria 1572
746 Ga0495601_0541482 3300053077 Unclassified 749
747 Ga0495612_0001837 3300053078 Bacteria 8704
748 Ga0495612_0010971 3300053078 Bacteria 3658
749 Ga0495612_0018436 3300053078 Bacteria 2796
750 Ga0495612_0044017 3300053078 Bacteria 1826
751 Ga0495612_0149420 3300053078 Bacteria 1016
752 Ga0495655_0000010 3300053083 Bacteria 125615
753 Ga0495655_0000171 3300053083 Bacteria 12258
754 Ga0495595_0000009 3300053084 Bacteria 193039
755 Ga0495595_0000148 3300053084 Bacteria 28375
756 Ga0495595_0021984 3300053084 Bacteria 2794
757 Ga0495595_0506958 3300053084 Bacteria 615
758 Ga0495619_0000001 3300053085 Bacteria 586054
759 Ga0495619_0000177 3300053085 Bacteria 46800
760 Ga0495619_0000413 3300053085 Bacteria 29033
761 Ga0495619_0000867 3300053085 Bacteria 19839
762 Ga0495619_0003424 3300053085 Bacteria 10239
763 Ga0495619_0014796 3300053085 Bacteria 4929
764 Ga0495619_0045943 3300053085 Bacteria 2870
765 Ga0495619_0053614 3300053085 Bacteria 2668
766 Ga0495619_0838692 3300053085 Bacteria 620
767 Ga0500566_0002814 3300053094 Bacteria 10359
768 Ga0500595_179189 3300053119 Bacteria 588
769 Ga0500614_001529 3300053123 Bacteria 5484
770 Ga0500628_000039 3300053129 Bacteria 49907
771 Ga0501082_0110513 3300060353 Bacteria 2379
772 Ga0530510_0140972 3300061734 Bacteria 1776

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009101 Ga0105247_10296170 Ga0105247_102961701 87
2 3300013297 Ga0157378_10244006 Ga0157378_102440062 87
3 3300013306 Ga0163162_12325988 Ga0163162_123259882 87
4 3300013307 Ga0157372_11025021 Ga0157372_110250212 87
5 3300014325 Ga0163163_10907496 Ga0163163_109074961 87
6 3300035691 Ga0373931_0562274 Ga0373931_0562274_34_363 87
7 3300048903 Ga0496100_0017081 Ga0496100_0017081_1684_2013 87
8 3300048904 Ga0496101_0277394 Ga0496101_0277394_963_1292 87
9 3300048905 Ga0496102_0005175 Ga0496102_0005175_7212_7541 87
10 3300048906 Ga0496103_0003939 Ga0496103_0003939_6770_7099 87
11 3300048907 Ga0496104_0324894 Ga0496104_0324894_365_694 87
12 3300048908 Ga0496105_0002572 Ga0496105_0002572_5769_6098 87
13 3300048909 Ga0496106_0007514 Ga0496106_0007514_5002_5331 87
14 3300048910 Ga0496107_0013937 Ga0496107_0013937_477_806 87
15 3300048911 Ga0496108_0028457 Ga0496108_0028457_2214_2543 87
16 3300048912 Ga0496109_0024868 Ga0496109_0024868_1225_1554 87
17 3300048914 Ga0496111_0036062 Ga0496111_0036062_2715_3044 87
18 3300048917 Ga0496114_0006238 Ga0496114_0006238_3914_4243 87
19 3300038443 Ga0395901_0350635 Ga0395901_0350635_703_1038 92
20 3300044901 Ga0466960_0095017 Ga0466960_0095017_406_744 92
21 3300005937 Ga0081455_10182740 Ga0081455_101827403 93
22 3300025923 Ga0207681_10156701 Ga0207681_101567013 93
23 3300013308 Ga0157375_10144911 Ga0157375_101449113 94
24 3300046500 Ga0495596_0210647 Ga0495596_0210647_284_649 94
25 3300053085 Ga0495619_0014796 Ga0495619_0014796_1185_1526 94
26 3300046499 Ga0495594_0000166 Ga0495594_0000166_14444_14770 95
27 3300046516 Ga0495628_0031836 Ga0495628_0031836_2400_2744 95
28 3300049583 Ga0501067_0488776 Ga0501067_0488776_228_554 95
29 3300049585 Ga0501069_0663311 Ga0501069_0663311_254_580 95
30 3300061734 Ga0530510_0140972 Ga0530510_0140972_54_380 95
31 3300005455 Ga0070663_102110783 Ga0070663_1021107831 97
32 3300044694 Ga0466963_0000548 Ga0466963_0000548_2297_2650 97
33 3300005439 Ga0070711_100235786 Ga0070711_1002357863 98
34 3300009098 Ga0105245_11813389 Ga0105245_118133892 98
35 3300009148 Ga0105243_10509838 Ga0105243_105098382 98
36 3300014325 Ga0163163_10418142 Ga0163163_104181423 98
37 3300014326 Ga0157380_11290674 Ga0157380_112906742 98
38 3300014745 Ga0157377_10948756 Ga0157377_109487562 98
39 3300046543 Ga0495645_0031530 Ga0495645_0031530_2212_2508 98
40 3300005436 Ga0070713_100051767 Ga0070713_1000517675 99
41 3300005615 Ga0070702_100989786 Ga0070702_1009897862 99
42 3300009551 Ga0105238_10000016 Ga0105238_10000016154 99
43 3300011119 Ga0105246_10705072 Ga0105246_107050721 99
44 3300025904 Ga0207647_10568024 Ga0207647_105680241 99
45 3300025916 Ga0207663_10666413 Ga0207663_106664132 99
46 3300025924 Ga0207694_10000012 Ga0207694_10000012268 99
47 3300025928 Ga0207700_10027642 Ga0207700_100276423 99
48 3300047447 Ga0495685_017187 Ga0495685_017187_1460_1804 99
49 3300009093 Ga0105240_12218355 Ga0105240_122183552 100
50 3300005339 Ga0070660_100752835 Ga0070660_1007528352 102
51 3300005366 Ga0070659_100087161 Ga0070659_1000871613 102
52 3300014326 Ga0157380_10000641 Ga0157380_1000064114 102
53 3300014969 Ga0157376_10693552 Ga0157376_106935522 102
54 3300025919 Ga0207657_10076447 Ga0207657_100764473 102
55 3300025932 Ga0207690_10026329 Ga0207690_100263292 102
56 3300025936 Ga0207670_10064975 Ga0207670_100649752 102
57 3300044842 Ga0466957_0001600 Ga0466957_0001600_10253_10606 102
58 3300046536 Ga0495587_0027615 Ga0495587_0027615_2145_2483 102
59 3300005439 Ga0070711_100788892 Ga0070711_1007888922 103
60 3300006358 Ga0068871_100619970 Ga0068871_1006199702 103
61 3300009553 Ga0105249_10000054 Ga0105249_1000005431 103
62 3300025961 Ga0207712_10000032 Ga0207712_10000032134 103
63 3300044694 Ga0466963_0716143 Ga0466963_0716143_343_696 103
64 3300046523 Ga0495644_0006894 Ga0495644_0006894_1756_2097 103
65 3300046690 Ga0495624_0000711 Ga0495624_0000711_17200_17547 103
66 3300047673 Ga0495593_0041504 Ga0495593_0041504_500_841 103
67 3300005329 Ga0070683_100499763 Ga0070683_1004997632 104
68 3300005535 Ga0070684_100468753 Ga0070684_1004687532 104
69 3300005539 Ga0068853_100025791 Ga0068853_1000257916 104
70 3300005564 Ga0070664_100068063 Ga0070664_1000680632 104
71 3300005614 Ga0068856_100092123 Ga0068856_1000921233 104
72 3300005840 Ga0068870_10237800 Ga0068870_102378003 104
73 3300017792 Ga0163161_11113299 Ga0163161_111132992 104
74 3300025915 Ga0207693_10916695 Ga0207693_109166952 104
75 3300025928 Ga0207700_11927132 Ga0207700_119271322 104
76 3300025944 Ga0207661_10495629 Ga0207661_104956292 104
77 3300025961 Ga0207712_10131246 Ga0207712_101312462 104
78 3300026041 Ga0207639_10017923 Ga0207639_100179237 104
79 3300026078 Ga0207702_10020626 Ga0207702_100206265 104
80 3300026078 Ga0207702_10742622 Ga0207702_107426222 104
81 3300028556 Ga0265337_1000462 Ga0265337_100046215 104
82 3300028558 Ga0265326_10000033 Ga0265326_1000003348 104
83 3300028654 Ga0265322_10000005 Ga0265322_100000052 104
84 3300028666 Ga0265336_10015097 Ga0265336_100150973 104
85 3300029957 Ga0265324_10001579 Ga0265324_1000157915 104
86 3300031238 Ga0265332_10009473 Ga0265332_100094735 104
87 3300031239 Ga0265328_10000811 Ga0265328_100008118 104
88 3300031240 Ga0265320_10000010 Ga0265320_1000001048 104
89 3300031242 Ga0265329_10001349 Ga0265329_1000134910 104
90 3300031247 Ga0265340_10379933 Ga0265340_103799332 104
91 3300031249 Ga0265339_10334464 Ga0265339_103344642 104
92 3300031250 Ga0265331_10000549 Ga0265331_1000054916 104
93 3300031251 Ga0265327_10000040 Ga0265327_10000040259 104
94 3300031344 Ga0265316_10057316 Ga0265316_100573163 104
95 3300031711 Ga0265314_10006416 Ga0265314_100064164 104
96 3300031712 Ga0265342_10064498 Ga0265342_100644982 104
97 3300035117 Ga0373953_0204583 Ga0373953_0204583_211_555 104
98 3300036401 Ga0373937_0161694 Ga0373937_0161694_1243_1587 104
99 3300045976 Ga0466967_0134346 Ga0466967_0134346_720_1034 104
100 3300045976 Ga0466967_0353777 Ga0466967_0353777_588_902 104
101 3300046454 Ga0495592_0227223 Ga0495592_0227223_305_619 104
102 3300046454 Ga0495592_0319266 Ga0495592_0319266_249_563 104
103 3300046455 Ga0495603_0001342 Ga0495603_0001342_2385_2699 104
104 3300046459 Ga0495629_0755210 Ga0495629_0755210_191_505 104
105 3300046461 Ga0495641_0000440 Ga0495641_0000440_25518_25862 104
106 3300046461 Ga0495641_0054791 Ga0495641_0054791_1345_1659 104
107 3300046463 Ga0495653_0186821 Ga0495653_0186821_545_889 104
108 3300046476 Ga0495662_0307837 Ga0495662_0307837_418_732 104
109 3300046511 Ga0495608_0106249 Ga0495608_0106249_268_612 104
110 3300046514 Ga0495618_0000218 Ga0495618_0000218_39084_39428 104
111 3300046516 Ga0495628_0104500 Ga0495628_0104500_54_368 104
112 3300046517 Ga0495630_0381863 Ga0495630_0381863_302_616 104
113 3300046529 Ga0495652_0008072 Ga0495652_0008072_3243_3557 104
114 3300046529 Ga0495652_0561378 Ga0495652_0561378_109_453 104
115 3300046543 Ga0495645_0247128 Ga0495645_0247128_115_429 104
116 3300046557 Ga0495622_0000076 Ga0495622_0000076_71945_72298 104
117 3300046559 Ga0495667_0000019 Ga0495667_0000019_121896_122210 104
118 3300046642 Ga0495634_0000933 Ga0495634_0000933_22585_22899 104
119 3300046642 Ga0495634_0008513 Ga0495634_0008513_3541_3855 104
120 3300046684 Ga0495669_0125527 Ga0495669_0125527_305_619 104
121 3300046694 Ga0495649_0006549 Ga0495649_0006549_1716_2060 104
122 3300046809 Ga0495600_0006449 Ga0495600_0006449_1081_1425 104
123 3300046809 Ga0495600_0335310 Ga0495600_0335310_493_837 104
124 3300047322 Ga0495680_0002158 Ga0495680_0002158_11267_11581 104
125 3300048912 Ga0496109_0279353 Ga0496109_0279353_999_1313 104
126 3300048915 Ga0496112_0256798 Ga0496112_0256798_1212_1526 104
127 3300048916 Ga0496113_0086377 Ga0496113_0086377_1266_1580 104
128 3300048917 Ga0496114_0005493 Ga0496114_0005493_2486_2830 104
129 3300048918 Ga0496115_0066821 Ga0496115_0066821_1347_1661 104
130 3300049575 Ga0501039_0686785 Ga0501039_0686785_29_343 104
131 3300049743 Ga0501081_1003258 Ga0501081_1003258_255_569 104
132 3300050507 nmdc:mga05p37_217112_c1 nmdc:mga05p37_217112_c1_1767_2108 104
133 3300053077 Ga0495601_0128333 Ga0495601_0128333_997_1311 104
134 3300053078 Ga0495612_0018436 Ga0495612_0018436_664_978 104
135 3300053078 Ga0495612_0149420 Ga0495612_0149420_42_356 104
136 3300053085 Ga0495619_0045943 Ga0495619_0045943_1515_1835 104
137 3300053085 Ga0495619_0838692 Ga0495619_0838692_86_400 104
138 3300053123 Ga0500614_001529 Ga0500614_001529_1660_2004 104
139 3300005329 Ga0070683_100004000 Ga0070683_1000040008 105
140 3300005535 Ga0070684_100012296 Ga0070684_1000122964 105
141 3300005548 Ga0070665_100127161 Ga0070665_1001271613 105
142 3300013296 Ga0157374_10000242 Ga0157374_1000024220 105
143 3300025944 Ga0207661_10000348 Ga0207661_1000034814 105
144 3300028379 Ga0268266_10057962 Ga0268266_100579623 105
145 3300046455 Ga0495603_0131153 Ga0495603_0131153_299_646 105
146 3300047320 Ga0495672_0123531 Ga0495672_0123531_702_1049 105
147 3300048905 Ga0496102_0673693 Ga0496102_0673693_580_909 105
148 3300048909 Ga0496106_0000137 Ga0496106_0000137_3079_3426 105
149 3300048910 Ga0496107_0050875 Ga0496107_0050875_18_365 105
150 3300048910 Ga0496107_0053158 Ga0496107_0053158_2544_2873 105
151 3300048922 Ga0496119_0058284 Ga0496119_0058284_376_705 105
152 3300048923 Ga0496120_0002373 Ga0496120_0002373_17241_17570 105
153 3300048924 Ga0496121_0149043 Ga0496121_0149043_303_632 105
154 3300048924 Ga0496121_0377222 Ga0496121_0377222_546_875 105
155 3300048929 Ga0496126_0485724 Ga0496126_0485724_274_603 105
156 3300049586 Ga0501070_0004723 Ga0501070_0004723_7635_7964 105
157 3300049744 Ga0501083_0007397 Ga0501083_0007397_1493_1822 105
158 3300050514 nmdc:mga08x19_206543_c1 nmdc:mga08x19_206543_c1_23_340 105
159 3300053119 Ga0500595_179189 Ga0500595_179189_55_384 105
160 3300003373 JGI25407J50210_10114449 JGI25407J50210_101144492 106
161 3300005981 Ga0081538_10022789 Ga0081538_100227893 106
162 3300035172 Ga0373955_0340332 Ga0373955_0340332_214_540 106
163 3300035398 Ga0316574_0007154 Ga0316574_0007154_2574_2900 106
164 3300035410 Ga0373924_0320616 Ga0373924_0320616_338_664 106
165 3300036401 Ga0373937_0052434 Ga0373937_0052434_1368_1694 106
166 3300036647 Ga0316582_0856350 Ga0316582_0856350_130_456 106
167 3300041463 Ga0451804_1135842 Ga0451804_1135842_168_488 106
168 3300046463 Ga0495653_0261498 Ga0495653_0261498_30_356 106
169 3300046517 Ga0495630_0000752 Ga0495630_0000752_7117_7443 106
170 3300046559 Ga0495667_0845848 Ga0495667_0845848_181_501 106
171 3300046663 Ga0495635_0015400 Ga0495635_0015400_836_1162 106
172 3300046675 Ga0495657_0114221 Ga0495657_0114221_674_1000 106
173 3300046690 Ga0495624_0265433 Ga0495624_0265433_98_424 106
174 3300046809 Ga0495600_0472057 Ga0495600_0472057_302_628 106
175 3300053077 Ga0495601_0012796 Ga0495601_0012796_3489_3812 106
176 3300053077 Ga0495601_0032168 Ga0495601_0032168_1718_2044 106
177 3300053077 Ga0495601_0541482 Ga0495601_0541482_67_399 106
178 3300053078 Ga0495612_0044017 Ga0495612_0044017_510_836 106
179 3300053085 Ga0495619_0000413 Ga0495619_0000413_1369_1695 106
180 3300053085 Ga0495619_0053614 Ga0495619_0053614_1264_1590 106
181 3300006051 Ga0075364_10221070 Ga0075364_102210702 107
182 3300014326 Ga0157380_10092518 Ga0157380_100925182 107
183 3300026067 Ga0207678_11081541 Ga0207678_110815411 107
184 3300047317 Ga0495604_0000104 Ga0495604_0000104_16500_16844 107
185 3300048907 Ga0496104_0002977 Ga0496104_0002977_8840_9166 107
186 3300048908 Ga0496105_0002721 Ga0496105_0002721_6556_6882 107
187 3300050490 nmdc:mga03n38_599995_c1 nmdc:mga03n38_599995_c1_82_411 107
188 3300050491 nmdc:mga00v17_618390_c1 nmdc:mga00v17_618390_c1_266_595 107
189 3300050491 nmdc:mga00v17_99220_c1 nmdc:mga00v17_99220_c1_1339_1668 107
190 3300050494 nmdc:mga06z11_43278_c1 nmdc:mga06z11_43278_c1_714_1043 107
191 3300053077 Ga0495601_0110732 Ga0495601_0110732_1130_1456 107
192 3300005435 Ga0070714_101089448 Ga0070714_1010894481 108
193 3300005548 Ga0070665_101288792 Ga0070665_1012887922 108
194 3300005718 Ga0068866_10562748 Ga0068866_105627482 108
195 3300005841 Ga0068863_100000229 Ga0068863_10000022929 108
196 3300005841 Ga0068863_100194056 Ga0068863_1001940564 108
197 3300009098 Ga0105245_10000330 Ga0105245_1000033030 108
198 3300009176 Ga0105242_10000264 Ga0105242_1000026424 108
199 3300013296 Ga0157374_11171875 Ga0157374_111718751 108
200 3300013308 Ga0157375_10258077 Ga0157375_102580773 108
201 3300025899 Ga0207642_10190004 Ga0207642_101900042 108
202 3300025913 Ga0207695_10633968 Ga0207695_106339682 108
203 3300025934 Ga0207686_10000035 Ga0207686_1000003595 108
204 3300026088 Ga0207641_10002613 Ga0207641_1000261310 108
205 3300026088 Ga0207641_10019958 Ga0207641_100199585 108
206 3300046515 Ga0495620_0000947 Ga0495620_0000947_2921_3268 108
207 3300048911 Ga0496108_0000004 Ga0496108_0000004_284306_284632 108
208 3300048912 Ga0496109_0000031 Ga0496109_0000031_130519_130845 108
209 3300053083 Ga0495655_0000010 Ga0495655_0000010_2411_2764 108
210 3300053129 Ga0500628_000039 Ga0500628_000039_42091_42444 108
211 3300005295 Ga0065707_10778225 Ga0065707_107782251 109
212 3300005329 Ga0070683_100166516 Ga0070683_1001665162 109
213 3300005330 Ga0070690_101317765 Ga0070690_1013177651 109
214 3300005331 Ga0070670_100346520 Ga0070670_1003465202 109
215 3300005336 Ga0070680_100385948 Ga0070680_1003859482 109
216 3300005337 Ga0070682_100016669 Ga0070682_1000166693 109
217 3300005338 Ga0068868_100117677 Ga0068868_1001176773 109
218 3300005339 Ga0070660_100000254 Ga0070660_10000025410 109
219 3300005340 Ga0070689_100171111 Ga0070689_1001711112 109
220 3300005341 Ga0070691_10447236 Ga0070691_104472361 109
221 3300005345 Ga0070692_10033559 Ga0070692_100335592 109
222 3300005353 Ga0070669_100271469 Ga0070669_1002714692 109
223 3300005365 Ga0070688_100016289 Ga0070688_1000162896 109
224 3300005366 Ga0070659_100010404 Ga0070659_1000104045 109
225 3300005438 Ga0070701_10184007 Ga0070701_101840072 109
226 3300005440 Ga0070705_101006704 Ga0070705_1010067042 109
227 3300005441 Ga0070700_100011692 Ga0070700_1000116926 109
228 3300005455 Ga0070663_100004452 Ga0070663_1000044522 109
229 3300005456 Ga0070678_100102651 Ga0070678_1001026514 109
230 3300005457 Ga0070662_100018204 Ga0070662_1000182045 109
231 3300005458 Ga0070681_11294148 Ga0070681_112941482 109
232 3300005459 Ga0068867_100023035 Ga0068867_1000230353 109
233 3300005530 Ga0070679_100133381 Ga0070679_1001333812 109
234 3300005535 Ga0070684_100023153 Ga0070684_1000231536 109
235 3300005539 Ga0068853_100013341 Ga0068853_10001334110 109
236 3300005543 Ga0070672_100052973 Ga0070672_1000529732 109
237 3300005544 Ga0070686_100008940 Ga0070686_1000089406 109
238 3300005545 Ga0070695_100195199 Ga0070695_1001951993 109
239 3300005547 Ga0070693_100217393 Ga0070693_1002173933 109
240 3300005563 Ga0068855_100496369 Ga0068855_1004963692 109
241 3300005564 Ga0070664_101369951 Ga0070664_1013699512 109
242 3300005577 Ga0068857_100210379 Ga0068857_1002103792 109
243 3300005578 Ga0068854_100029841 Ga0068854_1000298414 109
244 3300005615 Ga0070702_100012454 Ga0070702_1000124543 109
245 3300005616 Ga0068852_100008522 Ga0068852_1000085229 109
246 3300005617 Ga0068859_101781622 Ga0068859_1017816222 109
247 3300005618 Ga0068864_100142292 Ga0068864_1001422923 109
248 3300005718 Ga0068866_10045476 Ga0068866_100454762 109
249 3300005719 Ga0068861_100304376 Ga0068861_1003043762 109
250 3300005834 Ga0068851_10006008 Ga0068851_100060083 109
251 3300005841 Ga0068863_101134523 Ga0068863_1011345232 109
252 3300005842 Ga0068858_100322246 Ga0068858_1003222462 109
253 3300005843 Ga0068860_100128482 Ga0068860_1001284823 109
254 3300005843 Ga0068860_101231060 Ga0068860_1012310601 109
255 3300005844 Ga0068862_100017083 Ga0068862_1000170833 109
256 3300005937 Ga0081455_10524826 Ga0081455_105248262 109
257 3300006038 Ga0075365_10004268 Ga0075365_100042688 109
258 3300006048 Ga0075363_100011280 Ga0075363_1000112803 109
259 3300006051 Ga0075364_10027080 Ga0075364_100270803 109
260 3300006051 Ga0075364_10392574 Ga0075364_103925742 109
261 3300006178 Ga0075367_10134744 Ga0075367_101347442 109
262 3300006881 Ga0068865_100015784 Ga0068865_1000157843 109
263 3300006931 Ga0097620_101781395 Ga0097620_1017813952 109
264 3300009094 Ga0111539_10044614 Ga0111539_100446148 109
265 3300009098 Ga0105245_10042800 Ga0105245_100428004 109
266 3300009148 Ga0105243_10018797 Ga0105243_100187976 109
267 3300009176 Ga0105242_10968143 Ga0105242_109681432 109
268 3300009551 Ga0105238_10171646 Ga0105238_101716462 109
269 3300009553 Ga0105249_10629008 Ga0105249_106290081 109
270 3300013296 Ga0157374_10729583 Ga0157374_107295832 109
271 3300013306 Ga0163162_10257874 Ga0163162_102578742 109
272 3300013307 Ga0157372_10572197 Ga0157372_105721972 109
273 3300014326 Ga0157380_10139935 Ga0157380_101399352 109
274 3300014745 Ga0157377_10002909 Ga0157377_1000290911 109
275 3300014968 Ga0157379_10205732 Ga0157379_102057322 109
276 3300025321 Ga0207656_10040792 Ga0207656_100407922 109
277 3300025899 Ga0207642_10394536 Ga0207642_103945362 109
278 3300025901 Ga0207688_10010299 Ga0207688_100102992 109
279 3300025904 Ga0207647_10502343 Ga0207647_105023431 109
280 3300025907 Ga0207645_10080049 Ga0207645_100800493 109
281 3300025909 Ga0207705_10400598 Ga0207705_104005982 109
282 3300025912 Ga0207707_11247119 Ga0207707_112471191 109
283 3300025917 Ga0207660_10355449 Ga0207660_103554492 109
284 3300025918 Ga0207662_10075821 Ga0207662_100758213 109
285 3300025919 Ga0207657_10000895 Ga0207657_100008958 109
286 3300025921 Ga0207652_10226522 Ga0207652_102265223 109
287 3300025923 Ga0207681_10185136 Ga0207681_101851362 109
288 3300025924 Ga0207694_10139289 Ga0207694_101392893 109
289 3300025925 Ga0207650_10394434 Ga0207650_103944342 109
290 3300025926 Ga0207659_10100378 Ga0207659_101003781 109
291 3300025927 Ga0207687_10071643 Ga0207687_100716432 109
292 3300025932 Ga0207690_10013969 Ga0207690_100139696 109
293 3300025933 Ga0207706_10005227 Ga0207706_100052278 109
294 3300025934 Ga0207686_11089416 Ga0207686_110894161 109
295 3300025935 Ga0207709_10136361 Ga0207709_101363613 109
296 3300025936 Ga0207670_10470094 Ga0207670_104700942 109
297 3300025937 Ga0207669_10545829 Ga0207669_105458291 109
298 3300025938 Ga0207704_10008926 Ga0207704_100089263 109
299 3300025940 Ga0207691_10018193 Ga0207691_100181935 109
300 3300025944 Ga0207661_10332112 Ga0207661_103321123 109
301 3300025945 Ga0207679_10289241 Ga0207679_102892412 109
302 3300025949 Ga0207667_10099967 Ga0207667_100999672 109
303 3300025960 Ga0207651_10074933 Ga0207651_100749332 109
304 3300025961 Ga0207712_10446929 Ga0207712_104469291 109
305 3300025972 Ga0207668_10011738 Ga0207668_100117385 109
306 3300026023 Ga0207677_10042336 Ga0207677_100423362 109
307 3300026035 Ga0207703_11429211 Ga0207703_114292111 109
308 3300026041 Ga0207639_10008950 Ga0207639_100089508 109
309 3300026067 Ga0207678_10007063 Ga0207678_1000706313 109
310 3300026075 Ga0207708_10001040 Ga0207708_100010409 109
311 3300026088 Ga0207641_10432371 Ga0207641_104323711 109
312 3300026089 Ga0207648_10029476 Ga0207648_100294765 109
313 3300026116 Ga0207674_10088649 Ga0207674_100886492 109
314 3300026118 Ga0207675_100335474 Ga0207675_1003354743 109
315 3300026121 Ga0207683_10129353 Ga0207683_101293532 109
316 3300026142 Ga0207698_10028769 Ga0207698_100287693 109
317 3300028380 Ga0268265_10223962 Ga0268265_102239623 109
318 3300028381 Ga0268264_10473771 Ga0268264_104737712 109
319 3300048903 Ga0496100_0510723 Ga0496100_0510723_483_818 109
320 3300048905 Ga0496102_0041706 Ga0496102_0041706_2135_2470 109
321 3300048905 Ga0496102_0078416 Ga0496102_0078416_2453_2806 109
322 3300048906 Ga0496103_0378309 Ga0496103_0378309_302_637 109
323 3300048909 Ga0496106_0008110 Ga0496106_0008110_3740_4075 109
324 3300048910 Ga0496107_0055180 Ga0496107_0055180_1924_2259 109
325 3300048911 Ga0496108_0013024 Ga0496108_0013024_1787_2122 109
326 3300048912 Ga0496109_0003508 Ga0496109_0003508_789_1124 109
327 3300048913 Ga0496110_0023581 Ga0496110_0023581_1082_1417 109
328 3300048916 Ga0496113_0559065 Ga0496113_0559065_493_828 109
329 3300050491 nmdc:mga00v17_31399_c1 nmdc:mga00v17_31399_c1_2136_2471 109
330 3300050491 nmdc:mga00v17_415851_c1 nmdc:mga00v17_415851_c1_366_704 109
331 3300050492 nmdc:mga0yw44_5758_c1 nmdc:mga0yw44_5758_c1_1877_2212 109
332 3300050511 nmdc:mga08y16_42807_c1 nmdc:mga08y16_42807_c1_3785_4120 109
333 3300005329 Ga0070683_100132343 Ga0070683_1001323434 111
334 3300005344 Ga0070661_100000279 Ga0070661_10000027924 111
335 3300005344 Ga0070661_100724244 Ga0070661_1007242442 111
336 3300005455 Ga0070663_100082479 Ga0070663_1000824793 111
337 3300005458 Ga0070681_10235753 Ga0070681_102357532 111
338 3300005530 Ga0070679_100018595 Ga0070679_1000185953 111
339 3300005535 Ga0070684_100361092 Ga0070684_1003610922 111
340 3300014969 Ga0157376_10072594 Ga0157376_100725942 111
341 3300020082 Ga0206353_11846088 Ga0206353_118460882 111
342 3300025912 Ga0207707_10138975 Ga0207707_101389753 111
343 3300025920 Ga0207649_10000015 Ga0207649_10000015154 111
344 3300025921 Ga0207652_10001027 Ga0207652_100010271 111
345 3300026067 Ga0207678_10026150 Ga0207678_100261504 111
346 3300049571 Ga0501034_0091793 Ga0501034_0091793_539_880 111
347 3300049571 Ga0501034_0158767 Ga0501034_0158767_1572_1910 111
348 3300049579 Ga0501043_0291545 Ga0501043_0291545_172_513 111
349 3300049579 Ga0501043_0885003 Ga0501043_0885003_84_422 111
350 3300049581 Ga0501047_0237918 Ga0501047_0237918_87_425 111
351 3300049581 Ga0501047_0300887 Ga0501047_0300887_1081_1422 111
352 3300049581 Ga0501047_0864228 Ga0501047_0864228_256_600 111
353 3300049585 Ga0501069_0343152 Ga0501069_0343152_412_753 111
354 3300049586 Ga0501070_0105763 Ga0501070_0105763_1499_1843 111
355 3300049586 Ga0501070_0309283 Ga0501070_0309283_434_775 111
356 3300049587 Ga0501071_0044828 Ga0501071_0044828_582_923 111
357 3300049590 Ga0501074_0020387 Ga0501074_0020387_3189_3533 111
358 3300049741 Ga0501079_0035824 Ga0501079_0035824_827_1168 111
359 3300049742 Ga0501080_0038591 Ga0501080_0038591_2489_2830 111
360 3300049742 Ga0501080_1819758 Ga0501080_1819758_31_369 111
361 3300049744 Ga0501083_0056209 Ga0501083_0056209_186_527 111
362 3300049822 Ga0501035_1110521 Ga0501035_1110521_261_605 111
363 3300049823 Ga0501044_0121114 Ga0501044_0121114_2133_2474 111
364 3300049823 Ga0501044_0309804 Ga0501044_0309804_1158_1496 111
365 3300049823 Ga0501044_0395448 Ga0501044_0395448_207_545 111
366 3300005329 Ga0070683_100012150 Ga0070683_1000121507 112
367 3300005335 Ga0070666_10010680 Ga0070666_100106803 112
368 3300005355 Ga0070671_101707048 Ga0070671_1017070481 112
369 3300005367 Ga0070667_100007228 Ga0070667_1000072284 112
370 3300005434 Ga0070709_10749187 Ga0070709_107491872 112
371 3300005535 Ga0070684_100000542 Ga0070684_10000054211 112
372 3300005548 Ga0070665_100175868 Ga0070665_1001758683 112
373 3300005843 Ga0068860_100699832 Ga0068860_1006998322 112
374 3300005937 Ga0081455_10015052 Ga0081455_100150524 112
375 3300009545 Ga0105237_12336532 Ga0105237_123365321 112
376 3300009551 Ga0105238_10136897 Ga0105238_101368973 112
377 3300010375 Ga0105239_10195215 Ga0105239_101952153 112
378 3300013306 Ga0163162_10829343 Ga0163162_108293432 112
379 3300014325 Ga0163163_10265847 Ga0163163_102658472 112
380 3300025903 Ga0207680_10011203 Ga0207680_100112033 112
381 3300025924 Ga0207694_10466642 Ga0207694_104666421 112
382 3300025931 Ga0207644_11400983 Ga0207644_114009832 112
383 3300025944 Ga0207661_10007679 Ga0207661_100076794 112
384 3300025986 Ga0207658_10003057 Ga0207658_100030575 112
385 3300026035 Ga0207703_10467639 Ga0207703_104676392 112
386 3300026088 Ga0207641_10858440 Ga0207641_108584402 112
387 3300026142 Ga0207698_10650956 Ga0207698_106509562 112
388 3300028379 Ga0268266_10000781 Ga0268266_1000078126 112
389 3300028379 Ga0268266_10167561 Ga0268266_101675612 112
390 3300046535 Ga0495586_0093922 Ga0495586_0093922_1296_1634 112
391 3300046539 Ga0495621_0000491 Ga0495621_0000491_8582_8920 112
392 3300048905 Ga0496102_0136538 Ga0496102_0136538_361_711 112
393 3300048905 Ga0496102_0676220 Ga0496102_0676220_552_890 112
394 3300048906 Ga0496103_0073809 Ga0496103_0073809_1044_1394 112
395 3300048906 Ga0496103_0789426 Ga0496103_0789426_171_518 112
396 3300048907 Ga0496104_0106136 Ga0496104_0106136_686_1033 112
397 3300048908 Ga0496105_0088315 Ga0496105_0088315_773_1120 112
398 3300048910 Ga0496107_0363081 Ga0496107_0363081_317_664 112
399 3300048911 Ga0496108_0509956 Ga0496108_0509956_94_441 112
400 3300048913 Ga0496110_0316736 Ga0496110_0316736_1015_1356 112
401 3300048914 Ga0496111_0359217 Ga0496111_0359217_592_933 112
402 3300048915 Ga0496112_0000002 Ga0496112_0000002_21642_21980 112
403 3300048919 Ga0496116_0000120 Ga0496116_0000120_42490_42840 112
404 3300048920 Ga0496117_0003475 Ga0496117_0003475_3182_3532 112
405 3300048921 Ga0496118_0001146 Ga0496118_0001146_15771_16121 112
406 3300048921 Ga0496118_0128472 Ga0496118_0128472_728_1078 112
407 3300048921 Ga0496118_0283129 Ga0496118_0283129_103_453 112
408 3300048922 Ga0496119_0003031 Ga0496119_0003031_13605_13952 112
409 3300048922 Ga0496119_0008829 Ga0496119_0008829_3824_4174 112
410 3300048924 Ga0496121_0010929 Ga0496121_0010929_9273_9620 112
411 3300048924 Ga0496121_0022712 Ga0496121_0022712_79_429 112
412 3300048927 Ga0496124_0150244 Ga0496124_0150244_627_974 112
413 3300048927 Ga0496124_0371783 Ga0496124_0371783_608_955 112
414 3300048928 Ga0496125_0082356 Ga0496125_0082356_2032_2382 112
415 3300048928 Ga0496125_0183625 Ga0496125_0183625_223_570 112
416 3300049568 Ga0501031_0304132 Ga0501031_0304132_59_406 112
417 3300049568 Ga0501031_0550248 Ga0501031_0550248_364_711 112
418 3300049570 Ga0501033_0045821 Ga0501033_0045821_994_1341 112
419 3300049571 Ga0501034_0177639 Ga0501034_0177639_728_1075 112
420 3300049571 Ga0501034_0411408 Ga0501034_0411408_34_381 112
421 3300049574 Ga0501038_0055915 Ga0501038_0055915_1548_1895 112
422 3300049575 Ga0501039_0538583 Ga0501039_0538583_477_824 112
423 3300049576 Ga0501040_0138554 Ga0501040_0138554_144_491 112
424 3300049579 Ga0501043_0089573 Ga0501043_0089573_1573_1920 112
425 3300049579 Ga0501043_0432149 Ga0501043_0432149_582_929 112
426 3300049580 Ga0501046_0001831 Ga0501046_0001831_17198_17545 112
427 3300049580 Ga0501046_1176579 Ga0501046_1176579_13_360 112
428 3300049581 Ga0501047_0023553 Ga0501047_0023553_3271_3618 112
429 3300049581 Ga0501047_0039258 Ga0501047_0039258_3271_3618 112
430 3300049582 Ga0501048_0068919 Ga0501048_0068919_140_487 112
431 3300049582 Ga0501048_0487639 Ga0501048_0487639_504_851 112
432 3300049584 Ga0501068_0111008 Ga0501068_0111008_319_666 112
433 3300049585 Ga0501069_0509205 Ga0501069_0509205_168_515 112
434 3300049586 Ga0501070_0021704 Ga0501070_0021704_1993_2340 112
435 3300049586 Ga0501070_0199725 Ga0501070_0199725_779_1126 112
436 3300049589 Ga0501073_0135155 Ga0501073_0135155_1289_1636 112
437 3300049590 Ga0501074_0417034 Ga0501074_0417034_504_851 112
438 3300049592 Ga0501076_0114901 Ga0501076_0114901_1652_1996 112
439 3300049742 Ga0501080_0261243 Ga0501080_0261243_271_621 112
440 3300049742 Ga0501080_0420653 Ga0501080_0420653_40_387 112
441 3300049744 Ga0501083_0082419 Ga0501083_0082419_1698_2045 112
442 3300049822 Ga0501035_0028315 Ga0501035_0028315_995_1342 112
443 3300049822 Ga0501035_0048103 Ga0501035_0048103_2459_2806 112
444 3300049823 Ga0501044_0035974 Ga0501044_0035974_3774_4121 112
445 3300049823 Ga0501044_0091449 Ga0501044_0091449_995_1342 112
446 3300060353 Ga0501082_0110513 Ga0501082_0110513_1936_2283 112
447 3300001977 JGI24746J21847_1000082 JGI24746J21847_10000823 113
448 3300005356 Ga0070674_101297920 Ga0070674_1012979201 113
449 3300005439 Ga0070711_100001230 Ga0070711_10000123011 113
450 3300005441 Ga0070700_100068842 Ga0070700_1000688423 113
451 3300005457 Ga0070662_101176802 Ga0070662_1011768022 113
452 3300005535 Ga0070684_100390520 Ga0070684_1003905202 113
453 3300006881 Ga0068865_102023360 Ga0068865_1020233602 113
454 3300009094 Ga0111539_12142115 Ga0111539_121421152 113
455 3300025916 Ga0207663_10003933 Ga0207663_100039335 113
456 3300026078 Ga0207702_10457589 Ga0207702_104575892 113
457 3300046516 Ga0495628_0142305 Ga0495628_0142305_923_1264 113
458 3300046683 Ga0495658_0000001 Ga0495658_0000001_277757_278098 113
459 3300046809 Ga0495600_0278797 Ga0495600_0278797_684_1025 113
460 3300047472 Ga0495686_0252841 Ga0495686_0252841_471_821 113
461 3300048905 Ga0496102_1608250 Ga0496102_1608250_196_540 113
462 3300048907 Ga0496104_0342447 Ga0496104_0342447_781_1122 113
463 3300048908 Ga0496105_0156207 Ga0496105_0156207_535_876 113
464 3300048913 Ga0496110_0014143 Ga0496110_0014143_5254_5595 113
465 3300048913 Ga0496110_1524238 Ga0496110_1524238_134_478 113
466 3300048914 Ga0496111_0016446 Ga0496111_0016446_3148_3489 113
467 3300048914 Ga0496111_1266739 Ga0496111_1266739_138_482 113
468 3300048915 Ga0496112_0890495 Ga0496112_0890495_322_663 113
469 3300048927 Ga0496124_0726129 Ga0496124_0726129_29_370 113
470 3300049591 Ga0501075_0001204 Ga0501075_0001204_8662_9003 113
471 3300050507 nmdc:mga05p37_1337194_c1 nmdc:mga05p37_1337194_c1_309_653 113
472 3300050511 nmdc:mga08y16_1471105_c1 nmdc:mga08y16_1471105_c1_188_529 113
473 3300053077 Ga0495601_0100172 Ga0495601_0100172_592_933 113
474 3300053078 Ga0495612_0001837 Ga0495612_0001837_1602_1943 113
475 3300053084 Ga0495595_0506958 Ga0495595_0506958_181_522 113
476 3300005341 Ga0070691_10000046 Ga0070691_1000004622 114
477 3300005356 Ga0070674_100000074 Ga0070674_1000000748 114
478 3300005441 Ga0070700_100291468 Ga0070700_1002914682 114
479 3300005545 Ga0070695_100037702 Ga0070695_1000377022 114
480 3300005718 Ga0068866_10000349 Ga0068866_100003498 114
481 3300006852 Ga0075433_10012873 Ga0075433_100128733 114
482 3300009148 Ga0105243_10161333 Ga0105243_101613332 114
483 3300009176 Ga0105242_10767097 Ga0105242_107670972 114
484 3300014325 Ga0163163_11502968 Ga0163163_115029682 114
485 3300014326 Ga0157380_10000448 Ga0157380_1000044823 114
486 3300017792 Ga0163161_10000240 Ga0163161_1000024024 114
487 3300020082 Ga0206353_12016716 Ga0206353_120167162 114
488 3300025885 Ga0207653_10223232 Ga0207653_102232322 114
489 3300025899 Ga0207642_10000109 Ga0207642_1000010918 114
490 3300025934 Ga0207686_10455476 Ga0207686_104554762 114
491 3300025935 Ga0207709_10145526 Ga0207709_101455262 114
492 3300025937 Ga0207669_10000002 Ga0207669_100000028 114
493 3300026023 Ga0207677_10000551 Ga0207677_1000055112 114
494 3300026075 Ga0207708_10367025 Ga0207708_103670252 114
495 3300030521 Ga0307511_10127344 Ga0307511_101273443 114
496 3300046455 Ga0495603_0004246 Ga0495603_0004246_3431_3775 114
497 3300046463 Ga0495653_0122373 Ga0495653_0122373_852_1196 114
498 3300046511 Ga0495608_0000346 Ga0495608_0000346_29756_30100 114
499 3300046517 Ga0495630_0016660 Ga0495630_0016660_2208_2552 114
500 3300046536 Ga0495587_0006597 Ga0495587_0006597_4829_5173 114
501 3300046558 Ga0495633_0040611 Ga0495633_0040611_336_680 114
502 3300046615 Ga0495656_0000204 Ga0495656_0000204_15918_16262 114
503 3300046675 Ga0495657_0011081 Ga0495657_0011081_2260_2604 114
504 3300046681 Ga0495647_0126280 Ga0495647_0126280_202_546 114
505 3300046683 Ga0495658_0409302 Ga0495658_0409302_76_420 114
506 3300046684 Ga0495669_0380223 Ga0495669_0380223_85_429 114
507 3300046689 Ga0495613_0002052 Ga0495613_0002052_3979_4323 114
508 3300046691 Ga0495670_0210453 Ga0495670_0210453_526_870 114
509 3300048911 Ga0496108_0007240 Ga0496108_0007240_4624_4968 114
510 3300048916 Ga0496113_0003337 Ga0496113_0003337_2988_3332 114
511 3300048917 Ga0496114_0000003 Ga0496114_0000003_341321_341665 114
512 3300048918 Ga0496115_0000027 Ga0496115_0000027_67608_67952 114
513 3300049578 Ga0501042_0623728 Ga0501042_0623728_324_668 114
514 3300049586 Ga0501070_0239231 Ga0501070_0239231_710_1054 114
515 3300050515 nmdc:mga0a205_4_c1 nmdc:mga0a205_4_c1_18122_18466 114
516 3300050515 nmdc:mga0a205_507_c1 nmdc:mga0a205_507_c1_8194_8538 114
517 3300053084 Ga0495595_0000148 Ga0495595_0000148_8504_8848 114
518 3300053085 Ga0495619_0000177 Ga0495619_0000177_7349_7693 114
519 3300002239 JGI24034J26672_10000100 JGI24034J26672_1000010016 115
520 3300005333 Ga0070677_10000515 Ga0070677_100005155 115
521 3300005334 Ga0068869_100175188 Ga0068869_1001751883 115
522 3300005455 Ga0070663_101012510 Ga0070663_1010125102 115
523 3300005544 Ga0070686_100268702 Ga0070686_1002687023 115
524 3300005842 Ga0068858_100000017 Ga0068858_100000017101 115
525 3300006173 Ga0070716_100059536 Ga0070716_1000595363 115
526 3300009176 Ga0105242_10044641 Ga0105242_100446414 115
527 3300013104 Ga0157370_10007930 Ga0157370_1000793012 115
528 3300013308 Ga0157375_10000368 Ga0157375_1000036839 115
529 3300025893 Ga0207682_10001663 Ga0207682_100016636 115
530 3300025925 Ga0207650_10952763 Ga0207650_109527632 115
531 3300025927 Ga0207687_10000094 Ga0207687_1000009431 115
532 3300025934 Ga0207686_10012305 Ga0207686_100123055 115
533 3300025939 Ga0207665_10137458 Ga0207665_101374583 115
534 3300025942 Ga0207689_10236944 Ga0207689_102369443 115
535 3300026035 Ga0207703_10000030 Ga0207703_1000003099 115
536 3300035725 Ga0373947_0467276 Ga0373947_0467276_338_685 115
537 3300046463 Ga0495653_0035156 Ga0495653_0035156_1138_1485 115
538 3300046476 Ga0495662_0262372 Ga0495662_0262372_242_589 115
539 3300046516 Ga0495628_0116471 Ga0495628_0116471_1444_1791 115
540 3300046517 Ga0495630_0747779 Ga0495630_0747779_193_540 115
541 3300046535 Ga0495586_0000359 Ga0495586_0000359_25528_25875 115
542 3300046559 Ga0495667_0070832 Ga0495667_0070832_650_997 115
543 3300046642 Ga0495634_0000558 Ga0495634_0000558_25971_26318 115
544 3300046679 Ga0495623_0159064 Ga0495623_0159064_234_581 115
545 3300046681 Ga0495647_0000028 Ga0495647_0000028_32732_33079 115
546 3300047471 Ga0495684_0088553 Ga0495684_0088553_1947_2294 115
547 3300048908 Ga0496105_0359162 Ga0496105_0359162_293_643 115
548 3300048911 Ga0496108_0000413 Ga0496108_0000413_18234_18581 115
549 3300048912 Ga0496109_0000333 Ga0496109_0000333_12966_13313 115
550 3300049824 Ga0501045_0480926 Ga0501045_0480926_64_411 115
551 3300053085 Ga0495619_0000001 Ga0495619_0000001_275506_275853 115
552 3300001979 JGI24740J21852_10002425 JGI24740J21852_100024253 116
553 3300003203 JGI25406J46586_10071415 JGI25406J46586_100714152 116
554 3300005329 Ga0070683_100127418 Ga0070683_1001274184 116
555 3300005338 Ga0068868_100003592 Ga0068868_10000359211 116
556 3300005364 Ga0070673_101771310 Ga0070673_1017713101 116
557 3300005365 Ga0070688_100000211 Ga0070688_10000021112 116
558 3300005466 Ga0070685_10000540 Ga0070685_100005406 116
559 3300005535 Ga0070684_100585640 Ga0070684_1005856402 116
560 3300005564 Ga0070664_100048993 Ga0070664_1000489933 116
561 3300005840 Ga0068870_10139754 Ga0068870_101397543 116
562 3300005985 Ga0081539_10002029 Ga0081539_1000202926 116
563 3300007076 Ga0075435_100504652 Ga0075435_1005046522 116
564 3300009101 Ga0105247_10000629 Ga0105247_1000062912 116
565 3300009148 Ga0105243_10060666 Ga0105243_100606663 116
566 3300009176 Ga0105242_10000139 Ga0105242_1000013925 116
567 3300025900 Ga0207710_10000096 Ga0207710_1000009637 116
568 3300025908 Ga0207643_10088116 Ga0207643_100881162 116
569 3300025934 Ga0207686_10000242 Ga0207686_1000024225 116
570 3300025935 Ga0207709_10005413 Ga0207709_100054133 116
571 3300025944 Ga0207661_10090051 Ga0207661_100900515 116
572 3300025945 Ga0207679_10105381 Ga0207679_101053814 116
573 3300026023 Ga0207677_10000817 Ga0207677_1000081719 116
574 3300028379 Ga0268266_10025581 Ga0268266_100255813 116
575 3300031691 Ga0316579_10617453 Ga0316579_106174531 116
576 3300046460 Ga0495638_0034168 Ga0495638_0034168_536_886 116
577 3300046512 Ga0495610_0245770 Ga0495610_0245770_162_512 116
578 3300046514 Ga0495618_0456444 Ga0495618_0456444_250_600 116
579 3300046515 Ga0495620_0026815 Ga0495620_0026815_313_663 116
580 3300046536 Ga0495587_0371127 Ga0495587_0371127_45_395 116
581 3300046660 Ga0495625_0000395 Ga0495625_0000395_2678_3028 116
582 3300048907 Ga0496104_0000010 Ga0496104_0000010_430789_431139 116
583 3300048908 Ga0496105_0000005 Ga0496105_0000005_430789_431139 116
584 3300048922 Ga0496119_0024921 Ga0496119_0024921_911_1261 116
585 3300048923 Ga0496120_0026562 Ga0496120_0026562_2678_3028 116
586 3300050513 nmdc:mga0rr50_340539_c1 nmdc:mga0rr50_340539_c1_352_702 116
587 3300000546 LJNas_1026590 LJNas_10265902 117
588 3300003659 JGI25404J52841_10093533 JGI25404J52841_100935331 117
589 3300005327 Ga0070658_10173125 Ga0070658_101731253 117
590 3300005329 Ga0070683_100001949 Ga0070683_10000194916 117
591 3300005330 Ga0070690_100264005 Ga0070690_1002640053 117
592 3300005335 Ga0070666_10010679 Ga0070666_100106795 117
593 3300005337 Ga0070682_100000061 Ga0070682_1000000614 117
594 3300005337 Ga0070682_101349262 Ga0070682_1013492621 117
595 3300005339 Ga0070660_100539046 Ga0070660_1005390462 117
596 3300005340 Ga0070689_100090411 Ga0070689_1000904112 117
597 3300005341 Ga0070691_10085429 Ga0070691_100854293 117
598 3300005343 Ga0070687_100299903 Ga0070687_1002999031 117
599 3300005345 Ga0070692_10309891 Ga0070692_103098912 117
600 3300005354 Ga0070675_100000069 Ga0070675_10000006927 117
601 3300005365 Ga0070688_100006275 Ga0070688_1000062753 117
602 3300005365 Ga0070688_100370127 Ga0070688_1003701272 117
603 3300005366 Ga0070659_100003627 Ga0070659_1000036275 117
604 3300005367 Ga0070667_100073843 Ga0070667_1000738431 117
605 3300005367 Ga0070667_100966986 Ga0070667_1009669862 117
606 3300005435 Ga0070714_100037764 Ga0070714_1000377644 117
607 3300005436 Ga0070713_100000023 Ga0070713_10000002338 117
608 3300005438 Ga0070701_10447142 Ga0070701_104471422 117
609 3300005456 Ga0070678_100622074 Ga0070678_1006220742 117
610 3300005459 Ga0068867_100855966 Ga0068867_1008559662 117
611 3300005466 Ga0070685_10000032 Ga0070685_1000003265 117
612 3300005466 Ga0070685_10068347 Ga0070685_100683472 117
613 3300005535 Ga0070684_100627573 Ga0070684_1006275733 117
614 3300005535 Ga0070684_101901207 Ga0070684_1019012071 117
615 3300005539 Ga0068853_100370538 Ga0068853_1003705382 117
616 3300005543 Ga0070672_100000005 Ga0070672_10000000511 117
617 3300005544 Ga0070686_101298358 Ga0070686_1012983582 117
618 3300005547 Ga0070693_101286222 Ga0070693_1012862221 117
619 3300005548 Ga0070665_100001182 Ga0070665_10000118223 117
620 3300005548 Ga0070665_100965378 Ga0070665_1009653782 117
621 3300005577 Ga0068857_100099628 Ga0068857_1000996284 117
622 3300005577 Ga0068857_100901832 Ga0068857_1009018322 117
623 3300005578 Ga0068854_100000094 Ga0068854_10000009429 117
624 3300005614 Ga0068856_100001548 Ga0068856_10000154822 117
625 3300005614 Ga0068856_100014086 Ga0068856_1000140868 117
626 3300005616 Ga0068852_100000595 Ga0068852_10000059525 117
627 3300005719 Ga0068861_100429499 Ga0068861_1004294993 117
628 3300005719 Ga0068861_100713821 Ga0068861_1007138211 117
629 3300005834 Ga0068851_10009469 Ga0068851_100094695 117
630 3300005834 Ga0068851_10021879 Ga0068851_100218795 117
631 3300005983 Ga0081540_1000046 Ga0081540_100004663 117
632 3300006163 Ga0070715_10104200 Ga0070715_101042002 117
633 3300006175 Ga0070712_100004870 Ga0070712_10000487011 117
634 3300006881 Ga0068865_100000293 Ga0068865_10000029312 117
635 3300009098 Ga0105245_10000249 Ga0105245_1000024931 117
636 3300009098 Ga0105245_10001943 Ga0105245_100019433 117
637 3300009174 Ga0105241_10165675 Ga0105241_101656753 117
638 3300009177 Ga0105248_10000017 Ga0105248_10000017188 117
639 3300009177 Ga0105248_11539962 Ga0105248_115399622 117
640 3300010375 Ga0105239_10092973 Ga0105239_100929735 117
641 3300013102 Ga0157371_10005742 Ga0157371_100057422 117
642 3300013104 Ga0157370_10070465 Ga0157370_100704653 117
643 3300013105 Ga0157369_10000105 Ga0157369_10000105120 117
644 3300013296 Ga0157374_10899664 Ga0157374_108996641 117
645 3300013297 Ga0157378_10035367 Ga0157378_100353674 117
646 3300013306 Ga0163162_11205029 Ga0163162_112050292 117
647 3300013307 Ga0157372_10000556 Ga0157372_1000055613 117
648 3300013308 Ga0157375_10007785 Ga0157375_1000778512 117
649 3300013308 Ga0157375_10456179 Ga0157375_104561791 117
650 3300014745 Ga0157377_10697283 Ga0157377_106972832 117
651 3300014968 Ga0157379_12027983 Ga0157379_120279831 117
652 3300017792 Ga0163161_10093151 Ga0163161_100931515 117
653 3300025321 Ga0207656_10000372 Ga0207656_1000037213 117
654 3300025321 Ga0207656_10013051 Ga0207656_100130512 117
655 3300025903 Ga0207680_10037190 Ga0207680_100371904 117
656 3300025905 Ga0207685_10431402 Ga0207685_104314021 117
657 3300025909 Ga0207705_10100639 Ga0207705_101006393 117
658 3300025911 Ga0207654_10156486 Ga0207654_101564861 117
659 3300025915 Ga0207693_10009775 Ga0207693_100097752 117
660 3300025919 Ga0207657_10131398 Ga0207657_101313982 117
661 3300025926 Ga0207659_10000126 Ga0207659_1000012624 117
662 3300025927 Ga0207687_10000106 Ga0207687_1000010631 117
663 3300025927 Ga0207687_10000211 Ga0207687_1000021129 117
664 3300025928 Ga0207700_10000003 Ga0207700_1000000338 117
665 3300025929 Ga0207664_10031461 Ga0207664_100314613 117
666 3300025932 Ga0207690_10002156 Ga0207690_100021566 117
667 3300025936 Ga0207670_10054052 Ga0207670_100540525 117
668 3300025938 Ga0207704_10000018 Ga0207704_1000001834 117
669 3300025938 Ga0207704_10234165 Ga0207704_102341652 117
670 3300025940 Ga0207691_10000028 Ga0207691_10000028119 117
671 3300025941 Ga0207711_10000011 Ga0207711_10000011235 117
672 3300025941 Ga0207711_11029397 Ga0207711_110293972 117
673 3300025944 Ga0207661_10001988 Ga0207661_100019884 117
674 3300025972 Ga0207668_10245003 Ga0207668_102450033 117
675 3300025981 Ga0207640_10000077 Ga0207640_1000007755 117
676 3300025986 Ga0207658_10055754 Ga0207658_100557542 117
677 3300025986 Ga0207658_10249685 Ga0207658_102496853 117
678 3300026041 Ga0207639_10035932 Ga0207639_100359322 117
679 3300026041 Ga0207639_10125273 Ga0207639_101252732 117
680 3300026067 Ga0207678_10527404 Ga0207678_105274042 117
681 3300026078 Ga0207702_10000534 Ga0207702_1000053422 117
682 3300026078 Ga0207702_10046394 Ga0207702_100463942 117
683 3300026089 Ga0207648_11047191 Ga0207648_110471912 117
684 3300026116 Ga0207674_10331307 Ga0207674_103313072 117
685 3300026116 Ga0207674_10446657 Ga0207674_104466573 117
686 3300026118 Ga0207675_100624007 Ga0207675_1006240072 117
687 3300026118 Ga0207675_100772862 Ga0207675_1007728623 117
688 3300026121 Ga0207683_10013190 Ga0207683_100131907 117
689 3300026142 Ga0207698_10000450 Ga0207698_100004504 117
690 3300026142 Ga0207698_10018467 Ga0207698_100184671 117
691 3300028379 Ga0268266_10001302 Ga0268266_1000130214 117
692 3300028379 Ga0268266_12279305 Ga0268266_122793052 117
693 3300028563 Ga0265319_1000010 Ga0265319_1000010196 117
694 3300028577 Ga0265318_10057725 Ga0265318_100577252 117
695 3300028800 Ga0265338_10000051 Ga0265338_1000005190 117
696 3300031238 Ga0265332_10050960 Ga0265332_100509602 117
697 3300031240 Ga0265320_10469816 Ga0265320_104698162 117
698 3300031241 Ga0265325_10024230 Ga0265325_100242303 117
699 3300031250 Ga0265331_10034893 Ga0265331_100348934 117
700 3300031251 Ga0265327_10206608 Ga0265327_102066082 117
701 3300031344 Ga0265316_10239578 Ga0265316_102395783 117
702 3300031456 Ga0307513_10771902 Ga0307513_107719022 117
703 3300031712 Ga0265342_10135058 Ga0265342_101350582 117
704 3300032126 Ga0307415_100019193 Ga0307415_1000191932 117
705 3300041486 Ga0451807_1046215 Ga0451807_1046215_85_438 117
706 3300041496 Ga0451839_1259115 Ga0451839_1259115_293_646 117
707 3300041512 Ga0451853_2362759 Ga0451853_2362759_119_472 117
708 3300045836 Ga0466958_0029643 Ga0466958_0029643_136_489 117
709 3300045976 Ga0466967_0000012 Ga0466967_0000012_19292_19645 117
710 3300046454 Ga0495592_0032908 Ga0495592_0032908_3261_3614 117
711 3300046454 Ga0495592_0257617 Ga0495592_0257617_404_757 117
712 3300046459 Ga0495629_0000421 Ga0495629_0000421_9873_10226 117
713 3300046459 Ga0495629_0001522 Ga0495629_0001522_7924_8277 117
714 3300046459 Ga0495629_0007414 Ga0495629_0007414_6734_7087 117
715 3300046461 Ga0495641_0008689 Ga0495641_0008689_5410_5763 117
716 3300046461 Ga0495641_0088197 Ga0495641_0088197_414_767 117
717 3300046476 Ga0495662_0003232 Ga0495662_0003232_3734_4087 117
718 3300046477 Ga0495664_0195461 Ga0495664_0195461_506_859 117
719 3300046507 Ga0495606_0000908 Ga0495606_0000908_9885_10238 117
720 3300046511 Ga0495608_0000071 Ga0495608_0000071_60626_60979 117
721 3300046516 Ga0495628_0000663 Ga0495628_0000663_18340_18693 117
722 3300046517 Ga0495630_0000592 Ga0495630_0000592_23136_23489 117
723 3300046529 Ga0495652_0000009 Ga0495652_0000009_27632_27985 117
724 3300046536 Ga0495587_0217029 Ga0495587_0217029_566_919 117
725 3300046674 Ga0495588_0000647 Ga0495588_0000647_12001_12354 117
726 3300046675 Ga0495657_0000096 Ga0495657_0000096_60683_61036 117
727 3300046678 Ga0495599_0181345 Ga0495599_0181345_612_965 117
728 3300046681 Ga0495647_0000310 Ga0495647_0000310_3487_3840 117
729 3300046683 Ga0495658_0001763 Ga0495658_0001763_4419_4772 117
730 3300046684 Ga0495669_0148389 Ga0495669_0148389_377_730 117
731 3300046689 Ga0495613_0000132 Ga0495613_0000132_3411_3764 117
732 3300046690 Ga0495624_0002444 Ga0495624_0002444_4008_4361 117
733 3300047317 Ga0495604_0000527 Ga0495604_0000527_3405_3758 117
734 3300047317 Ga0495604_0225629 Ga0495604_0225629_751_1104 117
735 3300047319 Ga0495674_0000024 Ga0495674_0000024_47808_48161 117
736 3300047321 Ga0495676_0008324 Ga0495676_0008324_361_714 117
737 3300047322 Ga0495680_0066079 Ga0495680_0066079_1295_1648 117
738 3300047444 Ga0495675_0000715 Ga0495675_0000715_4165_4518 117
739 3300047446 Ga0495679_035991 Ga0495679_035991_1191_1544 117
740 3300047673 Ga0495593_0009754 Ga0495593_0009754_3408_3761 117
741 3300048088 Ga0495602_0000641 Ga0495602_0000641_28930_29283 117
742 3300048088 Ga0495602_0000911 Ga0495602_0000911_22014_22367 117
743 3300048903 Ga0496100_0000019 Ga0496100_0000019_54515_54868 117
744 3300048904 Ga0496101_0000005 Ga0496101_0000005_54515_54868 117
745 3300048905 Ga0496102_0000438 Ga0496102_0000438_18223_18576 117
746 3300048906 Ga0496103_0000001 Ga0496103_0000001_614140_614493 117
747 3300048907 Ga0496104_0081146 Ga0496104_0081146_2274_2627 117
748 3300048909 Ga0496106_0000033 Ga0496106_0000033_4504_4857 117
749 3300048910 Ga0496107_0000004 Ga0496107_0000004_54732_55085 117
750 3300048911 Ga0496108_0000349 Ga0496108_0000349_35303_35656 117
751 3300048911 Ga0496108_0005020 Ga0496108_0005020_971_1324 117
752 3300048912 Ga0496109_0000011 Ga0496109_0000011_105970_106323 117
753 3300048912 Ga0496109_0000307 Ga0496109_0000307_35294_35647 117
754 3300048912 Ga0496109_0310543 Ga0496109_0310543_52_405 117
755 3300048913 Ga0496110_0000166 Ga0496110_0000166_36517_36870 117
756 3300048914 Ga0496111_0000046 Ga0496111_0000046_15083_15436 117
757 3300048914 Ga0496111_0533691 Ga0496111_0533691_495_848 117
758 3300048916 Ga0496113_0000382 Ga0496113_0000382_4134_4487 117
759 3300048917 Ga0496114_0162625 Ga0496114_0162625_1479_1832 117
760 3300048917 Ga0496114_0179527 Ga0496114_0179527_157_510 117
761 3300048918 Ga0496115_0000022 Ga0496115_0000022_60171_60524 117
762 3300049578 Ga0501042_0040009 Ga0501042_0040009_150_503 117
763 3300049584 Ga0501068_0039982 Ga0501068_0039982_1238_1591 117
764 3300053077 Ga0495601_0000618 Ga0495601_0000618_15170_15526 117
765 3300053077 Ga0495601_0141014 Ga0495601_0141014_237_590 117
766 3300053078 Ga0495612_0010971 Ga0495612_0010971_1907_2260 117
767 3300053083 Ga0495655_0000171 Ga0495655_0000171_8296_8649 117
768 3300053084 Ga0495595_0000009 Ga0495595_0000009_16204_16557 117
769 3300053084 Ga0495595_0021984 Ga0495595_0021984_208_561 117
770 3300053085 Ga0495619_0000867 Ga0495619_0000867_3283_3636 117
771 3300053085 Ga0495619_0003424 Ga0495619_0003424_4297_4650 117
772 3300053094 Ga0500566_0002814 Ga0500566_0002814_2039_2392 117

Feature Viewer

pLDDT pTM Quality
68.32 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map