F480055

General Info

Members Datasets Scaffolds Average Seq Length
770 522 496 177

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0000145|Ga0500622_0000145_38023_38643
Length 206
Sequence LTISGFALIWQAMAIREILEIPDPRLKQVSAPVEAFDDELKTLVADMFETMYDAPGIGLAAIQVGVPLRVLVIDLQPDDPDAEPEVCTAGHSHGGGDHEHTLQPTRKEPRVFINPEILDPSEELAVYNEGCLSVPEIYADVERPSAIRARWQDLDGKVHEESMEGLMATCLQHEMDHLEGILFIDHLSRLKRQMAVKKLEKLRKAA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
8 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
13 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
14 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
15 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
16 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
17 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
18 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
19 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
20 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
21 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
22 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
23 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
24 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
25 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
26 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
27 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
28 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
29 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
30 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
31 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
32 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
33 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
34 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
35 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
36 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
37 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
38 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
39 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
40 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
41 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
42 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
43 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
44 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
45 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
46 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
47 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
48 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
49 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
50 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
51 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
52 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
53 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
54 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
55 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
56 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
57 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
58 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
59 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
60 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
61 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
62 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
63 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
64 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
65 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
66 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
67 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
68 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
69 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
70 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
71 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
72 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
73 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
74 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
75 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
76 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
77 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
78 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
79 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
80 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
81 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
82 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
83 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
84 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
85 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
86 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
87 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
88 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
89 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
90 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
91 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
92 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
93 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
94 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
95 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
96 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
97 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
98 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
99 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
100 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
101 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
102 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
103 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
104 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
105 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
106 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
107 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
108 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
109 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
110 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
111 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
112 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
113 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
114 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
115 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
116 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
117 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
118 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
119 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
120 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
121 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
122 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
123 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
124 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
125 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
126 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
127 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
128 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
129 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
130 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
131 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
132 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
133 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
134 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
135 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
136 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
137 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
138 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
139 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
140 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
141 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
142 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
143 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
144 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
145 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
146 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
147 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
148 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
149 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
150 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
151 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
152 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
153 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
154 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
155 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
156 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
157 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
158 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
159 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
160 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
161 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
162 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
163 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
164 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
165 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
166 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
167 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
168 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
169 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
170 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
171 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
172 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
173 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
174 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
175 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
176 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
177 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
178 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
179 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
180 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
181 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
182 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
183 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
184 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
185 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
186 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
187 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
188 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
189 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
190 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
191 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
192 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
193 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
194 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
195 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
196 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
197 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
198 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
199 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
200 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
201 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
202 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
203 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
204 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
205 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
206 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
207 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
208 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
209 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
210 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
211 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
212 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
213 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
214 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
215 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
216 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
217 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
218 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
219 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
220 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
221 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
222 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
223 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
224 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
225 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
226 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
227 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
228 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
229 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
230 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
231 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
232 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
233 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
234 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
235 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
236 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
237 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
238 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
239 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
240 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
241 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
242 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
243 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
244 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
245 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
246 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
247 3004167301 Mesorhizobium loti 582 Isolate Unclassified
248 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
249 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
250 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
251 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
252 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
253 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
254 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
255 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
256 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
257 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
258 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
259 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
260 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
261 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
262 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
263 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
264 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
265 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
266 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
267 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
268 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
269 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
270 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
271 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
272 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
273 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
274 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
275 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
276 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
277 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
278 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
279 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
280 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
281 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
282 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
283 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
284 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
285 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
286 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
287 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
288 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
289 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
290 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
291 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
292 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
293 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
294 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
295 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
296 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
297 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
298 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
299 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
300 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
301 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
302 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
303 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
304 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
305 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
306 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
307 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
308 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
309 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
310 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
311 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
312 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
313 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
314 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
315 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
316 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
317 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
318 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
319 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
320 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
321 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
322 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
323 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
324 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
325 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
326 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
327 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
328 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
329 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
330 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
331 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
332 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
333 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
334 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
335 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
336 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
337 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
339 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
341 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
375 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
379 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
380 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
381 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
382 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
383 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
384 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
385 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
386 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
387 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
388 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
389 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
390 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
391 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
392 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
393 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
394 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
395 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
396 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
397 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
398 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
399 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
400 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
401 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
402 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
403 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
404 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
405 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
406 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
407 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
408 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
409 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
410 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
411 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
412 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
413 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
414 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
415 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
416 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
417 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
418 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
419 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
420 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
421 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
422 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
423 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
424 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
425 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
426 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
427 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
428 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
429 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
430 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
431 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
432 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
433 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
434 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
435 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
436 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
437 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
442 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
443 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
444 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
445 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
446 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
447 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
448 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
449 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
450 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
453 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
454 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
455 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
463 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
464 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
465 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
468 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
469 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
470 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
471 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
472 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
473 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
474 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
475 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
478 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
479 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
483 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
484 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
485 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
486 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
487 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
488 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
489 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
490 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
491 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
492 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
493 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
494 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
495 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
496 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
497 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
498 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
499 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
500 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
501 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
502 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
503 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
504 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
505 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
506 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
507 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
508 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
509 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
510 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
511 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
512 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
513 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
514 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
515 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
516 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
517 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
518 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
519 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
520 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
521 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
522 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.29
Metatranscriptomes 0.13
Isolates 35.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.94
Nodule 30.78
Rhizoplane 2.6
Rhizosphere 42.73
Stem 0
Stem Tuber 0
Unclassified 8.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2562353 2162886006 Bacteria 984
2 SwRhRL2b_contig_3955086 2162886007 Bacteria 1417
3 JGI24740J21852_10043523 3300001979 Bacteria 1338
4 JGI24735J21928_10092387 3300002067 Bacteria 868
5 JGI24749J21850_1000462 3300002076 Bacteria 5997
6 JGI24751J29686_10000080 3300002459 Bacteria 54264
7 JGI24751J29686_10000081 3300002459 Bacteria 53804
8 JGI24751J29686_10002201 3300002459 Bacteria 3960
9 JGI25156J39149_1011787 3300002705 Bacteria 1959
10 JGI25165J46597_1000079 3300003214 Bacteria 179163
11 rootL2_10186239 3300003322 Bacteria 1239
12 Ga0055542_1000951 3300003762 Bacteria 18980
13 Ga0055529_1009398 3300003763 Bacteria 1284
14 Ga0065704_10116303 3300005289 Bacteria 1856
15 Ga0065712_10167921 3300005290 Bacteria 1261
16 Ga0065715_10207065 3300005293 Bacteria 1332
17 Ga0065707_10082647 3300005295 Bacteria 13064
18 Ga0065707_10141752 3300005295 Bacteria 1763
19 Ga0065707_10231886 3300005295 Bacteria 1186
20 Ga0065707_10380431 3300005295 Bacteria 878
21 Ga0070676_10010997 3300005328 Bacteria 4915
22 Ga0070690_100157457 3300005330 Bacteria 1554
23 Ga0070670_100000003 3300005331 Bacteria 529510
24 Ga0070670_100417861 3300005331 Bacteria 1185
25 Ga0070670_100434494 3300005331 Bacteria 1162
26 Ga0070682_100166249 3300005337 Bacteria 1529
27 Ga0070668_100000045 3300005347 Bacteria 77362
28 Ga0070668_100021139 3300005347 Bacteria 4919
29 Ga0070668_100155178 3300005347 Bacteria 1854
30 Ga0070668_100786227 3300005347 Bacteria 845
31 Ga0070669_100000044 3300005353 Bacteria 121087
32 Ga0070669_100001258 3300005353 Bacteria 18395
33 Ga0070669_100017575 3300005353 Bacteria 5101
34 Ga0070669_100036565 3300005353 Bacteria 3559
35 Ga0070669_101016064 3300005353 Bacteria 712
36 Ga0070671_100000066 3300005355 Bacteria 70998
37 Ga0070671_100001787 3300005355 Bacteria 16331
38 Ga0070671_100002573 3300005355 Bacteria 14068
39 Ga0070667_100000009 3300005367 Bacteria 281488
40 Ga0070667_100021344 3300005367 Bacteria 5378
41 Ga0070667_100034559 3300005367 Bacteria 4230
42 Ga0070667_100074388 3300005367 Bacteria 2898
43 Ga0070667_101045392 3300005367 Bacteria 763
44 Ga0070713_100011267 3300005436 Bacteria 6504
45 Ga0070705_100096833 3300005440 Bacteria 1853
46 Ga0070708_100693105 3300005445 Bacteria 959
47 Ga0070663_100145454 3300005455 Bacteria 1813
48 Ga0070663_100484421 3300005455 Bacteria 1025
49 Ga0068867_100524866 3300005459 Bacteria 1022
50 Ga0070684_101100321 3300005535 Bacteria 747
51 Ga0068853_100012737 3300005539 Bacteria 6847
52 Ga0068853_100315429 3300005539 Bacteria 1448
53 Ga0070665_100000530 3300005548 Bacteria 53943
54 Ga0070665_100169767 3300005548 Bacteria 2183
55 Ga0070665_100175017 3300005548 Bacteria 2147
56 Ga0070665_100407753 3300005548 Bacteria 1367
57 Ga0070665_100710073 3300005548 Bacteria 1018
58 Ga0068855_100028633 3300005563 Bacteria 6665
59 Ga0068855_100314010 3300005563 Bacteria 1733
60 Ga0068855_100656771 3300005563 Bacteria 1126
61 Ga0068857_100015287 3300005577 Bacteria 6700
62 Ga0068857_101402537 3300005577 Bacteria 680
63 Ga0068854_100003080 3300005578 Bacteria 10382
64 Ga0068854_100469225 3300005578 Bacteria 1055
65 Ga0068856_100103164 3300005614 Bacteria 2846
66 Ga0068856_100298031 3300005614 Bacteria 1630
67 Ga0068856_100352559 3300005614 Bacteria 1490
68 Ga0068856_100925274 3300005614 Bacteria 891
69 Ga0068852_100149801 3300005616 Bacteria 2168
70 Ga0068852_100345220 3300005616 Bacteria 1452
71 Ga0068852_100514593 3300005616 Bacteria 1193
72 Ga0068859_100016797 3300005617 Bacteria 7350
73 Ga0068859_100018845 3300005617 Bacteria 6934
74 Ga0068859_100159372 3300005617 Bacteria 2335
75 Ga0068864_100000158 3300005618 Bacteria 62676
76 Ga0068864_100012183 3300005618 Bacteria 7108
77 Ga0068861_100410290 3300005719 Bacteria 1204
78 Ga0068863_100000822 3300005841 Bacteria 31110
79 Ga0068863_100000879 3300005841 Bacteria 30177
80 Ga0068858_100003919 3300005842 Bacteria 14701
81 Ga0068858_100052666 3300005842 Bacteria 3765
82 Ga0068860_100000193 3300005843 Bacteria 97253
83 Ga0068860_100014365 3300005843 Bacteria 7761
84 Ga0068860_100027395 3300005843 Bacteria 5490
85 Ga0068860_100061894 3300005843 Bacteria 3556
86 Ga0068862_100000001 3300005844 Bacteria 523031
87 Ga0068862_100000031 3300005844 Bacteria 180203
88 Ga0068862_101424814 3300005844 Bacteria 697
89 Ga0075365_10130849 3300006038 Bacteria 1736
90 Ga0075365_10239018 3300006038 Bacteria 1276
91 Ga0075368_10001554 3300006042 Bacteria 7370
92 Ga0075368_10015771 3300006042 Bacteria 2808
93 Ga0075368_10116693 3300006042 Bacteria 1103
94 Ga0075363_100013689 3300006048 Bacteria 3943
95 Ga0075363_100038266 3300006048 Bacteria 2522
96 Ga0075363_100061286 3300006048 Bacteria 2027
97 Ga0075363_100354932 3300006048 Bacteria 857
98 Ga0075364_10046622 3300006051 Bacteria 2822
99 Ga0075364_10085148 3300006051 Bacteria 2093
100 Ga0075364_10266176 3300006051 Bacteria 1165
101 Ga0075364_10671225 3300006051 Bacteria 707
102 Ga0075432_10329807 3300006058 Bacteria 641
103 Ga0075362_10000066 3300006177 Bacteria 29420
104 Ga0075362_10009381 3300006177 Bacteria 3785
105 Ga0075362_10030466 3300006177 Bacteria 2330
106 Ga0075362_10070428 3300006177 Bacteria 1596
107 Ga0075362_10148000 3300006177 Bacteria 1125
108 Ga0075367_10004752 3300006178 Bacteria 6681
109 Ga0075367_10030395 3300006178 Bacteria 3097
110 Ga0075367_10120477 3300006178 Bacteria 1616
111 Ga0075367_10438862 3300006178 Bacteria 827
112 Ga0075369_10003434 3300006186 Bacteria 5771
113 Ga0075369_10050354 3300006186 Bacteria 1801
114 Ga0075369_10056869 3300006186 Bacteria 1701
115 Ga0075366_10006178 3300006195 Bacteria 6538
116 Ga0075366_10034299 3300006195 Bacteria 2988
117 Ga0075366_10381965 3300006195 Bacteria 866
118 Ga0075366_10513460 3300006195 Bacteria 741
119 Ga0097621_100051892 3300006237 Bacteria 3339
120 Ga0097621_100070667 3300006237 Bacteria 2883
121 Ga0097621_101054494 3300006237 Bacteria 762
122 Ga0075370_10000055 3300006353 Bacteria 33979
123 Ga0075370_10166361 3300006353 Bacteria 1295
124 Ga0075370_10167035 3300006353 Bacteria 1293
125 Ga0068871_100227713 3300006358 Bacteria 1617
126 Ga0075430_100434060 3300006846 Bacteria 1084
127 Ga0097620_100016796 3300006931 Bacteria 7350
128 Ga0097620_100018845 3300006931 Bacteria 6934
129 Ga0097620_100159381 3300006931 Bacteria 2335
130 Ga0105240_10467642 3300009093 Bacteria 1408
131 Ga0105240_10586721 3300009093 Bacteria 1229
132 Ga0105245_10750740 3300009098 Bacteria 1012
133 Ga0105243_11215062 3300009148 Bacteria 768
134 Ga0105241_10394536 3300009174 Bacteria 1212
135 Ga0105242_10037486 3300009176 Bacteria 3894
136 Ga0105248_10000287 3300009177 Bacteria 59537
137 Ga0105248_10390926 3300009177 Bacteria 1566
138 Ga0105248_11287666 3300009177 Bacteria 827
139 Ga0105237_10126106 3300009545 Bacteria 2554
140 Ga0105237_11112290 3300009545 Bacteria 797
141 Ga0105238_10004938 3300009551 Bacteria 13199
142 Ga0105238_10273152 3300009551 Bacteria 1671
143 Ga0105238_10733426 3300009551 Bacteria 1001
144 Ga0105249_10132768 3300009553 Bacteria 2379
145 Ga0105249_10189138 3300009553 Bacteria 2008
146 Ga0105249_11352463 3300009553 Bacteria 784
147 Ga0105239_10384029 3300010375 Bacteria 1588
148 Ga0105239_10596768 3300010375 Bacteria 1259
149 Ga0105239_11041267 3300010375 Bacteria 941
150 Ga0105246_11093605 3300011119 Bacteria 727
151 Ga0157373_10566969 3300013100 Bacteria 824
152 Ga0157374_10293667 3300013296 Bacteria 1607
153 Ga0163162_10404337 3300013306 Bacteria 1498
154 Ga0163162_10512538 3300013306 Bacteria 1329
155 Ga0157372_10048506 3300013307 Bacteria 4721
156 Ga0157372_10064258 3300013307 Bacteria 4118
157 Ga0157380_10000755 3300014326 Bacteria 20159
158 Ga0157380_10293081 3300014326 Bacteria 1495
159 Ga0182008_10058991 3300014497 Bacteria 1894
160 Ga0157379_10856085 3300014968 Bacteria 860
161 Ga0157376_11333093 3300014969 Bacteria 748
162 Ga0163161_10121940 3300017792 Bacteria 1959
163 Ga0163161_10229857 3300017792 Bacteria 1439
164 Ga0163161_11001700 3300017792 Bacteria 713
165 Ga0213876_10000322 3300021384 Bacteria 41914
166 Ga0213876_10110479 3300021384 Bacteria 1459
167 Ga0213875_10004220 3300021388 Bacteria 7935
168 Ga0213875_10047458 3300021388 Bacteria 2015
169 Ga0209148_1000136 3300025254 Bacteria 169088
170 Ga0209233_1000247 3300025261 Bacteria 87890
171 Ga0209233_1012279 3300025261 Bacteria 2489
172 Ga0209455_1000085 3300025272 Bacteria 247601
173 Ga0209758_1010633 3300025297 Bacteria 5476
174 Ga0207713_1008764 3300025735 Bacteria 5765
175 Ga0207710_10014255 3300025900 Bacteria 3349
176 Ga0207688_10170343 3300025901 Bacteria 1294
177 Ga0207680_10100329 3300025903 Bacteria 1859
178 Ga0207680_10339347 3300025903 Bacteria 1054
179 Ga0207680_10790681 3300025903 Bacteria 680
180 Ga0207647_10072715 3300025904 Bacteria 2073
181 Ga0207645_10016934 3300025907 Bacteria 4816
182 Ga0207705_10602867 3300025909 Bacteria 854
183 Ga0207654_10309471 3300025911 Bacteria 1077
184 Ga0207671_10011582 3300025914 Bacteria 7163
185 Ga0207663_10591179 3300025916 Bacteria 871
186 Ga0207681_10000041 3300025923 Bacteria 140201
187 Ga0207681_10000394 3300025923 Bacteria 30575
188 Ga0207681_10000505 3300025923 Bacteria 27187
189 Ga0207681_10022998 3300025923 Bacteria 3980
190 Ga0207650_10000004 3300025925 Bacteria 743372
191 Ga0207650_10116137 3300025925 Bacteria 2078
192 Ga0207659_10315723 3300025926 Bacteria 1288
193 Ga0207644_10000084 3300025931 Bacteria 69209
194 Ga0207644_10000087 3300025931 Bacteria 67315
195 Ga0207644_10062790 3300025931 Bacteria 2695
196 Ga0207690_10707383 3300025932 Bacteria 829
197 Ga0207669_10309607 3300025937 Bacteria 1204
198 Ga0207669_10797359 3300025937 Bacteria 783
199 Ga0207691_10194840 3300025940 Bacteria 1766
200 Ga0207711_10000658 3300025941 Bacteria 34432
201 Ga0207711_10030728 3300025941 Bacteria 4531
202 Ga0207711_10269870 3300025941 Bacteria 1565
203 Ga0207711_11006526 3300025941 Bacteria 773
204 Ga0207667_10009772 3300025949 Bacteria 11282
205 Ga0207667_10154190 3300025949 Bacteria 2364
206 Ga0207667_10674959 3300025949 Bacteria 1037
207 Ga0207667_11000395 3300025949 Bacteria 823
208 Ga0207712_10081378 3300025961 Bacteria 2358
209 Ga0207712_10183777 3300025961 Bacteria 1644
210 Ga0207668_10000031 3300025972 Bacteria 122168
211 Ga0207668_10012433 3300025972 Bacteria 5211
212 Ga0207668_10497404 3300025972 Bacteria 1048
213 Ga0207640_10150829 3300025981 Bacteria 1708
214 Ga0207640_10232565 3300025981 Bacteria 1419
215 Ga0207658_10000009 3300025986 Bacteria 264118
216 Ga0207658_10002560 3300025986 Bacteria 13206
217 Ga0207658_10010969 3300025986 Bacteria 6170
218 Ga0207658_10074300 3300025986 Bacteria 2583
219 Ga0207703_10003409 3300026035 Bacteria 13340
220 Ga0207703_10053515 3300026035 Bacteria 3281
221 Ga0207639_10796919 3300026041 Bacteria 880
222 Ga0207639_11120032 3300026041 Bacteria 738
223 Ga0207678_10140813 3300026067 Bacteria 2058
224 Ga0207678_10335537 3300026067 Bacteria 1302
225 Ga0207678_10440088 3300026067 Bacteria 1132
226 Ga0207702_10151964 3300026078 Bacteria 2107
227 Ga0207702_10384304 3300026078 Bacteria 1351
228 Ga0207702_10640741 3300026078 Bacteria 1045
229 Ga0207702_11069656 3300026078 Bacteria 800
230 Ga0207641_10000580 3300026088 Bacteria 40301
231 Ga0207641_10005050 3300026088 Bacteria 11306
232 Ga0207641_10033920 3300026088 Bacteria 4243
233 Ga0207676_10000006 3300026095 Bacteria 681936
234 Ga0207676_10008879 3300026095 Bacteria 7149
235 Ga0207676_10073680 3300026095 Bacteria 2749
236 Ga0207674_10021817 3300026116 Bacteria 6892
237 Ga0207674_10167756 3300026116 Bacteria 2149
238 Ga0207674_10894007 3300026116 Bacteria 856
239 Ga0207675_100000309 3300026118 Bacteria 46765
240 Ga0207675_100042371 3300026118 Bacteria 4250
241 Ga0207683_10067864 3300026121 Bacteria 3147
242 Ga0207698_10398965 3300026142 Bacteria 1314
243 Ga0207698_10754272 3300026142 Bacteria 972
244 Ga0209813_10000064 3300027866 Bacteria 43230
245 Ga0209813_10043531 3300027866 Bacteria 1376
246 Ga0209813_10049024 3300027866 Bacteria 1313
247 Ga0268266_10001263 3300028379 Bacteria 30915
248 Ga0268266_10883445 3300028379 Bacteria 864
249 Ga0268265_10000001 3300028380 Bacteria 1230727
250 Ga0268265_10000118 3300028380 Bacteria 99496
251 Ga0268265_10019466 3300028380 Bacteria 4719
252 Ga0268265_11005154 3300028380 Bacteria 824
253 Ga0268264_10000001 3300028381 Bacteria 1221000
254 Ga0268264_10013961 3300028381 Bacteria 6604
255 Ga0268264_10014246 3300028381 Bacteria 6537
256 Ga0268264_10128118 3300028381 Bacteria 2246
257 Ga0307513_10264400 3300031456 Bacteria 1508
258 Ga0307408_100029193 3300031548 Bacteria 3818
259 Ga0307405_10015134 3300031731 Bacteria 4168
260 Ga0307405_10452030 3300031731 Bacteria 1019
261 Ga0307405_10956516 3300031731 Bacteria 728
262 Ga0307413_10870662 3300031824 Bacteria 763
263 Ga0307406_10683182 3300031901 Bacteria 855
264 Ga0307412_10001551 3300031911 Bacteria 12691
265 Ga0307412_10001980 3300031911 Bacteria 11350
266 Ga0307412_10051786 3300031911 Bacteria 2715
267 Ga0307412_10074956 3300031911 Bacteria 2320
268 Ga0307412_10170987 3300031911 Bacteria 1625
269 Ga0307412_10178649 3300031911 Bacteria 1594
270 Ga0307412_10727531 3300031911 Bacteria 854
271 Ga0307414_10000486 3300032004 Bacteria 20663
272 Ga0307414_10157303 3300032004 Bacteria 1801
273 Ga0307411_10143810 3300032005 Bacteria 1762
274 Ga0307510_10381649 3300033180 Bacteria 854
275 Ga0373955_0098514 3300035172 Bacteria 1675
276 Ga0373962_0019321 3300035242 Bacteria 1782
277 Ga0373931_0021413 3300035691 Bacteria 3244
278 Ga0373937_0160065 3300036401 Bacteria 2111
279 Ga0395899_0000014 3300037312 Bacteria 488813
280 Ga0395900_0000007 3300037418 Bacteria 488860
281 Ga0395900_0069262 3300037418 Bacteria 3626
282 Ga0395900_0173763 3300037418 Bacteria 2192
283 Ga0395900_0264908 3300037418 Bacteria 1715
284 Ga0395900_0519780 3300037418 Bacteria 1138
285 Ga0395900_0860138 3300037418 Bacteria 832
286 Ga0395898_0000011 3300037466 Bacteria 488860
287 Ga0395898_1186545 3300037466 Bacteria 695
288 Ga0395905_0000008 3300037471 Bacteria 488860
289 Ga0395905_0029180 3300037471 Bacteria 5199
290 Ga0395905_0032726 3300037471 Bacteria 4887
291 Ga0395905_0063129 3300037471 Bacteria 3465
292 Ga0395905_0220342 3300037471 Bacteria 1776
293 Ga0395905_0821692 3300037471 Bacteria 832
294 Ga0436364_0088168 3300037853 Bacteria 4093
295 Ga0436364_0790157 3300037853 Bacteria 656
296 Ga0436364_0856601 3300037853 Bacteria 10731
297 Ga0436364_1359870 3300037853 Bacteria 3439
298 Ga0436364_1508701 3300037853 Bacteria 2034
299 Ga0395901_0000020 3300038443 Bacteria 314918
300 Ga0395901_0459333 3300038443 Bacteria 1301
301 Ga0436365_0173471 3300039437 Bacteria 110650
302 Ga0436365_0432577 3300039437 Bacteria 641
303 Ga0436365_0997613 3300039437 Bacteria 3241
304 Ga0436365_1559618 3300039437 Bacteria 1048
305 Ga0436365_1750591 3300039437 Bacteria 613
306 Ga0436363_0489279 3300039450 Bacteria 683
307 Ga0436363_1184338 3300039450 Bacteria 22162
308 Ga0439465_0176880 3300041413 Bacteria 771
309 Ga0451797_0546020 3300041453 Bacteria 817
310 Ga0451797_0921940 3300041453 Bacteria 794
311 Ga0451841_0961289 3300041498 Bacteria 1760
312 Ga0439458_0061672 3300042157 Bacteria 937
313 Ga0439460_0046886 3300042461 Bacteria 1285
314 Ga0466972_0012273 3300044658 Bacteria 4306
315 Ga0453684_0064389 3300044712 Bacteria 4684
316 Ga0466960_0035900 3300044901 Bacteria 2319
317 Ga0451576_0480621 3300045051 Bacteria 1305
318 Ga0466967_0441608 3300045976 Bacteria 1271
319 Ga0466967_0477072 3300045976 Bacteria 1222
320 Ga0495638_0047638 3300046460 Bacteria 2686
321 Ga0495653_0169714 3300046463 Bacteria 1507
322 Ga0495610_0065737 3300046512 Bacteria 1710
323 Ga0495637_0071599 3300046520 Bacteria 1398
324 Ga0495643_0046095 3300046522 Bacteria 2365
325 Ga0495643_0065747 3300046522 Bacteria 1914
326 Ga0495648_0149853 3300046524 Bacteria 1218
327 Ga0495654_0162867 3300046530 Bacteria 978
328 Ga0495586_0058619 3300046535 Bacteria 2091
329 Ga0495621_0029886 3300046539 Bacteria 1860
330 Ga0495597_0010903 3300046542 Bacteria 4422
331 Ga0495597_0096249 3300046542 Bacteria 1252
332 Ga0495633_0095646 3300046558 Bacteria 1380
333 Ga0495668_0009397 3300046616 Bacteria 6011
334 Ga0495668_0015679 3300046616 Bacteria 4418
335 Ga0495625_0123923 3300046660 Bacteria 1756
336 Ga0495625_0209302 3300046660 Bacteria 1282
337 Ga0495625_0489786 3300046660 Bacteria 753
338 Ga0495670_0555521 3300046691 Bacteria 625
339 Ga0495649_0238450 3300046694 Bacteria 937
340 Ga0495660_0059355 3300046810 Bacteria 2058
341 Ga0495687_125786 3300047443 Bacteria 917
342 Ga0495686_0222770 3300047472 Bacteria 1072
343 Ga0495615_0000025 3300048090 Bacteria 49753
344 Ga0496100_0247481 3300048903 Bacteria 1317
345 Ga0496101_0009564 3300048904 Bacteria 6375
346 Ga0496102_0155142 3300048905 Bacteria 2152
347 Ga0496102_0309499 3300048905 Bacteria 1489
348 Ga0496102_0591259 3300048905 Bacteria 1033
349 Ga0496103_0008264 3300048906 Bacteria 6180
350 Ga0496103_0144432 3300048906 Bacteria 1523
351 Ga0496104_0028553 3300048907 Bacteria 5170
352 Ga0496105_0116263 3300048908 Bacteria 2206
353 Ga0496106_0009457 3300048909 Bacteria 7206
354 Ga0496107_0000740 3300048910 Bacteria 18701
355 Ga0496107_0763028 3300048910 Bacteria 709
356 Ga0496109_0750467 3300048912 Bacteria 914
357 Ga0496110_0090794 3300048913 Bacteria 2731
358 Ga0496111_0037922 3300048914 Bacteria 3450
359 Ga0496114_1065550 3300048917 Bacteria 693
360 Ga0496115_0083231 3300048918 Bacteria 2608
361 Ga0496118_0088916 3300048921 Bacteria 2134
362 Ga0496118_0201605 3300048921 Bacteria 1178
363 Ga0496119_0060239 3300048922 Bacteria 2274
364 Ga0496119_0074460 3300048922 Bacteria 1977
365 Ga0496120_0002673 3300048923 Bacteria 17544
366 Ga0496121_0002650 3300048924 Bacteria 26852
367 Ga0496121_0087821 3300048924 Bacteria 2439
368 Ga0496121_0153215 3300048924 Bacteria 1694
369 Ga0496121_0649927 3300048924 Bacteria 642
370 Ga0496122_0005810 3300048925 Bacteria 14503
371 Ga0496123_0005504 3300048926 Bacteria 12731
372 Ga0496124_0069030 3300048927 Bacteria 2935
373 Ga0496124_0203651 3300048927 Bacteria 1503
374 Ga0496125_0083970 3300048928 Bacteria 2420
375 Ga0496125_0148194 3300048928 Bacteria 1618
376 Ga0496125_0604038 3300048928 Bacteria 598
377 Ga0501306_010832 3300049127 Bacteria 1154
378 Ga0501031_0000076 3300049568 Bacteria 51870
379 Ga0501032_0000001 3300049569 Bacteria 422097
380 Ga0501032_0000004 3300049569 Bacteria 310855
381 Ga0501033_0000156 3300049570 Bacteria 65847
382 Ga0501033_0000275 3300049570 Bacteria 49587
383 Ga0501033_0243242 3300049570 Bacteria 1276
384 Ga0501033_0682557 3300049570 Bacteria 700
385 Ga0501034_0000011 3300049571 Bacteria 310855
386 Ga0501034_0000036 3300049571 Bacteria 239274
387 Ga0501034_0040933 3300049571 Bacteria 4689
388 Ga0501034_0101428 3300049571 Bacteria 2872
389 Ga0501034_0157893 3300049571 Bacteria 2241
390 Ga0501034_0329833 3300049571 Bacteria 1458
391 Ga0501036_0000001 3300049572 Bacteria 310855
392 Ga0501036_0000358 3300049572 Bacteria 32271
393 Ga0501037_0000064 3300049573 Bacteria 97087
394 Ga0501037_0000091 3300049573 Bacteria 84811
395 Ga0501038_0000003 3300049574 Bacteria 310855
396 Ga0501038_0003916 3300049574 Bacteria 13845
397 Ga0501039_0000004 3300049575 Bacteria 310855
398 Ga0501039_0000011 3300049575 Bacteria 245124
399 Ga0501040_0009503 3300049576 Bacteria 6341
400 Ga0501043_0000016 3300049579 Bacteria 170869
401 Ga0501043_0017948 3300049579 Bacteria 5548
402 Ga0501043_0018243 3300049579 Bacteria 5501
403 Ga0501046_0143406 3300049580 Bacteria 1806
404 Ga0501047_0000876 3300049581 Bacteria 30712
405 Ga0501047_0004675 3300049581 Bacteria 12881
406 Ga0501047_0138675 3300049581 Bacteria 2311
407 Ga0501047_0554912 3300049581 Bacteria 973
408 Ga0501047_0594242 3300049581 Bacteria 929
409 Ga0501070_0009150 3300049586 Bacteria 8377
410 Ga0501070_0164737 3300049586 Bacteria 1827
411 Ga0501072_0641820 3300049588 Bacteria 836
412 Ga0501249_000464 3300049679 Bacteria 10123
413 Ga0501035_0000009 3300049822 Bacteria 310827
414 Ga0501035_0022781 3300049822 Bacteria 5752
415 Ga0501035_0057893 3300049822 Bacteria 3454
416 Ga0501035_0779129 3300049822 Bacteria 765
417 Ga0501044_0000005 3300049823 Bacteria 310855
418 Ga0501044_0021762 3300049823 Bacteria 6837
419 Ga0501044_0042055 3300049823 Bacteria 4756
420 Ga0501044_0241792 3300049823 Bacteria 1749
421 Ga0501044_0472556 3300049823 Bacteria 1158
422 Ga0501204_005586 3300049850 Bacteria 1384
423 nmdc:mga03683_29702_c1 3300050489 Bacteria 2181
424 nmdc:mga03683_5140_c2 3300050489 Bacteria 3055
425 nmdc:mga03683_55_c1 3300050489 Bacteria 47333
426 nmdc:mga03n38_29730_c1 3300050490 Bacteria 2289
427 nmdc:mga03n38_3343_c1 3300050490 Bacteria 5134
428 nmdc:mga03n38_370229_c1 3300050490 Bacteria 783
429 nmdc:mga03n38_71670_c1 3300050490 Bacteria 1605
430 nmdc:mga00v17_1644_c1 3300050491 Bacteria 11664
431 nmdc:mga00v17_257278_c1 3300050491 Bacteria 1132
432 nmdc:mga00v17_270354_c1 3300050491 Bacteria 1103
433 nmdc:mga00v17_43681_c1 3300050491 Bacteria 2700
434 nmdc:mga0yw44_156695_c1 3300050492 Bacteria 1489
435 nmdc:mga0yw44_162014_c1 3300050492 Bacteria 1465
436 nmdc:mga0yw44_245944_c1 3300050492 Bacteria 1190
437 nmdc:mga0yw44_73747_c1 3300050492 Bacteria 2124
438 nmdc:mga0k408_1951_c1 3300050493 Bacteria 11058
439 nmdc:mga0k408_450637_c1 3300050493 Bacteria 764
440 nmdc:mga06z11_1082_c1 3300050494 Bacteria 9916
441 nmdc:mga06z11_309815_c1 3300050494 Bacteria 940
442 nmdc:mga06z11_31721_c1 3300050494 Bacteria 2570
443 nmdc:mga06z11_80514_c1 3300050494 Bacteria 1746
444 nmdc:mga04h51_1318_c1 3300050495 Bacteria 5720
445 nmdc:mga04h51_145057_c1 3300050495 Bacteria 903
446 nmdc:mga04h51_58792_c1 3300050495 Bacteria 1312
447 nmdc:mga07m45_169244_c1 3300050496 Bacteria 1270
448 nmdc:mga07m45_185778_c1 3300050496 Bacteria 1209
449 nmdc:mga07m45_27326_c1 3300050496 Bacteria 3142
450 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
451 nmdc:mga07m45_55_c1 3300050496 Bacteria 47453
452 nmdc:mga0sz30_132359_c1 3300050516 Bacteria 1099
453 nmdc:mga0sz30_2912_c1 3300050516 Bacteria 6133
454 nmdc:mga0sz30_303_c1 3300050516 Bacteria 18938
455 Ga0495612_0476998 3300053078 Bacteria 571
456 Ga0500610_0026528 3300053079 Bacteria 2899
457 Ga0495655_0008528 3300053083 Bacteria 1951
458 Ga0500643_000167 3300053087 Bacteria 64874
459 Ga0500643_039415 3300053087 Bacteria 1396
460 Ga0500643_057773 3300053087 Bacteria 1094
461 Ga0500644_0007223 3300053088 Bacteria 2885
462 Ga0500647_0059268 3300053091 Bacteria 1841
463 Ga0500647_0200154 3300053091 Bacteria 906
464 Ga0500651_0002180 3300053093 Bacteria 10245
465 Ga0500641_0023205 3300053096 Bacteria 2384
466 Ga0500594_0117019 3300053118 Bacteria 834
467 Ga0500595_049173 3300053119 Bacteria 1315
468 Ga0500607_000354 3300053121 Bacteria 43487
469 Ga0500607_075177 3300053121 Bacteria 1735
470 Ga0500608_000755 3300053122 Bacteria 11796
471 Ga0500618_027385 3300053125 Bacteria 1356
472 Ga0500642_0001008 3300053130 Bacteria 8079
473 Ga0500655_000162 3300053133 Bacteria 16347
474 Ga0500559_0006081 3300053136 Bacteria 5469
475 Ga0500559_0015561 3300053136 Bacteria 3212
476 Ga0500564_015388 3300053138 Bacteria 3454
477 Ga0500568_0000052 3300053139 Bacteria 112079
478 Ga0500568_0105762 3300053139 Bacteria 1054
479 Ga0500590_000967 3300053148 Bacteria 11087
480 Ga0500616_0065036 3300053153 Bacteria 1876
481 Ga0500620_001541 3300053155 Bacteria 4306
482 Ga0500620_034796 3300053155 Bacteria 1619
483 Ga0500622_0000145 3300053156 Bacteria 75417
484 Ga0500622_0000446 3300053156 Bacteria 39340
485 Ga0500622_0006224 3300053156 Bacteria 6981
486 Ga0500627_0031410 3300053158 Bacteria 2230
487 Ga0500627_0321403 3300053158 Bacteria 672
488 Ga0500639_016444 3300053163 Bacteria 3901
489 Ga0500636_0148639 3300053177 Bacteria 1289
490 Ga0500637_0006247 3300053178 Bacteria 5850
491 Ga0500567_000039 3300053723 Bacteria 27122
492 Ga0500570_005298 3300053724 Bacteria 6886
493 Ga0500611_006335 3300053727 Bacteria 1718
494 Ga0500611_020789 3300053727 Bacteria 1244
495 Ga0500625_000021 3300053729 Bacteria 83503
496 Ga0500645_007973 3300053730 Bacteria 3649

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0763028 Ga0496107_0763028_15_449 140
2 3300014969 Ga0157376_11333093 Ga0157376_113330931 143
3 3300005328 Ga0070676_10010997 Ga0070676_100109972 145
4 3300009148 Ga0105243_11215062 Ga0105243_112150622 145
5 3300009176 Ga0105242_10037486 Ga0105242_100374863 145
6 3300025907 Ga0207645_10016934 Ga0207645_100169345 145
7 3300026116 Ga0207674_10894007 Ga0207674_108940072 145
8 3300006846 Ga0075430_100434060 Ga0075430_1004340602 148
9 3300046463 Ga0495653_0169714 Ga0495653_0169714_11_520 152
10 3300039437 Ga0436365_1750591 Ga0436365_1750591_62_580 153
11 3300039450 Ga0436363_1184338 Ga0436363_1184338_20560_21078 153
12 iso_pu_bacteria 2977971508 2977973602 153
13 3300053078 Ga0495612_0476998 Ga0495612_0476998_12_533 155
14 3300045976 Ga0466967_0477072 Ga0466967_0477072_407_925 156
15 iso_pu_bacteria 2958041894 2958045422 160
16 3300053158 Ga0500627_0321403 Ga0500627_0321403_20_538 164
17 iso_pu_bacteria 2503198000 2503198611 164
18 iso_pu_bacteria 2508501123 2509115720 164
19 iso_pu_bacteria 2509276018 2509368653 164
20 iso_pu_bacteria 2509276022 2509393398 164
21 iso_pu_bacteria 2510065059 2510314944 164
22 iso_pu_bacteria 2512875016 2512933949 164
23 iso_pu_bacteria 2513237090 2513610523 164
24 iso_pu_bacteria 2513237164 2514037130 164
25 iso_pu_bacteria 2513237305 2514417590 164
26 iso_pu_bacteria 2513237351 2514586117 164
27 iso_pu_bacteria 2588253730 2588520059 164
28 iso_pu_bacteria 2599185301 2599940146 164
29 iso_pu_bacteria 2643221550 2643770760 164
30 iso_pu_bacteria 2643221551 2643777750 164
31 iso_pu_bacteria 2643221555 2643796198 164
32 iso_pu_bacteria 2643221564 2643839683 164
33 iso_pu_bacteria 2643221595 2643983581 164
34 iso_pu_bacteria 2643221627 2644157222 164
35 iso_pu_bacteria 2687453392 2688595908 164
36 iso_pu_bacteria 2693429783 2694627849 164
37 iso_pu_bacteria 2693429784 2694636099 164
38 iso_pu_bacteria 2721755686 2723573169 164
39 iso_pu_bacteria 2756170246 2756674997 164
40 iso_pu_bacteria 2791355123 2792747099 164
41 iso_pu_bacteria 2844002411 2844003519 164
42 iso_pu_bacteria 2844009547 2844010721 164
43 iso_pu_bacteria 2847670302 2847673471 164
44 iso_pu_bacteria 2847686936 2847689979 164
45 iso_pu_bacteria 2856314179 2856319060 164
46 iso_pu_bacteria 2856320880 2856321054 164
47 iso_pu_bacteria 2856328259 2856332606 164
48 iso_pu_bacteria 2856334872 2856340594 164
49 iso_pu_bacteria 2856349417 2856350724 164
50 iso_pu_bacteria 2856356410 2856359910 164
51 iso_pu_bacteria 2856364286 2856369834 164
52 iso_pu_bacteria 2857349434 2857352974 164
53 iso_pu_bacteria 2869169390 2869171510 164
54 iso_pu_bacteria 2869234852 2869238090 164
55 iso_pu_bacteria 2869242130 2869249291 164
56 iso_pu_bacteria 2869249662 2869255393 164
57 iso_pu_bacteria 2869256925 2869262815 164
58 iso_pu_bacteria 2869264136 2869267728 164
59 iso_pu_bacteria 2869271264 2869273191 164
60 iso_pu_bacteria 2869278585 2869280713 164
61 iso_pu_bacteria 2869285874 2869290641 164
62 iso_pu_bacteria 2871429161 2871432923 164
63 iso_pu_bacteria 2871435913 2871437845 164
64 iso_pu_bacteria 2871444079 2871448569 164
65 iso_pu_bacteria 2871451962 2871454414 164
66 iso_pu_bacteria 2871459585 2871462749 164
67 iso_pu_bacteria 2871466892 2871472171 164
68 iso_pu_bacteria 2871481445 2871484714 164
69 iso_pu_bacteria 2871488783 2871489775 164
70 iso_pu_bacteria 2871495908 2871499854 164
71 iso_pu_bacteria 2874102143 2874107725 164
72 iso_pu_bacteria 2874109183 2874110830 164
73 iso_pu_bacteria 2874116593 2874121831 164
74 iso_pu_bacteria 2874123672 2874128410 164
75 iso_pu_bacteria 2874131515 2874133839 164
76 iso_pu_bacteria 2874139085 2874143149 164
77 iso_pu_bacteria 2874146452 2874153916 164
78 iso_pu_bacteria 2874155637 2874158604 164
79 iso_pu_bacteria 2874162495 2874165838 164
80 iso_pu_bacteria 2874168670 2874172362 164
81 iso_pu_bacteria 2876363079 2876363796 164
82 iso_pu_bacteria 2876369609 2876372938 164
83 iso_pu_bacteria 2876377896 2876384214 164
84 iso_pu_bacteria 2876386047 2876389784 164
85 iso_pu_bacteria 2876392853 2876397000 164
86 iso_pu_bacteria 2876399893 2876403201 164
87 iso_pu_bacteria 2876406927 2876413821 164
88 iso_pu_bacteria 2876413966 2876419221 164
89 iso_pu_bacteria 2876420981 2876425889 164
90 iso_pu_bacteria 2878035449 2878039449 164
91 iso_pu_bacteria 2878730984 2878737732 164
92 iso_pu_bacteria 2878738818 2878740786 164
93 iso_pu_bacteria 2878745973 2878750536 164
94 iso_pu_bacteria 2878753008 2878754189 164
95 iso_pu_bacteria 2878760144 2878764018 164
96 iso_pu_bacteria 2878767105 2878771048 164
97 iso_pu_bacteria 2878774303 2878776836 164
98 iso_pu_bacteria 2878781027 2878787044 164
99 iso_pu_bacteria 2881147464 2881148238 164
100 iso_pu_bacteria 2881155292 2881159322 164
101 iso_pu_bacteria 2881161766 2881165022 164
102 iso_pu_bacteria 2881845957 2881847884 164
103 iso_pu_bacteria 2881853255 2881855913 164
104 iso_pu_bacteria 2881861095 2881864572 164
105 iso_pu_bacteria 2882632389 2882636770 164
106 iso_pu_bacteria 2882912400 2882912532 164
107 iso_pu_bacteria 2885318864 2885319432 164
108 iso_pu_bacteria 2885342637 2885349295 164
109 iso_pu_bacteria 2885350715 2885352064 164
110 iso_pu_bacteria 2888337043 2888343157 164
111 iso_pu_bacteria 2888350351 2888353149 164
112 iso_pu_bacteria 2889010040 2889014953 164
113 iso_pu_bacteria 2889016732 2889019976 164
114 iso_pu_bacteria 2903492973 2903497496 164
115 iso_pu_bacteria 2903492973 2903499618 164
116 iso_pu_bacteria 2903513507 2903517449 164
117 iso_pu_bacteria 2903521522 2903526045 164
118 iso_pu_bacteria 2903528002 2903532409 164
119 iso_pu_bacteria 2903540706 2903544665 164
120 iso_pu_bacteria 2904659560 2904663754 164
121 iso_pu_bacteria 2906308376 2906313461 164
122 iso_pu_bacteria 2906321335 2906326170 164
123 iso_pu_bacteria 2906328253 2906334158 164
124 iso_pu_bacteria 2906354277 2906361415 164
125 iso_pu_bacteria 2906363423 2906363624 164
126 iso_pu_bacteria 2906370794 2906377906 164
127 iso_pu_bacteria 2906386501 2906393087 164
128 iso_pu_bacteria 2906393657 2906397125 164
129 iso_pu_bacteria 2906401398 2906408167 164
130 iso_pu_bacteria 2906408224 2906409148 164
131 iso_pu_bacteria 2906414383 2906419131 164
132 iso_pu_bacteria 2906427513 2906433985 164
133 iso_pu_bacteria 2922130491 2922135557 164
134 iso_pu_bacteria 2922151315 2922153631 164
135 iso_pu_bacteria 2922158528 2922162000 164
136 iso_pu_bacteria 2922172374 2922174300 164
137 iso_pu_bacteria 2922178524 2922181855 164
138 iso_pu_bacteria 2922185730 2922190801 164
139 iso_pu_bacteria 2924710171 2924716360 164
140 iso_pu_bacteria 2924718760 2924726442 164
141 iso_pu_bacteria 2924726620 2924731435 164
142 iso_pu_bacteria 2924733363 2924737479 164
143 iso_pu_bacteria 2924741084 2924741560 164
144 iso_pu_bacteria 2924748358 2924753194 164
145 iso_pu_bacteria 2924762789 2924766142 164
146 iso_pu_bacteria 2924776078 2924778387 164
147 iso_pu_bacteria 2924784321 2924784878 164
148 iso_pu_bacteria 2937813078 2937820235 164
149 iso_pu_bacteria 2937822353 2937822672 164
150 iso_pu_bacteria 2937861824 2937863134 164
151 iso_pu_bacteria 2937868953 2937870780 164
152 iso_pu_bacteria 2937877337 2937878186 164
153 iso_pu_bacteria 2937891427 2937891752 164
154 iso_pu_bacteria 2937972304 2937980097 164
155 iso_pu_bacteria 2937980651 2937988243 164
156 iso_pu_bacteria 2937994558 2937998513 164
157 iso_pu_bacteria 2938014810 2938018496 164
158 iso_pu_bacteria 2958034702 2958036586 164
159 iso_pu_bacteria 2958041894 2958046525 164
160 iso_pu_bacteria 2958064165 2958066875 164
161 iso_pu_bacteria 2958084443 2958085301 164
162 iso_pu_bacteria 2958092219 2958094947 164
163 iso_pu_bacteria 2958100919 2958106567 164
164 iso_pu_bacteria 2958108152 2958113510 164
165 iso_pu_bacteria 2958115193 2958119140 164
166 iso_pu_bacteria 2958122699 2958125517 164
167 iso_pu_bacteria 2958130278 2958135041 164
168 iso_pu_bacteria 2958137437 2958143414 164
169 iso_pu_bacteria 2958144490 2958145648 164
170 iso_pu_bacteria 2958158011 2958164465 164
171 iso_pu_bacteria 2958165035 2958168989 164
172 iso_pu_bacteria 2958172287 2958172880 164
173 iso_pu_bacteria 2958179912 2958184070 164
174 iso_pu_bacteria 2961077736 2961082125 164
175 iso_pu_bacteria 2961114664 2961119106 164
176 iso_pu_bacteria 2961127735 2961127770 164
177 iso_pu_bacteria 2961136820 2961139871 164
178 iso_pu_bacteria 2961163497 2961167451 164
179 iso_pu_bacteria 2961170736 2961176248 164
180 iso_pu_bacteria 2961183825 2961185567 164
181 iso_pu_bacteria 2963644680 2963645255 164
182 iso_pu_bacteria 2965018300 2965022273 164
183 iso_pu_bacteria 2965025482 2965030054 164
184 iso_pu_bacteria 2965032056 2965038574 164
185 iso_pu_bacteria 2965040258 2965045979 164
186 iso_pu_bacteria 2965047637 2965051573 164
187 iso_pu_bacteria 2965062239 2965068533 164
188 iso_pu_bacteria 2965089291 2965096081 164
189 iso_pu_bacteria 2965110997 2965116938 164
190 iso_pu_bacteria 2965119406 2965120997 164
191 iso_pu_bacteria 2967996073 2967996838 164
192 iso_pu_bacteria 2968003550 2968004901 164
193 iso_pu_bacteria 2968016561 2968023133 164
194 iso_pu_bacteria 2968091066 2968093569 164
195 iso_pu_bacteria 2968097103 2968101386 164
196 iso_pu_bacteria 2968110612 2968114893 164
197 iso_pu_bacteria 2968117919 2968122624 164
198 iso_pu_bacteria 2968128360 2968134002 164
199 iso_pu_bacteria 2968138860 2968141793 164
200 iso_pu_bacteria 2968171901 2968175858 164
201 iso_pu_bacteria 2970469710 2970475717 164
202 iso_pu_bacteria 2970489779 2970491967 164
203 iso_pu_bacteria 2970503327 2970508919 164
204 iso_pu_bacteria 2970510686 2970513403 164
205 iso_pu_bacteria 2970532167 2970536619 164
206 iso_pu_bacteria 2970547951 2970553495 164
207 iso_pu_bacteria 2970554993 2970558862 164
208 iso_pu_bacteria 2970593180 2970595419 164
209 iso_pu_bacteria 2970619444 2970623095 164
210 iso_pu_bacteria 2970627176 2970632753 164
211 iso_pu_bacteria 2977821940 2977823404 164
212 iso_pu_bacteria 2977828996 2977830540 164
213 iso_pu_bacteria 2977843712 2977847072 164
214 iso_pu_bacteria 2977851361 2977854650 164
215 iso_pu_bacteria 2977858184 2977864175 164
216 iso_pu_bacteria 2977864932 2977868140 164
217 iso_pu_bacteria 2977872689 2977876554 164
218 iso_pu_bacteria 2977898635 2977902394 164
219 iso_pu_bacteria 2977907340 2977911571 164
220 iso_pu_bacteria 2977915119 2977921208 164
221 iso_pu_bacteria 2977935797 2977941023 164
222 iso_pu_bacteria 2977942078 2977943311 164
223 iso_pu_bacteria 2977950692 2977956005 164
224 iso_pu_bacteria 2977957713 2977958891 164
225 iso_pu_bacteria 2979710463 2979713783 164
226 iso_pu_bacteria 2979742915 2979750500 164
227 iso_pu_bacteria 2979764755 2979767571 164
228 iso_pu_bacteria 2979772303 2979773559 164
229 iso_pu_bacteria 2979779861 2979786402 164
230 iso_pu_bacteria 2979793036 2979800624 164
231 iso_pu_bacteria 2979808191 2979813598 164
232 iso_pu_bacteria 2987636660 2987641566 164
233 iso_pu_bacteria 2987645492 2987650037 164
234 iso_pu_bacteria 2987652177 2987653434 164
235 iso_pu_bacteria 2987659509 2987663457 164
236 iso_pu_bacteria 2987666974 2987666980 164
237 iso_pu_bacteria 2987673487 2987674909 164
238 iso_pu_bacteria 2996341866 2996341937 164
239 iso_pu_bacteria 2996348954 2996355655 164
240 iso_pu_bacteria 2996386984 2996387140 164
241 iso_pu_bacteria 3000135777 3000137324 164
242 iso_pu_bacteria 3004167301 3004173188 164
243 iso_pu_bacteria 3004188549 3004192516 164
244 iso_pu_bacteria 3004195979 3004199975 164
245 iso_pu_bacteria 3004203850 3004209623 164
246 iso_pu_bacteria 3004232784 3004233735 164
247 iso_pu_bacteria 3004239961 3004246792 164
248 iso_pu_bacteria 3004248173 3004251073 164
249 iso_pu_bacteria 3004275668 3004282081 164
250 iso_pu_bacteria 637000159 637077102 164
251 iso_pu_bacteria 649633066 649870475 164
252 iso_pu_bacteria 8004300914 8004301204 164
253 iso_pu_bacteria 8004312739 8004314907 164
254 iso_pu_bacteria 8004361976 8004362751 164
255 iso_pu_bacteria 8004374579 8004375766 164
256 iso_pu_bacteria 8004387939 8004392930 164
257 iso_pu_bacteria 8004445564 8004449460 164
258 iso_pu_bacteria 8004640170 8004643877 164
259 iso_pu_bacteria 8004695233 8004700944 164
260 iso_pu_bacteria 8004703790 8004706723 164
261 iso_pu_bacteria 8004714634 8004719717 164
262 iso_pu_bacteria 8004727605 8004731084 164
263 3300017792 Ga0163161_11001700 Ga0163161_110017001 165
264 3300049823 Ga0501044_0472556 Ga0501044_0472556_486_992 165
265 iso_pu_bacteria 2597489875 2597810308 165
266 iso_pu_bacteria 2856342000 2856345141 165
267 iso_pu_bacteria 2869162929 2869163405 165
268 iso_pu_bacteria 2878788777 2878796312 165
269 iso_pu_bacteria 2885312484 2885314221 165
270 iso_pu_bacteria 2888343758 2888344292 165
271 iso_pu_bacteria 2924754689 2924758515 165
272 iso_pu_bacteria 2958071322 2958077254 165
273 iso_pu_bacteria 2970524798 2970525973 165
274 iso_pu_bacteria 2970540015 2970543677 165
275 iso_pu_bacteria 3005445848 3005452485 165
276 iso_pu_bacteria 8004395343 8004398951 165
277 iso_pu_bacteria 8055617313 8055617806 165
278 3300021384 Ga0213876_10110479 Ga0213876_101104791 166
279 3300021388 Ga0213875_10004220 Ga0213875_100042207 166
280 3300021388 Ga0213875_10047458 Ga0213875_100474582 166
281 3300037853 Ga0436364_0088168 Ga0436364_0088168_144_698 166
282 3300037853 Ga0436364_0790157 Ga0436364_0790157_56_586 166
283 3300037853 Ga0436364_1359870 Ga0436364_1359870_1095_1649 166
284 3300037853 Ga0436364_1508701 Ga0436364_1508701_149_685 166
285 3300039437 Ga0436365_0432577 Ga0436365_0432577_54_584 166
286 3300039437 Ga0436365_0997613 Ga0436365_0997613_104_658 166
287 3300049570 Ga0501033_0682557 Ga0501033_0682557_126_635 166
288 iso_pu_bacteria 2996336353 2996336854 166
289 iso_pu_bacteria 2906378014 2906383300 167
290 3300001979 JGI24740J21852_10043523 JGI24740J21852_100435232 168
291 3300002067 JGI24735J21928_10092387 JGI24735J21928_100923871 168
292 3300002705 JGI25156J39149_1011787 JGI25156J39149_10117872 168
293 3300003214 JGI25165J46597_1000079 JGI25165J46597_100007985 168
294 3300003322 rootL2_10186239 rootL2_101862392 168
295 3300003762 Ga0055542_1000951 Ga0055542_10009518 168
296 3300003763 Ga0055529_1009398 Ga0055529_10093982 168
297 3300005293 Ga0065715_10207065 Ga0065715_102070652 168
298 3300005331 Ga0070670_100417861 Ga0070670_1004178612 168
299 3300005353 Ga0070669_101016064 Ga0070669_1010160641 168
300 3300005367 Ga0070667_101045392 Ga0070667_1010453921 168
301 3300005436 Ga0070713_100011267 Ga0070713_1000112672 168
302 3300005455 Ga0070663_100484421 Ga0070663_1004844212 168
303 3300005459 Ga0068867_100524866 Ga0068867_1005248662 168
304 3300005535 Ga0070684_101100321 Ga0070684_1011003211 168
305 3300005539 Ga0068853_100012737 Ga0068853_1000127372 168
306 3300005539 Ga0068853_100315429 Ga0068853_1003154292 168
307 3300005548 Ga0070665_100407753 Ga0070665_1004077532 168
308 3300005548 Ga0070665_100710073 Ga0070665_1007100732 168
309 3300005563 Ga0068855_100656771 Ga0068855_1006567712 168
310 3300005577 Ga0068857_101402537 Ga0068857_1014025371 168
311 3300005578 Ga0068854_100469225 Ga0068854_1004692251 168
312 3300005614 Ga0068856_100103164 Ga0068856_1001031644 168
313 3300005614 Ga0068856_100298031 Ga0068856_1002980312 168
314 3300005614 Ga0068856_100352559 Ga0068856_1003525592 168
315 3300005614 Ga0068856_100925274 Ga0068856_1009252741 168
316 3300005616 Ga0068852_100149801 Ga0068852_1001498012 168
317 3300005616 Ga0068852_100514593 Ga0068852_1005145932 168
318 3300006038 Ga0075365_10239018 Ga0075365_102390182 168
319 3300006042 Ga0075368_10015771 Ga0075368_100157714 168
320 3300006042 Ga0075368_10116693 Ga0075368_101166931 168
321 3300006048 Ga0075363_100038266 Ga0075363_1000382664 168
322 3300006048 Ga0075363_100354932 Ga0075363_1003549322 168
323 3300006051 Ga0075364_10266176 Ga0075364_102661762 168
324 3300006051 Ga0075364_10671225 Ga0075364_106712252 168
325 3300006177 Ga0075362_10070428 Ga0075362_100704282 168
326 3300006177 Ga0075362_10148000 Ga0075362_101480002 168
327 3300006178 Ga0075367_10030395 Ga0075367_100303952 168
328 3300006178 Ga0075367_10120477 Ga0075367_101204772 168
329 3300006186 Ga0075369_10056869 Ga0075369_100568691 168
330 3300006237 Ga0097621_100051892 Ga0097621_1000518924 168
331 3300006237 Ga0097621_100070667 Ga0097621_1000706672 168
332 3300006237 Ga0097621_101054494 Ga0097621_1010544941 168
333 3300006358 Ga0068871_100227713 Ga0068871_1002277131 168
334 3300009093 Ga0105240_10467642 Ga0105240_104676421 168
335 3300009093 Ga0105240_10586721 Ga0105240_105867212 168
336 3300009098 Ga0105245_10750740 Ga0105245_107507402 168
337 3300009174 Ga0105241_10394536 Ga0105241_103945362 168
338 3300009177 Ga0105248_10390926 Ga0105248_103909262 168
339 3300009545 Ga0105237_10126106 Ga0105237_101261063 168
340 3300009545 Ga0105237_11112290 Ga0105237_111122901 168
341 3300009551 Ga0105238_10004938 Ga0105238_1000493812 168
342 3300009553 Ga0105249_11352463 Ga0105249_113524632 168
343 3300010375 Ga0105239_10384029 Ga0105239_103840292 168
344 3300010375 Ga0105239_10596768 Ga0105239_105967681 168
345 3300010375 Ga0105239_11041267 Ga0105239_110412672 168
346 3300011119 Ga0105246_11093605 Ga0105246_110936051 168
347 3300013100 Ga0157373_10566969 Ga0157373_105669691 168
348 3300013296 Ga0157374_10293667 Ga0157374_102936674 168
349 3300013306 Ga0163162_10512538 Ga0163162_105125382 168
350 3300013307 Ga0157372_10048506 Ga0157372_100485061 168
351 3300013307 Ga0157372_10064258 Ga0157372_100642583 168
352 3300014497 Ga0182008_10058991 Ga0182008_100589912 168
353 3300021384 Ga0213876_10000322 Ga0213876_1000032241 168
354 3300025254 Ga0209148_1000136 Ga0209148_100013649 168
355 3300025261 Ga0209233_1000247 Ga0209233_10002475 168
356 3300025261 Ga0209233_1012279 Ga0209233_10122792 168
357 3300025272 Ga0209455_1000085 Ga0209455_100008572 168
358 3300025297 Ga0209758_1010633 Ga0209758_10106332 168
359 3300025901 Ga0207688_10170343 Ga0207688_101703431 168
360 3300025903 Ga0207680_10790681 Ga0207680_107906811 168
361 3300025904 Ga0207647_10072715 Ga0207647_100727152 168
362 3300025911 Ga0207654_10309471 Ga0207654_103094711 168
363 3300025914 Ga0207671_10011582 Ga0207671_100115824 168
364 3300025916 Ga0207663_10591179 Ga0207663_105911792 168
365 3300025932 Ga0207690_10707383 Ga0207690_107073831 168
366 3300025937 Ga0207669_10309607 Ga0207669_103096072 168
367 3300025937 Ga0207669_10797359 Ga0207669_107973591 168
368 3300025940 Ga0207691_10194840 Ga0207691_101948402 168
369 3300025941 Ga0207711_11006526 Ga0207711_110065261 168
370 3300025949 Ga0207667_10674959 Ga0207667_106749592 168
371 3300025949 Ga0207667_11000395 Ga0207667_110003951 168
372 3300025981 Ga0207640_10232565 Ga0207640_102325651 168
373 3300026041 Ga0207639_10796919 Ga0207639_107969192 168
374 3300026041 Ga0207639_11120032 Ga0207639_111200321 168
375 3300026067 Ga0207678_10140813 Ga0207678_101408132 168
376 3300026067 Ga0207678_10440088 Ga0207678_104400882 168
377 3300026078 Ga0207702_10151964 Ga0207702_101519642 168
378 3300026078 Ga0207702_10384304 Ga0207702_103843042 168
379 3300026078 Ga0207702_10640741 Ga0207702_106407412 168
380 3300026078 Ga0207702_11069656 Ga0207702_110696561 168
381 3300026116 Ga0207674_10167756 Ga0207674_101677563 168
382 3300026121 Ga0207683_10067864 Ga0207683_100678642 168
383 3300026142 Ga0207698_10754272 Ga0207698_107542721 168
384 3300027866 Ga0209813_10043531 Ga0209813_100435312 168
385 3300027866 Ga0209813_10049024 Ga0209813_100490242 168
386 3300028379 Ga0268266_10883445 Ga0268266_108834452 168
387 3300031456 Ga0307513_10264400 Ga0307513_102644002 168
388 3300031911 Ga0307412_10170987 Ga0307412_101709874 168
389 3300035172 Ga0373955_0098514 Ga0373955_0098514_1021_1602 168
390 3300036401 Ga0373937_0160065 Ga0373937_0160065_45_605 168
391 3300037312 Ga0395899_0000014 Ga0395899_0000014_440913_441443 168
392 3300037418 Ga0395900_0000007 Ga0395900_0000007_440932_441462 168
393 3300037418 Ga0395900_0069262 Ga0395900_0069262_2458_2988 168
394 3300037418 Ga0395900_0173763 Ga0395900_0173763_851_1381 168
395 3300037418 Ga0395900_0264908 Ga0395900_0264908_220_750 168
396 3300037418 Ga0395900_0519780 Ga0395900_0519780_373_903 168
397 3300037418 Ga0395900_0860138 Ga0395900_0860138_25_555 168
398 3300037466 Ga0395898_0000011 Ga0395898_0000011_47399_47929 168
399 3300037466 Ga0395898_1186545 Ga0395898_1186545_52_564 168
400 3300037471 Ga0395905_0000008 Ga0395905_0000008_440932_441462 168
401 3300037471 Ga0395905_0029180 Ga0395905_0029180_3901_4431 168
402 3300037471 Ga0395905_0032726 Ga0395905_0032726_3805_4317 168
403 3300037471 Ga0395905_0063129 Ga0395905_0063129_1384_1914 168
404 3300037471 Ga0395905_0220342 Ga0395905_0220342_51_581 168
405 3300037471 Ga0395905_0821692 Ga0395905_0821692_147_677 168
406 3300037853 Ga0436364_0856601 Ga0436364_0856601_3661_4320 168
407 3300038443 Ga0395901_0000020 Ga0395901_0000020_266990_267520 168
408 3300038443 Ga0395901_0459333 Ga0395901_0459333_196_726 168
409 3300039437 Ga0436365_0173471 Ga0436365_0173471_98089_98607 168
410 3300039450 Ga0436363_0489279 Ga0436363_0489279_75_647 168
411 3300041413 Ga0439465_0176880 Ga0439465_0176880_183_713 168
412 3300042157 Ga0439458_0061672 Ga0439458_0061672_132_662 168
413 3300042461 Ga0439460_0046886 Ga0439460_0046886_34_651 168
414 3300044658 Ga0466972_0012273 Ga0466972_0012273_3360_3890 168
415 3300044901 Ga0466960_0035900 Ga0466960_0035900_1569_2099 168
416 3300045976 Ga0466967_0441608 Ga0466967_0441608_499_1029 168
417 3300046460 Ga0495638_0047638 Ga0495638_0047638_249_761 168
418 3300046512 Ga0495610_0065737 Ga0495610_0065737_93_623 168
419 3300046520 Ga0495637_0071599 Ga0495637_0071599_626_1156 168
420 3300046522 Ga0495643_0065747 Ga0495643_0065747_1093_1623 168
421 3300046535 Ga0495586_0058619 Ga0495586_0058619_206_748 168
422 3300046542 Ga0495597_0096249 Ga0495597_0096249_149_679 168
423 3300046660 Ga0495625_0489786 Ga0495625_0489786_207_737 168
424 3300046694 Ga0495649_0238450 Ga0495649_0238450_223_753 168
425 3300046810 Ga0495660_0059355 Ga0495660_0059355_276_806 168
426 3300047443 Ga0495687_125786 Ga0495687_125786_54_584 168
427 3300047472 Ga0495686_0222770 Ga0495686_0222770_109_639 168
428 3300048905 Ga0496102_0309499 Ga0496102_0309499_67_696 168
429 3300048905 Ga0496102_0591259 Ga0496102_0591259_332_862 168
430 3300048906 Ga0496103_0144432 Ga0496103_0144432_79_609 168
431 3300048912 Ga0496109_0750467 Ga0496109_0750467_113_643 168
432 3300048917 Ga0496114_1065550 Ga0496114_1065550_34_564 168
433 3300048918 Ga0496115_0083231 Ga0496115_0083231_140_670 168
434 3300048921 Ga0496118_0201605 Ga0496118_0201605_68_616 168
435 3300048922 Ga0496119_0060239 Ga0496119_0060239_1608_2138 168
436 3300048922 Ga0496119_0074460 Ga0496119_0074460_615_1145 168
437 3300048923 Ga0496120_0002673 Ga0496120_0002673_5096_5626 168
438 3300048924 Ga0496121_0153215 Ga0496121_0153215_214_744 168
439 3300048928 Ga0496125_0148194 Ga0496125_0148194_268_798 168
440 3300049568 Ga0501031_0000076 Ga0501031_0000076_42840_43370 168
441 3300049569 Ga0501032_0000001 Ga0501032_0000001_183377_183910 168
442 3300049569 Ga0501032_0000004 Ga0501032_0000004_301825_302355 168
443 3300049570 Ga0501033_0000156 Ga0501033_0000156_56817_57347 168
444 3300049570 Ga0501033_0000275 Ga0501033_0000275_44086_44619 168
445 3300049570 Ga0501033_0243242 Ga0501033_0243242_49_579 168
446 3300049571 Ga0501034_0000011 Ga0501034_0000011_301825_302355 168
447 3300049571 Ga0501034_0000036 Ga0501034_0000036_237199_237732 168
448 3300049571 Ga0501034_0101428 Ga0501034_0101428_1314_1955 168
449 3300049571 Ga0501034_0157893 Ga0501034_0157893_660_1190 168
450 3300049571 Ga0501034_0329833 Ga0501034_0329833_787_1299 168
451 3300049572 Ga0501036_0000001 Ga0501036_0000001_301825_302355 168
452 3300049572 Ga0501036_0000358 Ga0501036_0000358_22983_23516 168
453 3300049573 Ga0501037_0000064 Ga0501037_0000064_12126_12656 168
454 3300049573 Ga0501037_0000091 Ga0501037_0000091_52244_52777 168
455 3300049574 Ga0501038_0000003 Ga0501038_0000003_301825_302355 168
456 3300049574 Ga0501038_0003916 Ga0501038_0003916_5072_5605 168
457 3300049575 Ga0501039_0000004 Ga0501039_0000004_301825_302355 168
458 3300049575 Ga0501039_0000011 Ga0501039_0000011_239648_240181 168
459 3300049576 Ga0501040_0009503 Ga0501040_0009503_2688_3218 168
460 3300049579 Ga0501043_0000016 Ga0501043_0000016_160269_160802 168
461 3300049579 Ga0501043_0017948 Ga0501043_0017948_1810_2340 168
462 3300049581 Ga0501047_0004675 Ga0501047_0004675_8394_8924 168
463 3300049581 Ga0501047_0138675 Ga0501047_0138675_452_982 168
464 3300049581 Ga0501047_0594242 Ga0501047_0594242_191_721 168
465 3300049586 Ga0501070_0009150 Ga0501070_0009150_40_570 168
466 3300049586 Ga0501070_0164737 Ga0501070_0164737_1196_1726 168
467 3300049588 Ga0501072_0641820 Ga0501072_0641820_20_550 168
468 3300049822 Ga0501035_0000009 Ga0501035_0000009_8473_9003 168
469 3300049822 Ga0501035_0022781 Ga0501035_0022781_124_681 168
470 3300049822 Ga0501035_0057893 Ga0501035_0057893_1393_1923 168
471 3300049822 Ga0501035_0779129 Ga0501035_0779129_227_742 168
472 3300049823 Ga0501044_0000005 Ga0501044_0000005_301825_302355 168
473 3300049823 Ga0501044_0021762 Ga0501044_0021762_4798_5328 168
474 3300049823 Ga0501044_0042055 Ga0501044_0042055_411_944 168
475 3300050489 nmdc:mga03683_29702_c1 nmdc:mga03683_29702_c1_671_1201 168
476 3300050490 nmdc:mga03n38_29730_c1 nmdc:mga03n38_29730_c1_1480_2010 168
477 3300050490 nmdc:mga03n38_370229_c1 nmdc:mga03n38_370229_c1_33_563 168
478 3300050490 nmdc:mga03n38_71670_c1 nmdc:mga03n38_71670_c1_508_1038 168
479 3300050491 nmdc:mga00v17_270354_c1 nmdc:mga00v17_270354_c1_238_768 168
480 3300050491 nmdc:mga00v17_43681_c1 nmdc:mga00v17_43681_c1_965_1495 168
481 3300050492 nmdc:mga0yw44_156695_c1 nmdc:mga0yw44_156695_c1_792_1322 168
482 3300050492 nmdc:mga0yw44_245944_c1 nmdc:mga0yw44_245944_c1_395_925 168
483 3300050492 nmdc:mga0yw44_73747_c1 nmdc:mga0yw44_73747_c1_528_1058 168
484 3300050494 nmdc:mga06z11_309815_c1 nmdc:mga06z11_309815_c1_154_684 168
485 3300050494 nmdc:mga06z11_31721_c1 nmdc:mga06z11_31721_c1_1710_2240 168
486 3300050495 nmdc:mga04h51_145057_c1 nmdc:mga04h51_145057_c1_134_664 168
487 3300050495 nmdc:mga04h51_58792_c1 nmdc:mga04h51_58792_c1_537_1067 168
488 3300050496 nmdc:mga07m45_169244_c1 nmdc:mga07m45_169244_c1_285_815 168
489 3300050496 nmdc:mga07m45_185778_c1 nmdc:mga07m45_185778_c1_198_728 168
490 3300053079 Ga0500610_0026528 Ga0500610_0026528_2257_2787 168
491 3300053083 Ga0495655_0008528 Ga0495655_0008528_1084_1614 168
492 3300053088 Ga0500644_0007223 Ga0500644_0007223_2174_2686 168
493 3300053119 Ga0500595_049173 Ga0500595_049173_191_721 168
494 3300053139 Ga0500568_0000052 Ga0500568_0000052_43867_44397 168
495 3300053155 Ga0500620_001541 Ga0500620_001541_1136_1666 168
496 3300053155 Ga0500620_034796 Ga0500620_034796_721_1251 168
497 3300053156 Ga0500622_0000446 Ga0500622_0000446_29490_30002 168
498 3300053727 Ga0500611_006335 Ga0500611_006335_1130_1660 168
499 3300053727 Ga0500611_020789 Ga0500611_020789_239_769 168
500 iso_pu_bacteria 2903448605 2903454121 168
501 iso_pu_bacteria 2937848649 2937848923 168
502 iso_pu_bacteria 2968083720 2968089847 168
503 iso_pu_bacteria 2977922695 2977925564 168
504 iso_pu_bacteria 2977986579 2977993021 168
505 iso_pu_bacteria 3004211236 3004217099 168
506 iso_pu_bacteria 3004218560 3004225308 168
507 iso_pu_bacteria 3004268573 3004269267 168
508 iso_pu_bacteria 3004334049 3004337421 168
509 3300006038 Ga0075365_10130849 Ga0075365_101308492 169
510 3300009177 Ga0105248_11287666 Ga0105248_112876661 169
511 3300009551 Ga0105238_10733426 Ga0105238_107334262 169
512 3300031731 Ga0307405_10956516 Ga0307405_109565161 169
513 3300031824 Ga0307413_10870662 Ga0307413_108706622 169
514 3300031911 Ga0307412_10178649 Ga0307412_101786492 169
515 3300046660 Ga0495625_0209302 Ga0495625_0209302_529_1074 169
516 3300046691 Ga0495670_0555521 Ga0495670_0555521_29_562 169
517 3300049580 Ga0501046_0143406 Ga0501046_0143406_1204_1740 169
518 3300053153 Ga0500616_0065036 Ga0500616_0065036_336_848 169
519 3300053158 Ga0500627_0031410 Ga0500627_0031410_502_1035 169
520 iso_pu_bacteria 2582581305 2585260204 170
521 3300002076 JGI24749J21850_1000462 JGI24749J21850_10004623 174
522 3300002459 JGI24751J29686_10000081 JGI24751J29686_1000008169 174
523 3300002459 JGI24751J29686_10002201 JGI24751J29686_100022015 174
524 3300005295 Ga0065707_10141752 Ga0065707_101417522 174
525 3300005295 Ga0065707_10231886 Ga0065707_102318862 174
526 3300005295 Ga0065707_10380431 Ga0065707_103804312 174
527 3300005331 Ga0070670_100000003 Ga0070670_100000003127 174
528 3300005347 Ga0070668_100000045 Ga0070668_1000000458 174
529 3300005347 Ga0070668_100155178 Ga0070668_1001551783 174
530 3300005353 Ga0070669_100000044 Ga0070669_10000004453 174
531 3300005353 Ga0070669_100036565 Ga0070669_1000365654 174
532 3300005355 Ga0070671_100001787 Ga0070671_1000017874 174
533 3300005367 Ga0070667_100000009 Ga0070667_100000009198 174
534 3300005367 Ga0070667_100021344 Ga0070667_1000213441 174
535 3300005445 Ga0070708_100693105 Ga0070708_1006931051 174
536 3300005548 Ga0070665_100175017 Ga0070665_1001750172 174
537 3300005577 Ga0068857_100015287 Ga0068857_1000152874 174
538 3300005578 Ga0068854_100003080 Ga0068854_1000030806 174
539 3300005617 Ga0068859_100016797 Ga0068859_1000167979 174
540 3300005617 Ga0068859_100018845 Ga0068859_1000188458 174
541 3300005618 Ga0068864_100000158 Ga0068864_10000015871 174
542 3300005618 Ga0068864_100012183 Ga0068864_1000121837 174
543 3300005719 Ga0068861_100410290 Ga0068861_1004102902 174
544 3300005841 Ga0068863_100000822 Ga0068863_1000008224 174
545 3300005842 Ga0068858_100003919 Ga0068858_10000391911 174
546 3300005843 Ga0068860_100000193 Ga0068860_10000019333 174
547 3300005844 Ga0068862_100000001 Ga0068862_100000001477 174
548 3300005844 Ga0068862_100000031 Ga0068862_10000003198 174
549 3300005844 Ga0068862_101424814 Ga0068862_1014248141 174
550 3300006058 Ga0075432_10329807 Ga0075432_103298071 174
551 3300006195 Ga0075366_10513460 Ga0075366_105134601 174
552 3300006931 Ga0097620_100016796 Ga0097620_1000167969 174
553 3300006931 Ga0097620_100018845 Ga0097620_1000188458 174
554 3300009177 Ga0105248_10000287 Ga0105248_1000028712 174
555 3300009553 Ga0105249_10132768 Ga0105249_101327683 174
556 3300014326 Ga0157380_10000755 Ga0157380_100007553 174
557 3300017792 Ga0163161_10229857 Ga0163161_102298573 174
558 3300025903 Ga0207680_10339347 Ga0207680_103393472 174
559 3300025923 Ga0207681_10000041 Ga0207681_1000004178 174
560 3300025923 Ga0207681_10022998 Ga0207681_100229984 174
561 3300025925 Ga0207650_10000004 Ga0207650_10000004124 174
562 3300025931 Ga0207644_10000084 Ga0207644_1000008418 174
563 3300025941 Ga0207711_10000658 Ga0207711_1000065829 174
564 3300025941 Ga0207711_10030728 Ga0207711_100307285 174
565 3300025961 Ga0207712_10183777 Ga0207712_101837772 174
566 3300025972 Ga0207668_10000031 Ga0207668_1000003120 174
567 3300025972 Ga0207668_10497404 Ga0207668_104974041 174
568 3300025981 Ga0207640_10150829 Ga0207640_101508292 174
569 3300025986 Ga0207658_10000009 Ga0207658_1000000968 174
570 3300025986 Ga0207658_10010969 Ga0207658_100109697 174
571 3300026035 Ga0207703_10003409 Ga0207703_100034096 174
572 3300026088 Ga0207641_10000580 Ga0207641_1000058027 174
573 3300026088 Ga0207641_10005050 Ga0207641_100050505 174
574 3300026095 Ga0207676_10000006 Ga0207676_10000006586 174
575 3300026095 Ga0207676_10008879 Ga0207676_100088794 174
576 3300026116 Ga0207674_10021817 Ga0207674_100218177 174
577 3300026118 Ga0207675_100000309 Ga0207675_10000030950 174
578 3300026118 Ga0207675_100042371 Ga0207675_1000423714 174
579 3300028380 Ga0268265_10000001 Ga0268265_10000001559 174
580 3300028380 Ga0268265_10000118 Ga0268265_1000011856 174
581 3300028380 Ga0268265_11005154 Ga0268265_110051542 174
582 3300028381 Ga0268264_10000001 Ga0268264_1000000168 174
583 3300031548 Ga0307408_100029193 Ga0307408_1000291933 174
584 3300031731 Ga0307405_10015134 Ga0307405_100151342 174
585 3300031731 Ga0307405_10452030 Ga0307405_104520301 174
586 3300031901 Ga0307406_10683182 Ga0307406_106831822 174
587 3300031911 Ga0307412_10001551 Ga0307412_100015514 174
588 3300031911 Ga0307412_10001980 Ga0307412_1000198010 174
589 3300031911 Ga0307412_10051786 Ga0307412_100517861 174
590 3300031911 Ga0307412_10727531 Ga0307412_107275312 174
591 3300032004 Ga0307414_10000486 Ga0307414_100004869 174
592 3300032005 Ga0307411_10143810 Ga0307411_101438101 174
593 3300033180 Ga0307510_10381649 Ga0307510_103816491 174
594 3300041453 Ga0451797_0921940 Ga0451797_0921940_168_701 174
595 3300046522 Ga0495643_0046095 Ga0495643_0046095_362_895 174
596 3300046524 Ga0495648_0149853 Ga0495648_0149853_349_882 174
597 3300046542 Ga0495597_0010903 Ga0495597_0010903_259_792 174
598 3300046558 Ga0495633_0095646 Ga0495633_0095646_803_1336 174
599 3300046616 Ga0495668_0009397 Ga0495668_0009397_80_613 174
600 3300046616 Ga0495668_0015679 Ga0495668_0015679_136_669 174
601 3300048928 Ga0496125_0083970 Ga0496125_0083970_1044_1577 174
602 3300049127 Ga0501306_010832 Ga0501306_010832_434_967 174
603 3300049571 Ga0501034_0040933 Ga0501034_0040933_436_1086 174
604 3300049579 Ga0501043_0018243 Ga0501043_0018243_663_1196 174
605 3300049581 Ga0501047_0000876 Ga0501047_0000876_14372_14905 174
606 3300049679 Ga0501249_000464 Ga0501249_000464_5690_6223 174
607 3300049850 Ga0501204_005586 Ga0501204_005586_248_781 174
608 3300053087 Ga0500643_000167 Ga0500643_000167_40196_40729 174
609 3300053087 Ga0500643_057773 Ga0500643_057773_460_993 174
610 3300053091 Ga0500647_0200154 Ga0500647_0200154_207_740 174
611 3300053093 Ga0500651_0002180 Ga0500651_0002180_8036_8569 174
612 3300053096 Ga0500641_0023205 Ga0500641_0023205_141_674 174
613 3300053125 Ga0500618_027385 Ga0500618_027385_751_1284 174
614 3300053130 Ga0500642_0001008 Ga0500642_0001008_5646_6179 174
615 3300053133 Ga0500655_000162 Ga0500655_000162_1229_1762 174
616 3300053148 Ga0500590_000967 Ga0500590_000967_5273_5806 174
617 3300053156 Ga0500622_0006224 Ga0500622_0006224_998_1531 174
618 3300053163 Ga0500639_016444 Ga0500639_016444_1445_1978 174
619 3300053177 Ga0500636_0148639 Ga0500636_0148639_364_897 174
620 3300053724 Ga0500570_005298 Ga0500570_005298_5498_6031 174
621 3300044712 Ga0453684_0064389 Ga0453684_0064389_3961_4533 177
622 3300045051 Ga0451576_0480621 Ga0451576_0480621_430_996 177
623 2162886007 SwRhRL2b_contig_3955086 SwRhRL2b_0187.00004220 180
624 3300005330 Ga0070690_100157457 Ga0070690_1001574572 181
625 3300005331 Ga0070670_100434494 Ga0070670_1004344941 181
626 3300005353 Ga0070669_100001258 Ga0070669_1000012588 181
627 3300005355 Ga0070671_100000066 Ga0070671_10000006654 181
628 3300005367 Ga0070667_100034559 Ga0070667_1000345593 181
629 3300005617 Ga0068859_100159372 Ga0068859_1001593722 181
630 3300005843 Ga0068860_100014365 Ga0068860_1000143659 181
631 3300006931 Ga0097620_100159381 Ga0097620_1001593812 181
632 3300009553 Ga0105249_10189138 Ga0105249_101891383 181
633 3300013306 Ga0163162_10404337 Ga0163162_104043372 181
634 3300014968 Ga0157379_10856085 Ga0157379_108560851 181
635 3300025923 Ga0207681_10000505 Ga0207681_1000050522 181
636 3300025925 Ga0207650_10116137 Ga0207650_101161372 181
637 3300025931 Ga0207644_10000087 Ga0207644_1000008722 181
638 3300025941 Ga0207711_10269870 Ga0207711_102698702 181
639 3300025961 Ga0207712_10081378 Ga0207712_100813783 181
640 3300025986 Ga0207658_10074300 Ga0207658_100743001 181
641 3300026035 Ga0207703_10053515 Ga0207703_100535152 181
642 3300028381 Ga0268264_10128118 Ga0268264_101281181 181
643 3300048903 Ga0496100_0247481 Ga0496100_0247481_95_664 181
644 3300048904 Ga0496101_0009564 Ga0496101_0009564_2835_3404 181
645 3300048905 Ga0496102_0155142 Ga0496102_0155142_1377_1946 181
646 3300048907 Ga0496104_0028553 Ga0496104_0028553_408_977 181
647 3300048908 Ga0496105_0116263 Ga0496105_0116263_872_1441 181
648 3300048909 Ga0496106_0009457 Ga0496106_0009457_5428_5997 181
649 3300048910 Ga0496107_0000740 Ga0496107_0000740_16378_16947 181
650 3300048913 Ga0496110_0090794 Ga0496110_0090794_2082_2651 181
651 3300048914 Ga0496111_0037922 Ga0496111_0037922_907_1476 181
652 3300002459 JGI24751J29686_10000080 JGI24751J29686_1000008039 182
653 3300005347 Ga0070668_100021139 Ga0070668_1000211393 182
654 3300005347 Ga0070668_100786227 Ga0070668_1007862271 182
655 3300005353 Ga0070669_100017575 Ga0070669_1000175753 182
656 3300005355 Ga0070671_100002573 Ga0070671_10000257313 182
657 3300005548 Ga0070665_100000530 Ga0070665_10000053037 182
658 3300005563 Ga0068855_100314010 Ga0068855_1003140102 182
659 3300005841 Ga0068863_100000879 Ga0068863_10000087913 182
660 3300005842 Ga0068858_100052666 Ga0068858_1000526663 182
661 3300005843 Ga0068860_100061894 Ga0068860_1000618944 182
662 3300025735 Ga0207713_1008764 Ga0207713_10087646 182
663 3300025900 Ga0207710_10014255 Ga0207710_100142553 182
664 3300025909 Ga0207705_10602867 Ga0207705_106028671 182
665 3300025923 Ga0207681_10000394 Ga0207681_1000039426 182
666 3300025931 Ga0207644_10062790 Ga0207644_100627902 182
667 3300025949 Ga0207667_10154190 Ga0207667_101541902 182
668 3300025972 Ga0207668_10012433 Ga0207668_100124335 182
669 3300026088 Ga0207641_10033920 Ga0207641_100339202 182
670 3300026095 Ga0207676_10073680 Ga0207676_100736803 182
671 3300028379 Ga0268266_10001263 Ga0268266_1000126315 182
672 3300028380 Ga0268265_10019466 Ga0268265_100194663 182
673 3300028381 Ga0268264_10013961 Ga0268264_100139616 182
674 3300039437 Ga0436365_1559618 Ga0436365_1559618_25_582 182
675 3300048906 Ga0496103_0008264 Ga0496103_0008264_3117_3686 182
676 3300048921 Ga0496118_0088916 Ga0496118_0088916_15_584 182
677 3300048924 Ga0496121_0002650 Ga0496121_0002650_9784_10353 182
678 3300048924 Ga0496121_0649927 Ga0496121_0649927_59_628 182
679 3300048927 Ga0496124_0069030 Ga0496124_0069030_1858_2427 182
680 3300048927 Ga0496124_0203651 Ga0496124_0203651_68_637 182
681 3300048928 Ga0496125_0604038 Ga0496125_0604038_10_579 182
682 3300041498 Ga0451841_0961289 Ga0451841_0961289_558_1127 184
683 3300048924 Ga0496121_0087821 Ga0496121_0087821_1010_1579 184
684 3300006195 Ga0075366_10006178 Ga0075366_100061788 186
685 3300050493 nmdc:mga0k408_1951_c1 nmdc:mga0k408_1951_c1_5471_6049 186
686 2162886006 SwRhRL3b_contig_2562353 SwRhRL3b_0567.00000930 189
687 3300005289 Ga0065704_10116303 Ga0065704_101163031 189
688 3300005290 Ga0065712_10167921 Ga0065712_101679211 189
689 3300005295 Ga0065707_10082647 Ga0065707_1008264717 189
690 3300005337 Ga0070682_100166249 Ga0070682_1001662492 189
691 3300005367 Ga0070667_100074388 Ga0070667_1000743884 189
692 3300005440 Ga0070705_100096833 Ga0070705_1000968333 189
693 3300005455 Ga0070663_100145454 Ga0070663_1001454543 189
694 3300005548 Ga0070665_100169767 Ga0070665_1001697671 189
695 3300005563 Ga0068855_100028633 Ga0068855_1000286336 189
696 3300005616 Ga0068852_100345220 Ga0068852_1003452201 189
697 3300005843 Ga0068860_100027395 Ga0068860_1000273952 189
698 3300006042 Ga0075368_10001554 Ga0075368_100015543 189
699 3300006048 Ga0075363_100013689 Ga0075363_1000136894 189
700 3300006048 Ga0075363_100061286 Ga0075363_1000612862 189
701 3300006051 Ga0075364_10046622 Ga0075364_100466223 189
702 3300006051 Ga0075364_10085148 Ga0075364_100851483 189
703 3300006177 Ga0075362_10000066 Ga0075362_1000006622 189
704 3300006177 Ga0075362_10009381 Ga0075362_100093813 189
705 3300006177 Ga0075362_10030466 Ga0075362_100304662 189
706 3300006178 Ga0075367_10004752 Ga0075367_100047523 189
707 3300006178 Ga0075367_10438862 Ga0075367_104388621 189
708 3300006186 Ga0075369_10003434 Ga0075369_100034342 189
709 3300006186 Ga0075369_10050354 Ga0075369_100503542 189
710 3300006195 Ga0075366_10034299 Ga0075366_100342993 189
711 3300006195 Ga0075366_10381965 Ga0075366_103819651 189
712 3300006353 Ga0075370_10000055 Ga0075370_1000005529 189
713 3300006353 Ga0075370_10166361 Ga0075370_101663612 189
714 3300006353 Ga0075370_10167035 Ga0075370_101670351 189
715 3300009551 Ga0105238_10273152 Ga0105238_102731522 189
716 3300014326 Ga0157380_10293081 Ga0157380_102930813 189
717 3300017792 Ga0163161_10121940 Ga0163161_101219402 189
718 3300025903 Ga0207680_10100329 Ga0207680_101003293 189
719 3300025926 Ga0207659_10315723 Ga0207659_103157232 189
720 3300025949 Ga0207667_10009772 Ga0207667_1000977211 189
721 3300025986 Ga0207658_10002560 Ga0207658_1000256019 189
722 3300026067 Ga0207678_10335537 Ga0207678_103355373 189
723 3300026142 Ga0207698_10398965 Ga0207698_103989651 189
724 3300027866 Ga0209813_10000064 Ga0209813_1000006440 189
725 3300028381 Ga0268264_10014246 Ga0268264_100142462 189
726 3300031911 Ga0307412_10074956 Ga0307412_100749562 189
727 3300032004 Ga0307414_10157303 Ga0307414_101573032 189
728 3300035242 Ga0373962_0019321 Ga0373962_0019321_750_1319 189
729 3300035691 Ga0373931_0021413 Ga0373931_0021413_1913_2482 189
730 3300041453 Ga0451797_0546020 Ga0451797_0546020_197_766 189
731 3300046530 Ga0495654_0162867 Ga0495654_0162867_61_630 189
732 3300046539 Ga0495621_0029886 Ga0495621_0029886_1237_1806 189
733 3300046660 Ga0495625_0123923 Ga0495625_0123923_67_636 189
734 3300048090 Ga0495615_0000025 Ga0495615_0000025_3196_3810 189
735 3300048925 Ga0496122_0005810 Ga0496122_0005810_9646_10260 189
736 3300048926 Ga0496123_0005504 Ga0496123_0005504_11247_11861 189
737 3300049581 Ga0501047_0554912 Ga0501047_0554912_131_700 189
738 3300049823 Ga0501044_0241792 Ga0501044_0241792_1109_1678 189
739 3300050489 nmdc:mga03683_5140_c2 nmdc:mga03683_5140_c2_774_1433 189
740 3300050489 nmdc:mga03683_55_c1 nmdc:mga03683_55_c1_21608_22177 189
741 3300050490 nmdc:mga03n38_3343_c1 nmdc:mga03n38_3343_c1_3344_3913 189
742 3300050491 nmdc:mga00v17_1644_c1 nmdc:mga00v17_1644_c1_959_1618 189
743 3300050491 nmdc:mga00v17_257278_c1 nmdc:mga00v17_257278_c1_161_730 189
744 3300050492 nmdc:mga0yw44_162014_c1 nmdc:mga0yw44_162014_c1_464_1033 189
745 3300050493 nmdc:mga0k408_450637_c1 nmdc:mga0k408_450637_c1_124_693 189
746 3300050494 nmdc:mga06z11_1082_c1 nmdc:mga06z11_1082_c1_7096_7665 189
747 3300050494 nmdc:mga06z11_80514_c1 nmdc:mga06z11_80514_c1_231_800 189
748 3300050495 nmdc:mga04h51_1318_c1 nmdc:mga04h51_1318_c1_1975_2544 189
749 3300050496 nmdc:mga07m45_27326_c1 nmdc:mga07m45_27326_c1_136_705 189
750 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_175492_176061 189
751 3300050496 nmdc:mga07m45_55_c1 nmdc:mga07m45_55_c1_30017_30586 189
752 3300050516 nmdc:mga0sz30_132359_c1 nmdc:mga0sz30_132359_c1_292_861 189
753 3300050516 nmdc:mga0sz30_2912_c1 nmdc:mga0sz30_2912_c1_5167_5736 189
754 3300050516 nmdc:mga0sz30_303_c1 nmdc:mga0sz30_303_c1_18002_18571 189
755 3300053087 Ga0500643_039415 Ga0500643_039415_191_760 189
756 3300053091 Ga0500647_0059268 Ga0500647_0059268_870_1439 189
757 3300053118 Ga0500594_0117019 Ga0500594_0117019_54_623 189
758 3300053121 Ga0500607_000354 Ga0500607_000354_29931_30500 189
759 3300053121 Ga0500607_075177 Ga0500607_075177_529_1098 189
760 3300053122 Ga0500608_000755 Ga0500608_000755_3764_4333 189
761 3300053136 Ga0500559_0006081 Ga0500559_0006081_253_822 189
762 3300053136 Ga0500559_0015561 Ga0500559_0015561_1958_2527 189
763 3300053138 Ga0500564_015388 Ga0500564_015388_807_1376 189
764 3300053139 Ga0500568_0105762 Ga0500568_0105762_101_670 189
765 3300053156 Ga0500622_0000145 Ga0500622_0000145_38023_38643 189
766 3300053178 Ga0500637_0006247 Ga0500637_0006247_1048_1617 189
767 3300053723 Ga0500567_000039 Ga0500567_000039_19672_20241 189
768 3300053729 Ga0500625_000021 Ga0500625_000021_43498_44067 189
769 3300053730 Ga0500645_007973 Ga0500645_007973_860_1429 189
770 iso_pu_bacteria 2739367865 2740027591 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

15

193

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9764 3 182
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9646 1 171
3k6l-assembly3.cif.gz_C the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 0.9639 3 182
6jf5-assembly1.cif.gz_A k2u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9575 1 168
5j46-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia multivorans 0.9544 1 189
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9643 1 171 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9513 1 171 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9471 1 172 3.90.45.10
2ew5A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9388 2 184 3.90.45.10
4dr9B00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9305 4 181 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A7W5MXD6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9931 1 189 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A6I4SNS8-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9911 1 189 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A7W5MXD6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9879 1 189 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A365VLT1-F1-model_v4 deleted 0.9816 91 188
AF-A0A2X3L1W3-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9808 91 185 GO:0042586
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map