F480055
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 770 | 522 | 496 | 177 |
Family's Representative Sequence
| Representative Sequence | 3300053156|Ga0500622_0000145|Ga0500622_0000145_38023_38643 |
| Length | 206 |
| Sequence | LTISGFALIWQAMAIREILEIPDPRLKQVSAPVEAFDDELKTLVADMFETMYDAPGIGLAAIQVGVPLRVLVIDLQPDDPDAEPEVCTAGHSHGGGDHEHTLQPTRKEPRVFINPEILDPSEELAVYNEGCLSVPEIYADVERPSAIRARWQDLDGKVHEESMEGLMATCLQHEMDHLEGILFIDHLSRLKRQMAVKKLEKLRKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 7 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 8 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 11 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 12 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 13 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 14 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 15 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 16 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 17 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 18 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 19 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 20 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 21 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 22 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 23 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 24 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 25 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 26 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 27 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 28 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 29 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 30 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 31 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 32 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 33 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 34 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 35 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 36 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 37 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 38 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 39 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 40 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 41 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 42 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 43 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 44 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 45 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 46 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 47 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 48 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 49 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 50 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 51 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 52 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 53 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 54 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 55 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 56 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 57 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 58 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 59 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 60 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 61 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 62 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 63 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 64 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 65 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 66 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 67 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 68 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 69 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 70 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 71 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 72 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 73 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 74 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 75 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 76 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 77 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 78 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 79 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 80 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 81 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 82 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 83 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 84 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 85 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 86 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 87 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 88 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 89 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 90 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 91 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 92 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 93 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 94 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 95 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 96 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 97 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 98 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 99 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 100 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 101 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 102 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 103 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 104 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 105 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 106 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 107 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 108 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 109 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 110 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 111 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 112 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 113 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 114 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 115 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 116 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 117 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 118 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 119 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 120 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 121 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 122 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 123 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 124 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 125 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 126 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 127 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 128 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 129 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 130 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 131 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 132 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 133 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 134 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 135 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 136 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 137 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 138 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 139 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 140 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 141 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 142 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 143 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 144 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 145 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 146 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 147 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 148 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 149 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 150 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 151 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 152 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 153 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 154 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 155 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 156 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 157 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 158 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 159 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 160 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 161 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 162 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 163 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 164 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 165 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 166 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 167 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 168 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 169 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 170 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 171 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 172 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 173 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 174 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 175 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 176 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 177 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 178 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 179 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 180 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 181 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 182 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 183 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 184 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 185 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 186 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 187 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 188 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 189 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 190 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 191 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 192 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 193 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 194 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 195 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 196 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 197 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 198 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 199 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 200 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 201 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 202 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 203 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 204 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 205 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 206 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 207 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 208 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 209 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 210 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 211 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 212 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 213 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 214 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 215 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 216 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 217 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 218 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 219 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 220 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 221 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 222 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 223 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 224 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 225 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 226 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 227 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 228 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 229 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 230 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 231 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 232 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 233 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 234 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 235 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 236 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 237 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 238 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 239 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 240 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 241 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 242 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 243 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 244 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 245 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 246 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 247 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 248 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 249 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 250 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 251 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 252 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 253 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 254 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 255 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 256 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 257 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 258 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 259 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 260 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 261 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 262 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 263 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 264 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 265 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 266 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 267 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 268 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 269 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 270 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 271 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 272 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 273 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 275 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 277 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 282 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 286 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 287 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 288 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 290 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 291 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 292 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 293 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 294 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 295 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 296 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 297 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 298 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 299 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 300 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 301 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 302 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 303 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 304 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 305 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 306 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 307 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 308 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 309 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 310 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 312 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 313 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 314 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 324 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 332 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 336 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 337 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 338 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 341 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 379 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 380 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 381 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 382 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 383 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 384 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 385 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 386 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 387 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 388 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 389 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 390 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 391 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 392 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 393 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 394 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 395 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 396 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 397 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 398 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 399 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 400 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 401 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 402 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 403 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 404 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 405 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 406 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 407 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 408 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 409 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 429 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 431 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 432 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 433 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 434 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 435 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 436 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 438 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 439 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 440 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 441 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 442 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 443 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 444 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 445 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 446 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 447 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 448 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 449 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 453 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 454 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 465 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 468 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 469 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 470 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 471 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 473 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 474 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 475 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 476 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 477 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 481 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 483 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 484 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 485 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 486 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 487 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 488 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 489 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 491 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 492 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 495 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 496 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 497 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 498 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 499 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 501 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 502 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 503 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 504 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 505 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 506 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 507 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 508 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 509 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 510 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 511 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 512 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 513 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 514 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 515 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 516 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 517 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 518 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 519 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 520 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 521 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 522 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.29 |
| Metatranscriptomes | 0.13 |
| Isolates | 35.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.94 |
| Nodule | 30.78 |
| Rhizoplane | 2.6 |
| Rhizosphere | 42.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2562353 | 2162886006 | Bacteria | 984 |
| 2 | SwRhRL2b_contig_3955086 | 2162886007 | Bacteria | 1417 |
| 3 | JGI24740J21852_10043523 | 3300001979 | Bacteria | 1338 |
| 4 | JGI24735J21928_10092387 | 3300002067 | Bacteria | 868 |
| 5 | JGI24749J21850_1000462 | 3300002076 | Bacteria | 5997 |
| 6 | JGI24751J29686_10000080 | 3300002459 | Bacteria | 54264 |
| 7 | JGI24751J29686_10000081 | 3300002459 | Bacteria | 53804 |
| 8 | JGI24751J29686_10002201 | 3300002459 | Bacteria | 3960 |
| 9 | JGI25156J39149_1011787 | 3300002705 | Bacteria | 1959 |
| 10 | JGI25165J46597_1000079 | 3300003214 | Bacteria | 179163 |
| 11 | rootL2_10186239 | 3300003322 | Bacteria | 1239 |
| 12 | Ga0055542_1000951 | 3300003762 | Bacteria | 18980 |
| 13 | Ga0055529_1009398 | 3300003763 | Bacteria | 1284 |
| 14 | Ga0065704_10116303 | 3300005289 | Bacteria | 1856 |
| 15 | Ga0065712_10167921 | 3300005290 | Bacteria | 1261 |
| 16 | Ga0065715_10207065 | 3300005293 | Bacteria | 1332 |
| 17 | Ga0065707_10082647 | 3300005295 | Bacteria | 13064 |
| 18 | Ga0065707_10141752 | 3300005295 | Bacteria | 1763 |
| 19 | Ga0065707_10231886 | 3300005295 | Bacteria | 1186 |
| 20 | Ga0065707_10380431 | 3300005295 | Bacteria | 878 |
| 21 | Ga0070676_10010997 | 3300005328 | Bacteria | 4915 |
| 22 | Ga0070690_100157457 | 3300005330 | Bacteria | 1554 |
| 23 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 24 | Ga0070670_100417861 | 3300005331 | Bacteria | 1185 |
| 25 | Ga0070670_100434494 | 3300005331 | Bacteria | 1162 |
| 26 | Ga0070682_100166249 | 3300005337 | Bacteria | 1529 |
| 27 | Ga0070668_100000045 | 3300005347 | Bacteria | 77362 |
| 28 | Ga0070668_100021139 | 3300005347 | Bacteria | 4919 |
| 29 | Ga0070668_100155178 | 3300005347 | Bacteria | 1854 |
| 30 | Ga0070668_100786227 | 3300005347 | Bacteria | 845 |
| 31 | Ga0070669_100000044 | 3300005353 | Bacteria | 121087 |
| 32 | Ga0070669_100001258 | 3300005353 | Bacteria | 18395 |
| 33 | Ga0070669_100017575 | 3300005353 | Bacteria | 5101 |
| 34 | Ga0070669_100036565 | 3300005353 | Bacteria | 3559 |
| 35 | Ga0070669_101016064 | 3300005353 | Bacteria | 712 |
| 36 | Ga0070671_100000066 | 3300005355 | Bacteria | 70998 |
| 37 | Ga0070671_100001787 | 3300005355 | Bacteria | 16331 |
| 38 | Ga0070671_100002573 | 3300005355 | Bacteria | 14068 |
| 39 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 40 | Ga0070667_100021344 | 3300005367 | Bacteria | 5378 |
| 41 | Ga0070667_100034559 | 3300005367 | Bacteria | 4230 |
| 42 | Ga0070667_100074388 | 3300005367 | Bacteria | 2898 |
| 43 | Ga0070667_101045392 | 3300005367 | Bacteria | 763 |
| 44 | Ga0070713_100011267 | 3300005436 | Bacteria | 6504 |
| 45 | Ga0070705_100096833 | 3300005440 | Bacteria | 1853 |
| 46 | Ga0070708_100693105 | 3300005445 | Bacteria | 959 |
| 47 | Ga0070663_100145454 | 3300005455 | Bacteria | 1813 |
| 48 | Ga0070663_100484421 | 3300005455 | Bacteria | 1025 |
| 49 | Ga0068867_100524866 | 3300005459 | Bacteria | 1022 |
| 50 | Ga0070684_101100321 | 3300005535 | Bacteria | 747 |
| 51 | Ga0068853_100012737 | 3300005539 | Bacteria | 6847 |
| 52 | Ga0068853_100315429 | 3300005539 | Bacteria | 1448 |
| 53 | Ga0070665_100000530 | 3300005548 | Bacteria | 53943 |
| 54 | Ga0070665_100169767 | 3300005548 | Bacteria | 2183 |
| 55 | Ga0070665_100175017 | 3300005548 | Bacteria | 2147 |
| 56 | Ga0070665_100407753 | 3300005548 | Bacteria | 1367 |
| 57 | Ga0070665_100710073 | 3300005548 | Bacteria | 1018 |
| 58 | Ga0068855_100028633 | 3300005563 | Bacteria | 6665 |
| 59 | Ga0068855_100314010 | 3300005563 | Bacteria | 1733 |
| 60 | Ga0068855_100656771 | 3300005563 | Bacteria | 1126 |
| 61 | Ga0068857_100015287 | 3300005577 | Bacteria | 6700 |
| 62 | Ga0068857_101402537 | 3300005577 | Bacteria | 680 |
| 63 | Ga0068854_100003080 | 3300005578 | Bacteria | 10382 |
| 64 | Ga0068854_100469225 | 3300005578 | Bacteria | 1055 |
| 65 | Ga0068856_100103164 | 3300005614 | Bacteria | 2846 |
| 66 | Ga0068856_100298031 | 3300005614 | Bacteria | 1630 |
| 67 | Ga0068856_100352559 | 3300005614 | Bacteria | 1490 |
| 68 | Ga0068856_100925274 | 3300005614 | Bacteria | 891 |
| 69 | Ga0068852_100149801 | 3300005616 | Bacteria | 2168 |
| 70 | Ga0068852_100345220 | 3300005616 | Bacteria | 1452 |
| 71 | Ga0068852_100514593 | 3300005616 | Bacteria | 1193 |
| 72 | Ga0068859_100016797 | 3300005617 | Bacteria | 7350 |
| 73 | Ga0068859_100018845 | 3300005617 | Bacteria | 6934 |
| 74 | Ga0068859_100159372 | 3300005617 | Bacteria | 2335 |
| 75 | Ga0068864_100000158 | 3300005618 | Bacteria | 62676 |
| 76 | Ga0068864_100012183 | 3300005618 | Bacteria | 7108 |
| 77 | Ga0068861_100410290 | 3300005719 | Bacteria | 1204 |
| 78 | Ga0068863_100000822 | 3300005841 | Bacteria | 31110 |
| 79 | Ga0068863_100000879 | 3300005841 | Bacteria | 30177 |
| 80 | Ga0068858_100003919 | 3300005842 | Bacteria | 14701 |
| 81 | Ga0068858_100052666 | 3300005842 | Bacteria | 3765 |
| 82 | Ga0068860_100000193 | 3300005843 | Bacteria | 97253 |
| 83 | Ga0068860_100014365 | 3300005843 | Bacteria | 7761 |
| 84 | Ga0068860_100027395 | 3300005843 | Bacteria | 5490 |
| 85 | Ga0068860_100061894 | 3300005843 | Bacteria | 3556 |
| 86 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 87 | Ga0068862_100000031 | 3300005844 | Bacteria | 180203 |
| 88 | Ga0068862_101424814 | 3300005844 | Bacteria | 697 |
| 89 | Ga0075365_10130849 | 3300006038 | Bacteria | 1736 |
| 90 | Ga0075365_10239018 | 3300006038 | Bacteria | 1276 |
| 91 | Ga0075368_10001554 | 3300006042 | Bacteria | 7370 |
| 92 | Ga0075368_10015771 | 3300006042 | Bacteria | 2808 |
| 93 | Ga0075368_10116693 | 3300006042 | Bacteria | 1103 |
| 94 | Ga0075363_100013689 | 3300006048 | Bacteria | 3943 |
| 95 | Ga0075363_100038266 | 3300006048 | Bacteria | 2522 |
| 96 | Ga0075363_100061286 | 3300006048 | Bacteria | 2027 |
| 97 | Ga0075363_100354932 | 3300006048 | Bacteria | 857 |
| 98 | Ga0075364_10046622 | 3300006051 | Bacteria | 2822 |
| 99 | Ga0075364_10085148 | 3300006051 | Bacteria | 2093 |
| 100 | Ga0075364_10266176 | 3300006051 | Bacteria | 1165 |
| 101 | Ga0075364_10671225 | 3300006051 | Bacteria | 707 |
| 102 | Ga0075432_10329807 | 3300006058 | Bacteria | 641 |
| 103 | Ga0075362_10000066 | 3300006177 | Bacteria | 29420 |
| 104 | Ga0075362_10009381 | 3300006177 | Bacteria | 3785 |
| 105 | Ga0075362_10030466 | 3300006177 | Bacteria | 2330 |
| 106 | Ga0075362_10070428 | 3300006177 | Bacteria | 1596 |
| 107 | Ga0075362_10148000 | 3300006177 | Bacteria | 1125 |
| 108 | Ga0075367_10004752 | 3300006178 | Bacteria | 6681 |
| 109 | Ga0075367_10030395 | 3300006178 | Bacteria | 3097 |
| 110 | Ga0075367_10120477 | 3300006178 | Bacteria | 1616 |
| 111 | Ga0075367_10438862 | 3300006178 | Bacteria | 827 |
| 112 | Ga0075369_10003434 | 3300006186 | Bacteria | 5771 |
| 113 | Ga0075369_10050354 | 3300006186 | Bacteria | 1801 |
| 114 | Ga0075369_10056869 | 3300006186 | Bacteria | 1701 |
| 115 | Ga0075366_10006178 | 3300006195 | Bacteria | 6538 |
| 116 | Ga0075366_10034299 | 3300006195 | Bacteria | 2988 |
| 117 | Ga0075366_10381965 | 3300006195 | Bacteria | 866 |
| 118 | Ga0075366_10513460 | 3300006195 | Bacteria | 741 |
| 119 | Ga0097621_100051892 | 3300006237 | Bacteria | 3339 |
| 120 | Ga0097621_100070667 | 3300006237 | Bacteria | 2883 |
| 121 | Ga0097621_101054494 | 3300006237 | Bacteria | 762 |
| 122 | Ga0075370_10000055 | 3300006353 | Bacteria | 33979 |
| 123 | Ga0075370_10166361 | 3300006353 | Bacteria | 1295 |
| 124 | Ga0075370_10167035 | 3300006353 | Bacteria | 1293 |
| 125 | Ga0068871_100227713 | 3300006358 | Bacteria | 1617 |
| 126 | Ga0075430_100434060 | 3300006846 | Bacteria | 1084 |
| 127 | Ga0097620_100016796 | 3300006931 | Bacteria | 7350 |
| 128 | Ga0097620_100018845 | 3300006931 | Bacteria | 6934 |
| 129 | Ga0097620_100159381 | 3300006931 | Bacteria | 2335 |
| 130 | Ga0105240_10467642 | 3300009093 | Bacteria | 1408 |
| 131 | Ga0105240_10586721 | 3300009093 | Bacteria | 1229 |
| 132 | Ga0105245_10750740 | 3300009098 | Bacteria | 1012 |
| 133 | Ga0105243_11215062 | 3300009148 | Bacteria | 768 |
| 134 | Ga0105241_10394536 | 3300009174 | Bacteria | 1212 |
| 135 | Ga0105242_10037486 | 3300009176 | Bacteria | 3894 |
| 136 | Ga0105248_10000287 | 3300009177 | Bacteria | 59537 |
| 137 | Ga0105248_10390926 | 3300009177 | Bacteria | 1566 |
| 138 | Ga0105248_11287666 | 3300009177 | Bacteria | 827 |
| 139 | Ga0105237_10126106 | 3300009545 | Bacteria | 2554 |
| 140 | Ga0105237_11112290 | 3300009545 | Bacteria | 797 |
| 141 | Ga0105238_10004938 | 3300009551 | Bacteria | 13199 |
| 142 | Ga0105238_10273152 | 3300009551 | Bacteria | 1671 |
| 143 | Ga0105238_10733426 | 3300009551 | Bacteria | 1001 |
| 144 | Ga0105249_10132768 | 3300009553 | Bacteria | 2379 |
| 145 | Ga0105249_10189138 | 3300009553 | Bacteria | 2008 |
| 146 | Ga0105249_11352463 | 3300009553 | Bacteria | 784 |
| 147 | Ga0105239_10384029 | 3300010375 | Bacteria | 1588 |
| 148 | Ga0105239_10596768 | 3300010375 | Bacteria | 1259 |
| 149 | Ga0105239_11041267 | 3300010375 | Bacteria | 941 |
| 150 | Ga0105246_11093605 | 3300011119 | Bacteria | 727 |
| 151 | Ga0157373_10566969 | 3300013100 | Bacteria | 824 |
| 152 | Ga0157374_10293667 | 3300013296 | Bacteria | 1607 |
| 153 | Ga0163162_10404337 | 3300013306 | Bacteria | 1498 |
| 154 | Ga0163162_10512538 | 3300013306 | Bacteria | 1329 |
| 155 | Ga0157372_10048506 | 3300013307 | Bacteria | 4721 |
| 156 | Ga0157372_10064258 | 3300013307 | Bacteria | 4118 |
| 157 | Ga0157380_10000755 | 3300014326 | Bacteria | 20159 |
| 158 | Ga0157380_10293081 | 3300014326 | Bacteria | 1495 |
| 159 | Ga0182008_10058991 | 3300014497 | Bacteria | 1894 |
| 160 | Ga0157379_10856085 | 3300014968 | Bacteria | 860 |
| 161 | Ga0157376_11333093 | 3300014969 | Bacteria | 748 |
| 162 | Ga0163161_10121940 | 3300017792 | Bacteria | 1959 |
| 163 | Ga0163161_10229857 | 3300017792 | Bacteria | 1439 |
| 164 | Ga0163161_11001700 | 3300017792 | Bacteria | 713 |
| 165 | Ga0213876_10000322 | 3300021384 | Bacteria | 41914 |
| 166 | Ga0213876_10110479 | 3300021384 | Bacteria | 1459 |
| 167 | Ga0213875_10004220 | 3300021388 | Bacteria | 7935 |
| 168 | Ga0213875_10047458 | 3300021388 | Bacteria | 2015 |
| 169 | Ga0209148_1000136 | 3300025254 | Bacteria | 169088 |
| 170 | Ga0209233_1000247 | 3300025261 | Bacteria | 87890 |
| 171 | Ga0209233_1012279 | 3300025261 | Bacteria | 2489 |
| 172 | Ga0209455_1000085 | 3300025272 | Bacteria | 247601 |
| 173 | Ga0209758_1010633 | 3300025297 | Bacteria | 5476 |
| 174 | Ga0207713_1008764 | 3300025735 | Bacteria | 5765 |
| 175 | Ga0207710_10014255 | 3300025900 | Bacteria | 3349 |
| 176 | Ga0207688_10170343 | 3300025901 | Bacteria | 1294 |
| 177 | Ga0207680_10100329 | 3300025903 | Bacteria | 1859 |
| 178 | Ga0207680_10339347 | 3300025903 | Bacteria | 1054 |
| 179 | Ga0207680_10790681 | 3300025903 | Bacteria | 680 |
| 180 | Ga0207647_10072715 | 3300025904 | Bacteria | 2073 |
| 181 | Ga0207645_10016934 | 3300025907 | Bacteria | 4816 |
| 182 | Ga0207705_10602867 | 3300025909 | Bacteria | 854 |
| 183 | Ga0207654_10309471 | 3300025911 | Bacteria | 1077 |
| 184 | Ga0207671_10011582 | 3300025914 | Bacteria | 7163 |
| 185 | Ga0207663_10591179 | 3300025916 | Bacteria | 871 |
| 186 | Ga0207681_10000041 | 3300025923 | Bacteria | 140201 |
| 187 | Ga0207681_10000394 | 3300025923 | Bacteria | 30575 |
| 188 | Ga0207681_10000505 | 3300025923 | Bacteria | 27187 |
| 189 | Ga0207681_10022998 | 3300025923 | Bacteria | 3980 |
| 190 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 191 | Ga0207650_10116137 | 3300025925 | Bacteria | 2078 |
| 192 | Ga0207659_10315723 | 3300025926 | Bacteria | 1288 |
| 193 | Ga0207644_10000084 | 3300025931 | Bacteria | 69209 |
| 194 | Ga0207644_10000087 | 3300025931 | Bacteria | 67315 |
| 195 | Ga0207644_10062790 | 3300025931 | Bacteria | 2695 |
| 196 | Ga0207690_10707383 | 3300025932 | Bacteria | 829 |
| 197 | Ga0207669_10309607 | 3300025937 | Bacteria | 1204 |
| 198 | Ga0207669_10797359 | 3300025937 | Bacteria | 783 |
| 199 | Ga0207691_10194840 | 3300025940 | Bacteria | 1766 |
| 200 | Ga0207711_10000658 | 3300025941 | Bacteria | 34432 |
| 201 | Ga0207711_10030728 | 3300025941 | Bacteria | 4531 |
| 202 | Ga0207711_10269870 | 3300025941 | Bacteria | 1565 |
| 203 | Ga0207711_11006526 | 3300025941 | Bacteria | 773 |
| 204 | Ga0207667_10009772 | 3300025949 | Bacteria | 11282 |
| 205 | Ga0207667_10154190 | 3300025949 | Bacteria | 2364 |
| 206 | Ga0207667_10674959 | 3300025949 | Bacteria | 1037 |
| 207 | Ga0207667_11000395 | 3300025949 | Bacteria | 823 |
| 208 | Ga0207712_10081378 | 3300025961 | Bacteria | 2358 |
| 209 | Ga0207712_10183777 | 3300025961 | Bacteria | 1644 |
| 210 | Ga0207668_10000031 | 3300025972 | Bacteria | 122168 |
| 211 | Ga0207668_10012433 | 3300025972 | Bacteria | 5211 |
| 212 | Ga0207668_10497404 | 3300025972 | Bacteria | 1048 |
| 213 | Ga0207640_10150829 | 3300025981 | Bacteria | 1708 |
| 214 | Ga0207640_10232565 | 3300025981 | Bacteria | 1419 |
| 215 | Ga0207658_10000009 | 3300025986 | Bacteria | 264118 |
| 216 | Ga0207658_10002560 | 3300025986 | Bacteria | 13206 |
| 217 | Ga0207658_10010969 | 3300025986 | Bacteria | 6170 |
| 218 | Ga0207658_10074300 | 3300025986 | Bacteria | 2583 |
| 219 | Ga0207703_10003409 | 3300026035 | Bacteria | 13340 |
| 220 | Ga0207703_10053515 | 3300026035 | Bacteria | 3281 |
| 221 | Ga0207639_10796919 | 3300026041 | Bacteria | 880 |
| 222 | Ga0207639_11120032 | 3300026041 | Bacteria | 738 |
| 223 | Ga0207678_10140813 | 3300026067 | Bacteria | 2058 |
| 224 | Ga0207678_10335537 | 3300026067 | Bacteria | 1302 |
| 225 | Ga0207678_10440088 | 3300026067 | Bacteria | 1132 |
| 226 | Ga0207702_10151964 | 3300026078 | Bacteria | 2107 |
| 227 | Ga0207702_10384304 | 3300026078 | Bacteria | 1351 |
| 228 | Ga0207702_10640741 | 3300026078 | Bacteria | 1045 |
| 229 | Ga0207702_11069656 | 3300026078 | Bacteria | 800 |
| 230 | Ga0207641_10000580 | 3300026088 | Bacteria | 40301 |
| 231 | Ga0207641_10005050 | 3300026088 | Bacteria | 11306 |
| 232 | Ga0207641_10033920 | 3300026088 | Bacteria | 4243 |
| 233 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 234 | Ga0207676_10008879 | 3300026095 | Bacteria | 7149 |
| 235 | Ga0207676_10073680 | 3300026095 | Bacteria | 2749 |
| 236 | Ga0207674_10021817 | 3300026116 | Bacteria | 6892 |
| 237 | Ga0207674_10167756 | 3300026116 | Bacteria | 2149 |
| 238 | Ga0207674_10894007 | 3300026116 | Bacteria | 856 |
| 239 | Ga0207675_100000309 | 3300026118 | Bacteria | 46765 |
| 240 | Ga0207675_100042371 | 3300026118 | Bacteria | 4250 |
| 241 | Ga0207683_10067864 | 3300026121 | Bacteria | 3147 |
| 242 | Ga0207698_10398965 | 3300026142 | Bacteria | 1314 |
| 243 | Ga0207698_10754272 | 3300026142 | Bacteria | 972 |
| 244 | Ga0209813_10000064 | 3300027866 | Bacteria | 43230 |
| 245 | Ga0209813_10043531 | 3300027866 | Bacteria | 1376 |
| 246 | Ga0209813_10049024 | 3300027866 | Bacteria | 1313 |
| 247 | Ga0268266_10001263 | 3300028379 | Bacteria | 30915 |
| 248 | Ga0268266_10883445 | 3300028379 | Bacteria | 864 |
| 249 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 250 | Ga0268265_10000118 | 3300028380 | Bacteria | 99496 |
| 251 | Ga0268265_10019466 | 3300028380 | Bacteria | 4719 |
| 252 | Ga0268265_11005154 | 3300028380 | Bacteria | 824 |
| 253 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 254 | Ga0268264_10013961 | 3300028381 | Bacteria | 6604 |
| 255 | Ga0268264_10014246 | 3300028381 | Bacteria | 6537 |
| 256 | Ga0268264_10128118 | 3300028381 | Bacteria | 2246 |
| 257 | Ga0307513_10264400 | 3300031456 | Bacteria | 1508 |
| 258 | Ga0307408_100029193 | 3300031548 | Bacteria | 3818 |
| 259 | Ga0307405_10015134 | 3300031731 | Bacteria | 4168 |
| 260 | Ga0307405_10452030 | 3300031731 | Bacteria | 1019 |
| 261 | Ga0307405_10956516 | 3300031731 | Bacteria | 728 |
| 262 | Ga0307413_10870662 | 3300031824 | Bacteria | 763 |
| 263 | Ga0307406_10683182 | 3300031901 | Bacteria | 855 |
| 264 | Ga0307412_10001551 | 3300031911 | Bacteria | 12691 |
| 265 | Ga0307412_10001980 | 3300031911 | Bacteria | 11350 |
| 266 | Ga0307412_10051786 | 3300031911 | Bacteria | 2715 |
| 267 | Ga0307412_10074956 | 3300031911 | Bacteria | 2320 |
| 268 | Ga0307412_10170987 | 3300031911 | Bacteria | 1625 |
| 269 | Ga0307412_10178649 | 3300031911 | Bacteria | 1594 |
| 270 | Ga0307412_10727531 | 3300031911 | Bacteria | 854 |
| 271 | Ga0307414_10000486 | 3300032004 | Bacteria | 20663 |
| 272 | Ga0307414_10157303 | 3300032004 | Bacteria | 1801 |
| 273 | Ga0307411_10143810 | 3300032005 | Bacteria | 1762 |
| 274 | Ga0307510_10381649 | 3300033180 | Bacteria | 854 |
| 275 | Ga0373955_0098514 | 3300035172 | Bacteria | 1675 |
| 276 | Ga0373962_0019321 | 3300035242 | Bacteria | 1782 |
| 277 | Ga0373931_0021413 | 3300035691 | Bacteria | 3244 |
| 278 | Ga0373937_0160065 | 3300036401 | Bacteria | 2111 |
| 279 | Ga0395899_0000014 | 3300037312 | Bacteria | 488813 |
| 280 | Ga0395900_0000007 | 3300037418 | Bacteria | 488860 |
| 281 | Ga0395900_0069262 | 3300037418 | Bacteria | 3626 |
| 282 | Ga0395900_0173763 | 3300037418 | Bacteria | 2192 |
| 283 | Ga0395900_0264908 | 3300037418 | Bacteria | 1715 |
| 284 | Ga0395900_0519780 | 3300037418 | Bacteria | 1138 |
| 285 | Ga0395900_0860138 | 3300037418 | Bacteria | 832 |
| 286 | Ga0395898_0000011 | 3300037466 | Bacteria | 488860 |
| 287 | Ga0395898_1186545 | 3300037466 | Bacteria | 695 |
| 288 | Ga0395905_0000008 | 3300037471 | Bacteria | 488860 |
| 289 | Ga0395905_0029180 | 3300037471 | Bacteria | 5199 |
| 290 | Ga0395905_0032726 | 3300037471 | Bacteria | 4887 |
| 291 | Ga0395905_0063129 | 3300037471 | Bacteria | 3465 |
| 292 | Ga0395905_0220342 | 3300037471 | Bacteria | 1776 |
| 293 | Ga0395905_0821692 | 3300037471 | Bacteria | 832 |
| 294 | Ga0436364_0088168 | 3300037853 | Bacteria | 4093 |
| 295 | Ga0436364_0790157 | 3300037853 | Bacteria | 656 |
| 296 | Ga0436364_0856601 | 3300037853 | Bacteria | 10731 |
| 297 | Ga0436364_1359870 | 3300037853 | Bacteria | 3439 |
| 298 | Ga0436364_1508701 | 3300037853 | Bacteria | 2034 |
| 299 | Ga0395901_0000020 | 3300038443 | Bacteria | 314918 |
| 300 | Ga0395901_0459333 | 3300038443 | Bacteria | 1301 |
| 301 | Ga0436365_0173471 | 3300039437 | Bacteria | 110650 |
| 302 | Ga0436365_0432577 | 3300039437 | Bacteria | 641 |
| 303 | Ga0436365_0997613 | 3300039437 | Bacteria | 3241 |
| 304 | Ga0436365_1559618 | 3300039437 | Bacteria | 1048 |
| 305 | Ga0436365_1750591 | 3300039437 | Bacteria | 613 |
| 306 | Ga0436363_0489279 | 3300039450 | Bacteria | 683 |
| 307 | Ga0436363_1184338 | 3300039450 | Bacteria | 22162 |
| 308 | Ga0439465_0176880 | 3300041413 | Bacteria | 771 |
| 309 | Ga0451797_0546020 | 3300041453 | Bacteria | 817 |
| 310 | Ga0451797_0921940 | 3300041453 | Bacteria | 794 |
| 311 | Ga0451841_0961289 | 3300041498 | Bacteria | 1760 |
| 312 | Ga0439458_0061672 | 3300042157 | Bacteria | 937 |
| 313 | Ga0439460_0046886 | 3300042461 | Bacteria | 1285 |
| 314 | Ga0466972_0012273 | 3300044658 | Bacteria | 4306 |
| 315 | Ga0453684_0064389 | 3300044712 | Bacteria | 4684 |
| 316 | Ga0466960_0035900 | 3300044901 | Bacteria | 2319 |
| 317 | Ga0451576_0480621 | 3300045051 | Bacteria | 1305 |
| 318 | Ga0466967_0441608 | 3300045976 | Bacteria | 1271 |
| 319 | Ga0466967_0477072 | 3300045976 | Bacteria | 1222 |
| 320 | Ga0495638_0047638 | 3300046460 | Bacteria | 2686 |
| 321 | Ga0495653_0169714 | 3300046463 | Bacteria | 1507 |
| 322 | Ga0495610_0065737 | 3300046512 | Bacteria | 1710 |
| 323 | Ga0495637_0071599 | 3300046520 | Bacteria | 1398 |
| 324 | Ga0495643_0046095 | 3300046522 | Bacteria | 2365 |
| 325 | Ga0495643_0065747 | 3300046522 | Bacteria | 1914 |
| 326 | Ga0495648_0149853 | 3300046524 | Bacteria | 1218 |
| 327 | Ga0495654_0162867 | 3300046530 | Bacteria | 978 |
| 328 | Ga0495586_0058619 | 3300046535 | Bacteria | 2091 |
| 329 | Ga0495621_0029886 | 3300046539 | Bacteria | 1860 |
| 330 | Ga0495597_0010903 | 3300046542 | Bacteria | 4422 |
| 331 | Ga0495597_0096249 | 3300046542 | Bacteria | 1252 |
| 332 | Ga0495633_0095646 | 3300046558 | Bacteria | 1380 |
| 333 | Ga0495668_0009397 | 3300046616 | Bacteria | 6011 |
| 334 | Ga0495668_0015679 | 3300046616 | Bacteria | 4418 |
| 335 | Ga0495625_0123923 | 3300046660 | Bacteria | 1756 |
| 336 | Ga0495625_0209302 | 3300046660 | Bacteria | 1282 |
| 337 | Ga0495625_0489786 | 3300046660 | Bacteria | 753 |
| 338 | Ga0495670_0555521 | 3300046691 | Bacteria | 625 |
| 339 | Ga0495649_0238450 | 3300046694 | Bacteria | 937 |
| 340 | Ga0495660_0059355 | 3300046810 | Bacteria | 2058 |
| 341 | Ga0495687_125786 | 3300047443 | Bacteria | 917 |
| 342 | Ga0495686_0222770 | 3300047472 | Bacteria | 1072 |
| 343 | Ga0495615_0000025 | 3300048090 | Bacteria | 49753 |
| 344 | Ga0496100_0247481 | 3300048903 | Bacteria | 1317 |
| 345 | Ga0496101_0009564 | 3300048904 | Bacteria | 6375 |
| 346 | Ga0496102_0155142 | 3300048905 | Bacteria | 2152 |
| 347 | Ga0496102_0309499 | 3300048905 | Bacteria | 1489 |
| 348 | Ga0496102_0591259 | 3300048905 | Bacteria | 1033 |
| 349 | Ga0496103_0008264 | 3300048906 | Bacteria | 6180 |
| 350 | Ga0496103_0144432 | 3300048906 | Bacteria | 1523 |
| 351 | Ga0496104_0028553 | 3300048907 | Bacteria | 5170 |
| 352 | Ga0496105_0116263 | 3300048908 | Bacteria | 2206 |
| 353 | Ga0496106_0009457 | 3300048909 | Bacteria | 7206 |
| 354 | Ga0496107_0000740 | 3300048910 | Bacteria | 18701 |
| 355 | Ga0496107_0763028 | 3300048910 | Bacteria | 709 |
| 356 | Ga0496109_0750467 | 3300048912 | Bacteria | 914 |
| 357 | Ga0496110_0090794 | 3300048913 | Bacteria | 2731 |
| 358 | Ga0496111_0037922 | 3300048914 | Bacteria | 3450 |
| 359 | Ga0496114_1065550 | 3300048917 | Bacteria | 693 |
| 360 | Ga0496115_0083231 | 3300048918 | Bacteria | 2608 |
| 361 | Ga0496118_0088916 | 3300048921 | Bacteria | 2134 |
| 362 | Ga0496118_0201605 | 3300048921 | Bacteria | 1178 |
| 363 | Ga0496119_0060239 | 3300048922 | Bacteria | 2274 |
| 364 | Ga0496119_0074460 | 3300048922 | Bacteria | 1977 |
| 365 | Ga0496120_0002673 | 3300048923 | Bacteria | 17544 |
| 366 | Ga0496121_0002650 | 3300048924 | Bacteria | 26852 |
| 367 | Ga0496121_0087821 | 3300048924 | Bacteria | 2439 |
| 368 | Ga0496121_0153215 | 3300048924 | Bacteria | 1694 |
| 369 | Ga0496121_0649927 | 3300048924 | Bacteria | 642 |
| 370 | Ga0496122_0005810 | 3300048925 | Bacteria | 14503 |
| 371 | Ga0496123_0005504 | 3300048926 | Bacteria | 12731 |
| 372 | Ga0496124_0069030 | 3300048927 | Bacteria | 2935 |
| 373 | Ga0496124_0203651 | 3300048927 | Bacteria | 1503 |
| 374 | Ga0496125_0083970 | 3300048928 | Bacteria | 2420 |
| 375 | Ga0496125_0148194 | 3300048928 | Bacteria | 1618 |
| 376 | Ga0496125_0604038 | 3300048928 | Bacteria | 598 |
| 377 | Ga0501306_010832 | 3300049127 | Bacteria | 1154 |
| 378 | Ga0501031_0000076 | 3300049568 | Bacteria | 51870 |
| 379 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 380 | Ga0501032_0000004 | 3300049569 | Bacteria | 310855 |
| 381 | Ga0501033_0000156 | 3300049570 | Bacteria | 65847 |
| 382 | Ga0501033_0000275 | 3300049570 | Bacteria | 49587 |
| 383 | Ga0501033_0243242 | 3300049570 | Bacteria | 1276 |
| 384 | Ga0501033_0682557 | 3300049570 | Bacteria | 700 |
| 385 | Ga0501034_0000011 | 3300049571 | Bacteria | 310855 |
| 386 | Ga0501034_0000036 | 3300049571 | Bacteria | 239274 |
| 387 | Ga0501034_0040933 | 3300049571 | Bacteria | 4689 |
| 388 | Ga0501034_0101428 | 3300049571 | Bacteria | 2872 |
| 389 | Ga0501034_0157893 | 3300049571 | Bacteria | 2241 |
| 390 | Ga0501034_0329833 | 3300049571 | Bacteria | 1458 |
| 391 | Ga0501036_0000001 | 3300049572 | Bacteria | 310855 |
| 392 | Ga0501036_0000358 | 3300049572 | Bacteria | 32271 |
| 393 | Ga0501037_0000064 | 3300049573 | Bacteria | 97087 |
| 394 | Ga0501037_0000091 | 3300049573 | Bacteria | 84811 |
| 395 | Ga0501038_0000003 | 3300049574 | Bacteria | 310855 |
| 396 | Ga0501038_0003916 | 3300049574 | Bacteria | 13845 |
| 397 | Ga0501039_0000004 | 3300049575 | Bacteria | 310855 |
| 398 | Ga0501039_0000011 | 3300049575 | Bacteria | 245124 |
| 399 | Ga0501040_0009503 | 3300049576 | Bacteria | 6341 |
| 400 | Ga0501043_0000016 | 3300049579 | Bacteria | 170869 |
| 401 | Ga0501043_0017948 | 3300049579 | Bacteria | 5548 |
| 402 | Ga0501043_0018243 | 3300049579 | Bacteria | 5501 |
| 403 | Ga0501046_0143406 | 3300049580 | Bacteria | 1806 |
| 404 | Ga0501047_0000876 | 3300049581 | Bacteria | 30712 |
| 405 | Ga0501047_0004675 | 3300049581 | Bacteria | 12881 |
| 406 | Ga0501047_0138675 | 3300049581 | Bacteria | 2311 |
| 407 | Ga0501047_0554912 | 3300049581 | Bacteria | 973 |
| 408 | Ga0501047_0594242 | 3300049581 | Bacteria | 929 |
| 409 | Ga0501070_0009150 | 3300049586 | Bacteria | 8377 |
| 410 | Ga0501070_0164737 | 3300049586 | Bacteria | 1827 |
| 411 | Ga0501072_0641820 | 3300049588 | Bacteria | 836 |
| 412 | Ga0501249_000464 | 3300049679 | Bacteria | 10123 |
| 413 | Ga0501035_0000009 | 3300049822 | Bacteria | 310827 |
| 414 | Ga0501035_0022781 | 3300049822 | Bacteria | 5752 |
| 415 | Ga0501035_0057893 | 3300049822 | Bacteria | 3454 |
| 416 | Ga0501035_0779129 | 3300049822 | Bacteria | 765 |
| 417 | Ga0501044_0000005 | 3300049823 | Bacteria | 310855 |
| 418 | Ga0501044_0021762 | 3300049823 | Bacteria | 6837 |
| 419 | Ga0501044_0042055 | 3300049823 | Bacteria | 4756 |
| 420 | Ga0501044_0241792 | 3300049823 | Bacteria | 1749 |
| 421 | Ga0501044_0472556 | 3300049823 | Bacteria | 1158 |
| 422 | Ga0501204_005586 | 3300049850 | Bacteria | 1384 |
| 423 | nmdc:mga03683_29702_c1 | 3300050489 | Bacteria | 2181 |
| 424 | nmdc:mga03683_5140_c2 | 3300050489 | Bacteria | 3055 |
| 425 | nmdc:mga03683_55_c1 | 3300050489 | Bacteria | 47333 |
| 426 | nmdc:mga03n38_29730_c1 | 3300050490 | Bacteria | 2289 |
| 427 | nmdc:mga03n38_3343_c1 | 3300050490 | Bacteria | 5134 |
| 428 | nmdc:mga03n38_370229_c1 | 3300050490 | Bacteria | 783 |
| 429 | nmdc:mga03n38_71670_c1 | 3300050490 | Bacteria | 1605 |
| 430 | nmdc:mga00v17_1644_c1 | 3300050491 | Bacteria | 11664 |
| 431 | nmdc:mga00v17_257278_c1 | 3300050491 | Bacteria | 1132 |
| 432 | nmdc:mga00v17_270354_c1 | 3300050491 | Bacteria | 1103 |
| 433 | nmdc:mga00v17_43681_c1 | 3300050491 | Bacteria | 2700 |
| 434 | nmdc:mga0yw44_156695_c1 | 3300050492 | Bacteria | 1489 |
| 435 | nmdc:mga0yw44_162014_c1 | 3300050492 | Bacteria | 1465 |
| 436 | nmdc:mga0yw44_245944_c1 | 3300050492 | Bacteria | 1190 |
| 437 | nmdc:mga0yw44_73747_c1 | 3300050492 | Bacteria | 2124 |
| 438 | nmdc:mga0k408_1951_c1 | 3300050493 | Bacteria | 11058 |
| 439 | nmdc:mga0k408_450637_c1 | 3300050493 | Bacteria | 764 |
| 440 | nmdc:mga06z11_1082_c1 | 3300050494 | Bacteria | 9916 |
| 441 | nmdc:mga06z11_309815_c1 | 3300050494 | Bacteria | 940 |
| 442 | nmdc:mga06z11_31721_c1 | 3300050494 | Bacteria | 2570 |
| 443 | nmdc:mga06z11_80514_c1 | 3300050494 | Bacteria | 1746 |
| 444 | nmdc:mga04h51_1318_c1 | 3300050495 | Bacteria | 5720 |
| 445 | nmdc:mga04h51_145057_c1 | 3300050495 | Bacteria | 903 |
| 446 | nmdc:mga04h51_58792_c1 | 3300050495 | Bacteria | 1312 |
| 447 | nmdc:mga07m45_169244_c1 | 3300050496 | Bacteria | 1270 |
| 448 | nmdc:mga07m45_185778_c1 | 3300050496 | Bacteria | 1209 |
| 449 | nmdc:mga07m45_27326_c1 | 3300050496 | Bacteria | 3142 |
| 450 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 451 | nmdc:mga07m45_55_c1 | 3300050496 | Bacteria | 47453 |
| 452 | nmdc:mga0sz30_132359_c1 | 3300050516 | Bacteria | 1099 |
| 453 | nmdc:mga0sz30_2912_c1 | 3300050516 | Bacteria | 6133 |
| 454 | nmdc:mga0sz30_303_c1 | 3300050516 | Bacteria | 18938 |
| 455 | Ga0495612_0476998 | 3300053078 | Bacteria | 571 |
| 456 | Ga0500610_0026528 | 3300053079 | Bacteria | 2899 |
| 457 | Ga0495655_0008528 | 3300053083 | Bacteria | 1951 |
| 458 | Ga0500643_000167 | 3300053087 | Bacteria | 64874 |
| 459 | Ga0500643_039415 | 3300053087 | Bacteria | 1396 |
| 460 | Ga0500643_057773 | 3300053087 | Bacteria | 1094 |
| 461 | Ga0500644_0007223 | 3300053088 | Bacteria | 2885 |
| 462 | Ga0500647_0059268 | 3300053091 | Bacteria | 1841 |
| 463 | Ga0500647_0200154 | 3300053091 | Bacteria | 906 |
| 464 | Ga0500651_0002180 | 3300053093 | Bacteria | 10245 |
| 465 | Ga0500641_0023205 | 3300053096 | Bacteria | 2384 |
| 466 | Ga0500594_0117019 | 3300053118 | Bacteria | 834 |
| 467 | Ga0500595_049173 | 3300053119 | Bacteria | 1315 |
| 468 | Ga0500607_000354 | 3300053121 | Bacteria | 43487 |
| 469 | Ga0500607_075177 | 3300053121 | Bacteria | 1735 |
| 470 | Ga0500608_000755 | 3300053122 | Bacteria | 11796 |
| 471 | Ga0500618_027385 | 3300053125 | Bacteria | 1356 |
| 472 | Ga0500642_0001008 | 3300053130 | Bacteria | 8079 |
| 473 | Ga0500655_000162 | 3300053133 | Bacteria | 16347 |
| 474 | Ga0500559_0006081 | 3300053136 | Bacteria | 5469 |
| 475 | Ga0500559_0015561 | 3300053136 | Bacteria | 3212 |
| 476 | Ga0500564_015388 | 3300053138 | Bacteria | 3454 |
| 477 | Ga0500568_0000052 | 3300053139 | Bacteria | 112079 |
| 478 | Ga0500568_0105762 | 3300053139 | Bacteria | 1054 |
| 479 | Ga0500590_000967 | 3300053148 | Bacteria | 11087 |
| 480 | Ga0500616_0065036 | 3300053153 | Bacteria | 1876 |
| 481 | Ga0500620_001541 | 3300053155 | Bacteria | 4306 |
| 482 | Ga0500620_034796 | 3300053155 | Bacteria | 1619 |
| 483 | Ga0500622_0000145 | 3300053156 | Bacteria | 75417 |
| 484 | Ga0500622_0000446 | 3300053156 | Bacteria | 39340 |
| 485 | Ga0500622_0006224 | 3300053156 | Bacteria | 6981 |
| 486 | Ga0500627_0031410 | 3300053158 | Bacteria | 2230 |
| 487 | Ga0500627_0321403 | 3300053158 | Bacteria | 672 |
| 488 | Ga0500639_016444 | 3300053163 | Bacteria | 3901 |
| 489 | Ga0500636_0148639 | 3300053177 | Bacteria | 1289 |
| 490 | Ga0500637_0006247 | 3300053178 | Bacteria | 5850 |
| 491 | Ga0500567_000039 | 3300053723 | Bacteria | 27122 |
| 492 | Ga0500570_005298 | 3300053724 | Bacteria | 6886 |
| 493 | Ga0500611_006335 | 3300053727 | Bacteria | 1718 |
| 494 | Ga0500611_020789 | 3300053727 | Bacteria | 1244 |
| 495 | Ga0500625_000021 | 3300053729 | Bacteria | 83503 |
| 496 | Ga0500645_007973 | 3300053730 | Bacteria | 3649 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048910 | Ga0496107_0763028 | Ga0496107_0763028_15_449 | 140 |
| 2 | 3300014969 | Ga0157376_11333093 | Ga0157376_113330931 | 143 |
| 3 | 3300005328 | Ga0070676_10010997 | Ga0070676_100109972 | 145 |
| 4 | 3300009148 | Ga0105243_11215062 | Ga0105243_112150622 | 145 |
| 5 | 3300009176 | Ga0105242_10037486 | Ga0105242_100374863 | 145 |
| 6 | 3300025907 | Ga0207645_10016934 | Ga0207645_100169345 | 145 |
| 7 | 3300026116 | Ga0207674_10894007 | Ga0207674_108940072 | 145 |
| 8 | 3300006846 | Ga0075430_100434060 | Ga0075430_1004340602 | 148 |
| 9 | 3300046463 | Ga0495653_0169714 | Ga0495653_0169714_11_520 | 152 |
| 10 | 3300039437 | Ga0436365_1750591 | Ga0436365_1750591_62_580 | 153 |
| 11 | 3300039450 | Ga0436363_1184338 | Ga0436363_1184338_20560_21078 | 153 |
| 12 | iso_pu_bacteria | 2977971508 | 2977973602 | 153 |
| 13 | 3300053078 | Ga0495612_0476998 | Ga0495612_0476998_12_533 | 155 |
| 14 | 3300045976 | Ga0466967_0477072 | Ga0466967_0477072_407_925 | 156 |
| 15 | iso_pu_bacteria | 2958041894 | 2958045422 | 160 |
| 16 | 3300053158 | Ga0500627_0321403 | Ga0500627_0321403_20_538 | 164 |
| 17 | iso_pu_bacteria | 2503198000 | 2503198611 | 164 |
| 18 | iso_pu_bacteria | 2508501123 | 2509115720 | 164 |
| 19 | iso_pu_bacteria | 2509276018 | 2509368653 | 164 |
| 20 | iso_pu_bacteria | 2509276022 | 2509393398 | 164 |
| 21 | iso_pu_bacteria | 2510065059 | 2510314944 | 164 |
| 22 | iso_pu_bacteria | 2512875016 | 2512933949 | 164 |
| 23 | iso_pu_bacteria | 2513237090 | 2513610523 | 164 |
| 24 | iso_pu_bacteria | 2513237164 | 2514037130 | 164 |
| 25 | iso_pu_bacteria | 2513237305 | 2514417590 | 164 |
| 26 | iso_pu_bacteria | 2513237351 | 2514586117 | 164 |
| 27 | iso_pu_bacteria | 2588253730 | 2588520059 | 164 |
| 28 | iso_pu_bacteria | 2599185301 | 2599940146 | 164 |
| 29 | iso_pu_bacteria | 2643221550 | 2643770760 | 164 |
| 30 | iso_pu_bacteria | 2643221551 | 2643777750 | 164 |
| 31 | iso_pu_bacteria | 2643221555 | 2643796198 | 164 |
| 32 | iso_pu_bacteria | 2643221564 | 2643839683 | 164 |
| 33 | iso_pu_bacteria | 2643221595 | 2643983581 | 164 |
| 34 | iso_pu_bacteria | 2643221627 | 2644157222 | 164 |
| 35 | iso_pu_bacteria | 2687453392 | 2688595908 | 164 |
| 36 | iso_pu_bacteria | 2693429783 | 2694627849 | 164 |
| 37 | iso_pu_bacteria | 2693429784 | 2694636099 | 164 |
| 38 | iso_pu_bacteria | 2721755686 | 2723573169 | 164 |
| 39 | iso_pu_bacteria | 2756170246 | 2756674997 | 164 |
| 40 | iso_pu_bacteria | 2791355123 | 2792747099 | 164 |
| 41 | iso_pu_bacteria | 2844002411 | 2844003519 | 164 |
| 42 | iso_pu_bacteria | 2844009547 | 2844010721 | 164 |
| 43 | iso_pu_bacteria | 2847670302 | 2847673471 | 164 |
| 44 | iso_pu_bacteria | 2847686936 | 2847689979 | 164 |
| 45 | iso_pu_bacteria | 2856314179 | 2856319060 | 164 |
| 46 | iso_pu_bacteria | 2856320880 | 2856321054 | 164 |
| 47 | iso_pu_bacteria | 2856328259 | 2856332606 | 164 |
| 48 | iso_pu_bacteria | 2856334872 | 2856340594 | 164 |
| 49 | iso_pu_bacteria | 2856349417 | 2856350724 | 164 |
| 50 | iso_pu_bacteria | 2856356410 | 2856359910 | 164 |
| 51 | iso_pu_bacteria | 2856364286 | 2856369834 | 164 |
| 52 | iso_pu_bacteria | 2857349434 | 2857352974 | 164 |
| 53 | iso_pu_bacteria | 2869169390 | 2869171510 | 164 |
| 54 | iso_pu_bacteria | 2869234852 | 2869238090 | 164 |
| 55 | iso_pu_bacteria | 2869242130 | 2869249291 | 164 |
| 56 | iso_pu_bacteria | 2869249662 | 2869255393 | 164 |
| 57 | iso_pu_bacteria | 2869256925 | 2869262815 | 164 |
| 58 | iso_pu_bacteria | 2869264136 | 2869267728 | 164 |
| 59 | iso_pu_bacteria | 2869271264 | 2869273191 | 164 |
| 60 | iso_pu_bacteria | 2869278585 | 2869280713 | 164 |
| 61 | iso_pu_bacteria | 2869285874 | 2869290641 | 164 |
| 62 | iso_pu_bacteria | 2871429161 | 2871432923 | 164 |
| 63 | iso_pu_bacteria | 2871435913 | 2871437845 | 164 |
| 64 | iso_pu_bacteria | 2871444079 | 2871448569 | 164 |
| 65 | iso_pu_bacteria | 2871451962 | 2871454414 | 164 |
| 66 | iso_pu_bacteria | 2871459585 | 2871462749 | 164 |
| 67 | iso_pu_bacteria | 2871466892 | 2871472171 | 164 |
| 68 | iso_pu_bacteria | 2871481445 | 2871484714 | 164 |
| 69 | iso_pu_bacteria | 2871488783 | 2871489775 | 164 |
| 70 | iso_pu_bacteria | 2871495908 | 2871499854 | 164 |
| 71 | iso_pu_bacteria | 2874102143 | 2874107725 | 164 |
| 72 | iso_pu_bacteria | 2874109183 | 2874110830 | 164 |
| 73 | iso_pu_bacteria | 2874116593 | 2874121831 | 164 |
| 74 | iso_pu_bacteria | 2874123672 | 2874128410 | 164 |
| 75 | iso_pu_bacteria | 2874131515 | 2874133839 | 164 |
| 76 | iso_pu_bacteria | 2874139085 | 2874143149 | 164 |
| 77 | iso_pu_bacteria | 2874146452 | 2874153916 | 164 |
| 78 | iso_pu_bacteria | 2874155637 | 2874158604 | 164 |
| 79 | iso_pu_bacteria | 2874162495 | 2874165838 | 164 |
| 80 | iso_pu_bacteria | 2874168670 | 2874172362 | 164 |
| 81 | iso_pu_bacteria | 2876363079 | 2876363796 | 164 |
| 82 | iso_pu_bacteria | 2876369609 | 2876372938 | 164 |
| 83 | iso_pu_bacteria | 2876377896 | 2876384214 | 164 |
| 84 | iso_pu_bacteria | 2876386047 | 2876389784 | 164 |
| 85 | iso_pu_bacteria | 2876392853 | 2876397000 | 164 |
| 86 | iso_pu_bacteria | 2876399893 | 2876403201 | 164 |
| 87 | iso_pu_bacteria | 2876406927 | 2876413821 | 164 |
| 88 | iso_pu_bacteria | 2876413966 | 2876419221 | 164 |
| 89 | iso_pu_bacteria | 2876420981 | 2876425889 | 164 |
| 90 | iso_pu_bacteria | 2878035449 | 2878039449 | 164 |
| 91 | iso_pu_bacteria | 2878730984 | 2878737732 | 164 |
| 92 | iso_pu_bacteria | 2878738818 | 2878740786 | 164 |
| 93 | iso_pu_bacteria | 2878745973 | 2878750536 | 164 |
| 94 | iso_pu_bacteria | 2878753008 | 2878754189 | 164 |
| 95 | iso_pu_bacteria | 2878760144 | 2878764018 | 164 |
| 96 | iso_pu_bacteria | 2878767105 | 2878771048 | 164 |
| 97 | iso_pu_bacteria | 2878774303 | 2878776836 | 164 |
| 98 | iso_pu_bacteria | 2878781027 | 2878787044 | 164 |
| 99 | iso_pu_bacteria | 2881147464 | 2881148238 | 164 |
| 100 | iso_pu_bacteria | 2881155292 | 2881159322 | 164 |
| 101 | iso_pu_bacteria | 2881161766 | 2881165022 | 164 |
| 102 | iso_pu_bacteria | 2881845957 | 2881847884 | 164 |
| 103 | iso_pu_bacteria | 2881853255 | 2881855913 | 164 |
| 104 | iso_pu_bacteria | 2881861095 | 2881864572 | 164 |
| 105 | iso_pu_bacteria | 2882632389 | 2882636770 | 164 |
| 106 | iso_pu_bacteria | 2882912400 | 2882912532 | 164 |
| 107 | iso_pu_bacteria | 2885318864 | 2885319432 | 164 |
| 108 | iso_pu_bacteria | 2885342637 | 2885349295 | 164 |
| 109 | iso_pu_bacteria | 2885350715 | 2885352064 | 164 |
| 110 | iso_pu_bacteria | 2888337043 | 2888343157 | 164 |
| 111 | iso_pu_bacteria | 2888350351 | 2888353149 | 164 |
| 112 | iso_pu_bacteria | 2889010040 | 2889014953 | 164 |
| 113 | iso_pu_bacteria | 2889016732 | 2889019976 | 164 |
| 114 | iso_pu_bacteria | 2903492973 | 2903497496 | 164 |
| 115 | iso_pu_bacteria | 2903492973 | 2903499618 | 164 |
| 116 | iso_pu_bacteria | 2903513507 | 2903517449 | 164 |
| 117 | iso_pu_bacteria | 2903521522 | 2903526045 | 164 |
| 118 | iso_pu_bacteria | 2903528002 | 2903532409 | 164 |
| 119 | iso_pu_bacteria | 2903540706 | 2903544665 | 164 |
| 120 | iso_pu_bacteria | 2904659560 | 2904663754 | 164 |
| 121 | iso_pu_bacteria | 2906308376 | 2906313461 | 164 |
| 122 | iso_pu_bacteria | 2906321335 | 2906326170 | 164 |
| 123 | iso_pu_bacteria | 2906328253 | 2906334158 | 164 |
| 124 | iso_pu_bacteria | 2906354277 | 2906361415 | 164 |
| 125 | iso_pu_bacteria | 2906363423 | 2906363624 | 164 |
| 126 | iso_pu_bacteria | 2906370794 | 2906377906 | 164 |
| 127 | iso_pu_bacteria | 2906386501 | 2906393087 | 164 |
| 128 | iso_pu_bacteria | 2906393657 | 2906397125 | 164 |
| 129 | iso_pu_bacteria | 2906401398 | 2906408167 | 164 |
| 130 | iso_pu_bacteria | 2906408224 | 2906409148 | 164 |
| 131 | iso_pu_bacteria | 2906414383 | 2906419131 | 164 |
| 132 | iso_pu_bacteria | 2906427513 | 2906433985 | 164 |
| 133 | iso_pu_bacteria | 2922130491 | 2922135557 | 164 |
| 134 | iso_pu_bacteria | 2922151315 | 2922153631 | 164 |
| 135 | iso_pu_bacteria | 2922158528 | 2922162000 | 164 |
| 136 | iso_pu_bacteria | 2922172374 | 2922174300 | 164 |
| 137 | iso_pu_bacteria | 2922178524 | 2922181855 | 164 |
| 138 | iso_pu_bacteria | 2922185730 | 2922190801 | 164 |
| 139 | iso_pu_bacteria | 2924710171 | 2924716360 | 164 |
| 140 | iso_pu_bacteria | 2924718760 | 2924726442 | 164 |
| 141 | iso_pu_bacteria | 2924726620 | 2924731435 | 164 |
| 142 | iso_pu_bacteria | 2924733363 | 2924737479 | 164 |
| 143 | iso_pu_bacteria | 2924741084 | 2924741560 | 164 |
| 144 | iso_pu_bacteria | 2924748358 | 2924753194 | 164 |
| 145 | iso_pu_bacteria | 2924762789 | 2924766142 | 164 |
| 146 | iso_pu_bacteria | 2924776078 | 2924778387 | 164 |
| 147 | iso_pu_bacteria | 2924784321 | 2924784878 | 164 |
| 148 | iso_pu_bacteria | 2937813078 | 2937820235 | 164 |
| 149 | iso_pu_bacteria | 2937822353 | 2937822672 | 164 |
| 150 | iso_pu_bacteria | 2937861824 | 2937863134 | 164 |
| 151 | iso_pu_bacteria | 2937868953 | 2937870780 | 164 |
| 152 | iso_pu_bacteria | 2937877337 | 2937878186 | 164 |
| 153 | iso_pu_bacteria | 2937891427 | 2937891752 | 164 |
| 154 | iso_pu_bacteria | 2937972304 | 2937980097 | 164 |
| 155 | iso_pu_bacteria | 2937980651 | 2937988243 | 164 |
| 156 | iso_pu_bacteria | 2937994558 | 2937998513 | 164 |
| 157 | iso_pu_bacteria | 2938014810 | 2938018496 | 164 |
| 158 | iso_pu_bacteria | 2958034702 | 2958036586 | 164 |
| 159 | iso_pu_bacteria | 2958041894 | 2958046525 | 164 |
| 160 | iso_pu_bacteria | 2958064165 | 2958066875 | 164 |
| 161 | iso_pu_bacteria | 2958084443 | 2958085301 | 164 |
| 162 | iso_pu_bacteria | 2958092219 | 2958094947 | 164 |
| 163 | iso_pu_bacteria | 2958100919 | 2958106567 | 164 |
| 164 | iso_pu_bacteria | 2958108152 | 2958113510 | 164 |
| 165 | iso_pu_bacteria | 2958115193 | 2958119140 | 164 |
| 166 | iso_pu_bacteria | 2958122699 | 2958125517 | 164 |
| 167 | iso_pu_bacteria | 2958130278 | 2958135041 | 164 |
| 168 | iso_pu_bacteria | 2958137437 | 2958143414 | 164 |
| 169 | iso_pu_bacteria | 2958144490 | 2958145648 | 164 |
| 170 | iso_pu_bacteria | 2958158011 | 2958164465 | 164 |
| 171 | iso_pu_bacteria | 2958165035 | 2958168989 | 164 |
| 172 | iso_pu_bacteria | 2958172287 | 2958172880 | 164 |
| 173 | iso_pu_bacteria | 2958179912 | 2958184070 | 164 |
| 174 | iso_pu_bacteria | 2961077736 | 2961082125 | 164 |
| 175 | iso_pu_bacteria | 2961114664 | 2961119106 | 164 |
| 176 | iso_pu_bacteria | 2961127735 | 2961127770 | 164 |
| 177 | iso_pu_bacteria | 2961136820 | 2961139871 | 164 |
| 178 | iso_pu_bacteria | 2961163497 | 2961167451 | 164 |
| 179 | iso_pu_bacteria | 2961170736 | 2961176248 | 164 |
| 180 | iso_pu_bacteria | 2961183825 | 2961185567 | 164 |
| 181 | iso_pu_bacteria | 2963644680 | 2963645255 | 164 |
| 182 | iso_pu_bacteria | 2965018300 | 2965022273 | 164 |
| 183 | iso_pu_bacteria | 2965025482 | 2965030054 | 164 |
| 184 | iso_pu_bacteria | 2965032056 | 2965038574 | 164 |
| 185 | iso_pu_bacteria | 2965040258 | 2965045979 | 164 |
| 186 | iso_pu_bacteria | 2965047637 | 2965051573 | 164 |
| 187 | iso_pu_bacteria | 2965062239 | 2965068533 | 164 |
| 188 | iso_pu_bacteria | 2965089291 | 2965096081 | 164 |
| 189 | iso_pu_bacteria | 2965110997 | 2965116938 | 164 |
| 190 | iso_pu_bacteria | 2965119406 | 2965120997 | 164 |
| 191 | iso_pu_bacteria | 2967996073 | 2967996838 | 164 |
| 192 | iso_pu_bacteria | 2968003550 | 2968004901 | 164 |
| 193 | iso_pu_bacteria | 2968016561 | 2968023133 | 164 |
| 194 | iso_pu_bacteria | 2968091066 | 2968093569 | 164 |
| 195 | iso_pu_bacteria | 2968097103 | 2968101386 | 164 |
| 196 | iso_pu_bacteria | 2968110612 | 2968114893 | 164 |
| 197 | iso_pu_bacteria | 2968117919 | 2968122624 | 164 |
| 198 | iso_pu_bacteria | 2968128360 | 2968134002 | 164 |
| 199 | iso_pu_bacteria | 2968138860 | 2968141793 | 164 |
| 200 | iso_pu_bacteria | 2968171901 | 2968175858 | 164 |
| 201 | iso_pu_bacteria | 2970469710 | 2970475717 | 164 |
| 202 | iso_pu_bacteria | 2970489779 | 2970491967 | 164 |
| 203 | iso_pu_bacteria | 2970503327 | 2970508919 | 164 |
| 204 | iso_pu_bacteria | 2970510686 | 2970513403 | 164 |
| 205 | iso_pu_bacteria | 2970532167 | 2970536619 | 164 |
| 206 | iso_pu_bacteria | 2970547951 | 2970553495 | 164 |
| 207 | iso_pu_bacteria | 2970554993 | 2970558862 | 164 |
| 208 | iso_pu_bacteria | 2970593180 | 2970595419 | 164 |
| 209 | iso_pu_bacteria | 2970619444 | 2970623095 | 164 |
| 210 | iso_pu_bacteria | 2970627176 | 2970632753 | 164 |
| 211 | iso_pu_bacteria | 2977821940 | 2977823404 | 164 |
| 212 | iso_pu_bacteria | 2977828996 | 2977830540 | 164 |
| 213 | iso_pu_bacteria | 2977843712 | 2977847072 | 164 |
| 214 | iso_pu_bacteria | 2977851361 | 2977854650 | 164 |
| 215 | iso_pu_bacteria | 2977858184 | 2977864175 | 164 |
| 216 | iso_pu_bacteria | 2977864932 | 2977868140 | 164 |
| 217 | iso_pu_bacteria | 2977872689 | 2977876554 | 164 |
| 218 | iso_pu_bacteria | 2977898635 | 2977902394 | 164 |
| 219 | iso_pu_bacteria | 2977907340 | 2977911571 | 164 |
| 220 | iso_pu_bacteria | 2977915119 | 2977921208 | 164 |
| 221 | iso_pu_bacteria | 2977935797 | 2977941023 | 164 |
| 222 | iso_pu_bacteria | 2977942078 | 2977943311 | 164 |
| 223 | iso_pu_bacteria | 2977950692 | 2977956005 | 164 |
| 224 | iso_pu_bacteria | 2977957713 | 2977958891 | 164 |
| 225 | iso_pu_bacteria | 2979710463 | 2979713783 | 164 |
| 226 | iso_pu_bacteria | 2979742915 | 2979750500 | 164 |
| 227 | iso_pu_bacteria | 2979764755 | 2979767571 | 164 |
| 228 | iso_pu_bacteria | 2979772303 | 2979773559 | 164 |
| 229 | iso_pu_bacteria | 2979779861 | 2979786402 | 164 |
| 230 | iso_pu_bacteria | 2979793036 | 2979800624 | 164 |
| 231 | iso_pu_bacteria | 2979808191 | 2979813598 | 164 |
| 232 | iso_pu_bacteria | 2987636660 | 2987641566 | 164 |
| 233 | iso_pu_bacteria | 2987645492 | 2987650037 | 164 |
| 234 | iso_pu_bacteria | 2987652177 | 2987653434 | 164 |
| 235 | iso_pu_bacteria | 2987659509 | 2987663457 | 164 |
| 236 | iso_pu_bacteria | 2987666974 | 2987666980 | 164 |
| 237 | iso_pu_bacteria | 2987673487 | 2987674909 | 164 |
| 238 | iso_pu_bacteria | 2996341866 | 2996341937 | 164 |
| 239 | iso_pu_bacteria | 2996348954 | 2996355655 | 164 |
| 240 | iso_pu_bacteria | 2996386984 | 2996387140 | 164 |
| 241 | iso_pu_bacteria | 3000135777 | 3000137324 | 164 |
| 242 | iso_pu_bacteria | 3004167301 | 3004173188 | 164 |
| 243 | iso_pu_bacteria | 3004188549 | 3004192516 | 164 |
| 244 | iso_pu_bacteria | 3004195979 | 3004199975 | 164 |
| 245 | iso_pu_bacteria | 3004203850 | 3004209623 | 164 |
| 246 | iso_pu_bacteria | 3004232784 | 3004233735 | 164 |
| 247 | iso_pu_bacteria | 3004239961 | 3004246792 | 164 |
| 248 | iso_pu_bacteria | 3004248173 | 3004251073 | 164 |
| 249 | iso_pu_bacteria | 3004275668 | 3004282081 | 164 |
| 250 | iso_pu_bacteria | 637000159 | 637077102 | 164 |
| 251 | iso_pu_bacteria | 649633066 | 649870475 | 164 |
| 252 | iso_pu_bacteria | 8004300914 | 8004301204 | 164 |
| 253 | iso_pu_bacteria | 8004312739 | 8004314907 | 164 |
| 254 | iso_pu_bacteria | 8004361976 | 8004362751 | 164 |
| 255 | iso_pu_bacteria | 8004374579 | 8004375766 | 164 |
| 256 | iso_pu_bacteria | 8004387939 | 8004392930 | 164 |
| 257 | iso_pu_bacteria | 8004445564 | 8004449460 | 164 |
| 258 | iso_pu_bacteria | 8004640170 | 8004643877 | 164 |
| 259 | iso_pu_bacteria | 8004695233 | 8004700944 | 164 |
| 260 | iso_pu_bacteria | 8004703790 | 8004706723 | 164 |
| 261 | iso_pu_bacteria | 8004714634 | 8004719717 | 164 |
| 262 | iso_pu_bacteria | 8004727605 | 8004731084 | 164 |
| 263 | 3300017792 | Ga0163161_11001700 | Ga0163161_110017001 | 165 |
| 264 | 3300049823 | Ga0501044_0472556 | Ga0501044_0472556_486_992 | 165 |
| 265 | iso_pu_bacteria | 2597489875 | 2597810308 | 165 |
| 266 | iso_pu_bacteria | 2856342000 | 2856345141 | 165 |
| 267 | iso_pu_bacteria | 2869162929 | 2869163405 | 165 |
| 268 | iso_pu_bacteria | 2878788777 | 2878796312 | 165 |
| 269 | iso_pu_bacteria | 2885312484 | 2885314221 | 165 |
| 270 | iso_pu_bacteria | 2888343758 | 2888344292 | 165 |
| 271 | iso_pu_bacteria | 2924754689 | 2924758515 | 165 |
| 272 | iso_pu_bacteria | 2958071322 | 2958077254 | 165 |
| 273 | iso_pu_bacteria | 2970524798 | 2970525973 | 165 |
| 274 | iso_pu_bacteria | 2970540015 | 2970543677 | 165 |
| 275 | iso_pu_bacteria | 3005445848 | 3005452485 | 165 |
| 276 | iso_pu_bacteria | 8004395343 | 8004398951 | 165 |
| 277 | iso_pu_bacteria | 8055617313 | 8055617806 | 165 |
| 278 | 3300021384 | Ga0213876_10110479 | Ga0213876_101104791 | 166 |
| 279 | 3300021388 | Ga0213875_10004220 | Ga0213875_100042207 | 166 |
| 280 | 3300021388 | Ga0213875_10047458 | Ga0213875_100474582 | 166 |
| 281 | 3300037853 | Ga0436364_0088168 | Ga0436364_0088168_144_698 | 166 |
| 282 | 3300037853 | Ga0436364_0790157 | Ga0436364_0790157_56_586 | 166 |
| 283 | 3300037853 | Ga0436364_1359870 | Ga0436364_1359870_1095_1649 | 166 |
| 284 | 3300037853 | Ga0436364_1508701 | Ga0436364_1508701_149_685 | 166 |
| 285 | 3300039437 | Ga0436365_0432577 | Ga0436365_0432577_54_584 | 166 |
| 286 | 3300039437 | Ga0436365_0997613 | Ga0436365_0997613_104_658 | 166 |
| 287 | 3300049570 | Ga0501033_0682557 | Ga0501033_0682557_126_635 | 166 |
| 288 | iso_pu_bacteria | 2996336353 | 2996336854 | 166 |
| 289 | iso_pu_bacteria | 2906378014 | 2906383300 | 167 |
| 290 | 3300001979 | JGI24740J21852_10043523 | JGI24740J21852_100435232 | 168 |
| 291 | 3300002067 | JGI24735J21928_10092387 | JGI24735J21928_100923871 | 168 |
| 292 | 3300002705 | JGI25156J39149_1011787 | JGI25156J39149_10117872 | 168 |
| 293 | 3300003214 | JGI25165J46597_1000079 | JGI25165J46597_100007985 | 168 |
| 294 | 3300003322 | rootL2_10186239 | rootL2_101862392 | 168 |
| 295 | 3300003762 | Ga0055542_1000951 | Ga0055542_10009518 | 168 |
| 296 | 3300003763 | Ga0055529_1009398 | Ga0055529_10093982 | 168 |
| 297 | 3300005293 | Ga0065715_10207065 | Ga0065715_102070652 | 168 |
| 298 | 3300005331 | Ga0070670_100417861 | Ga0070670_1004178612 | 168 |
| 299 | 3300005353 | Ga0070669_101016064 | Ga0070669_1010160641 | 168 |
| 300 | 3300005367 | Ga0070667_101045392 | Ga0070667_1010453921 | 168 |
| 301 | 3300005436 | Ga0070713_100011267 | Ga0070713_1000112672 | 168 |
| 302 | 3300005455 | Ga0070663_100484421 | Ga0070663_1004844212 | 168 |
| 303 | 3300005459 | Ga0068867_100524866 | Ga0068867_1005248662 | 168 |
| 304 | 3300005535 | Ga0070684_101100321 | Ga0070684_1011003211 | 168 |
| 305 | 3300005539 | Ga0068853_100012737 | Ga0068853_1000127372 | 168 |
| 306 | 3300005539 | Ga0068853_100315429 | Ga0068853_1003154292 | 168 |
| 307 | 3300005548 | Ga0070665_100407753 | Ga0070665_1004077532 | 168 |
| 308 | 3300005548 | Ga0070665_100710073 | Ga0070665_1007100732 | 168 |
| 309 | 3300005563 | Ga0068855_100656771 | Ga0068855_1006567712 | 168 |
| 310 | 3300005577 | Ga0068857_101402537 | Ga0068857_1014025371 | 168 |
| 311 | 3300005578 | Ga0068854_100469225 | Ga0068854_1004692251 | 168 |
| 312 | 3300005614 | Ga0068856_100103164 | Ga0068856_1001031644 | 168 |
| 313 | 3300005614 | Ga0068856_100298031 | Ga0068856_1002980312 | 168 |
| 314 | 3300005614 | Ga0068856_100352559 | Ga0068856_1003525592 | 168 |
| 315 | 3300005614 | Ga0068856_100925274 | Ga0068856_1009252741 | 168 |
| 316 | 3300005616 | Ga0068852_100149801 | Ga0068852_1001498012 | 168 |
| 317 | 3300005616 | Ga0068852_100514593 | Ga0068852_1005145932 | 168 |
| 318 | 3300006038 | Ga0075365_10239018 | Ga0075365_102390182 | 168 |
| 319 | 3300006042 | Ga0075368_10015771 | Ga0075368_100157714 | 168 |
| 320 | 3300006042 | Ga0075368_10116693 | Ga0075368_101166931 | 168 |
| 321 | 3300006048 | Ga0075363_100038266 | Ga0075363_1000382664 | 168 |
| 322 | 3300006048 | Ga0075363_100354932 | Ga0075363_1003549322 | 168 |
| 323 | 3300006051 | Ga0075364_10266176 | Ga0075364_102661762 | 168 |
| 324 | 3300006051 | Ga0075364_10671225 | Ga0075364_106712252 | 168 |
| 325 | 3300006177 | Ga0075362_10070428 | Ga0075362_100704282 | 168 |
| 326 | 3300006177 | Ga0075362_10148000 | Ga0075362_101480002 | 168 |
| 327 | 3300006178 | Ga0075367_10030395 | Ga0075367_100303952 | 168 |
| 328 | 3300006178 | Ga0075367_10120477 | Ga0075367_101204772 | 168 |
| 329 | 3300006186 | Ga0075369_10056869 | Ga0075369_100568691 | 168 |
| 330 | 3300006237 | Ga0097621_100051892 | Ga0097621_1000518924 | 168 |
| 331 | 3300006237 | Ga0097621_100070667 | Ga0097621_1000706672 | 168 |
| 332 | 3300006237 | Ga0097621_101054494 | Ga0097621_1010544941 | 168 |
| 333 | 3300006358 | Ga0068871_100227713 | Ga0068871_1002277131 | 168 |
| 334 | 3300009093 | Ga0105240_10467642 | Ga0105240_104676421 | 168 |
| 335 | 3300009093 | Ga0105240_10586721 | Ga0105240_105867212 | 168 |
| 336 | 3300009098 | Ga0105245_10750740 | Ga0105245_107507402 | 168 |
| 337 | 3300009174 | Ga0105241_10394536 | Ga0105241_103945362 | 168 |
| 338 | 3300009177 | Ga0105248_10390926 | Ga0105248_103909262 | 168 |
| 339 | 3300009545 | Ga0105237_10126106 | Ga0105237_101261063 | 168 |
| 340 | 3300009545 | Ga0105237_11112290 | Ga0105237_111122901 | 168 |
| 341 | 3300009551 | Ga0105238_10004938 | Ga0105238_1000493812 | 168 |
| 342 | 3300009553 | Ga0105249_11352463 | Ga0105249_113524632 | 168 |
| 343 | 3300010375 | Ga0105239_10384029 | Ga0105239_103840292 | 168 |
| 344 | 3300010375 | Ga0105239_10596768 | Ga0105239_105967681 | 168 |
| 345 | 3300010375 | Ga0105239_11041267 | Ga0105239_110412672 | 168 |
| 346 | 3300011119 | Ga0105246_11093605 | Ga0105246_110936051 | 168 |
| 347 | 3300013100 | Ga0157373_10566969 | Ga0157373_105669691 | 168 |
| 348 | 3300013296 | Ga0157374_10293667 | Ga0157374_102936674 | 168 |
| 349 | 3300013306 | Ga0163162_10512538 | Ga0163162_105125382 | 168 |
| 350 | 3300013307 | Ga0157372_10048506 | Ga0157372_100485061 | 168 |
| 351 | 3300013307 | Ga0157372_10064258 | Ga0157372_100642583 | 168 |
| 352 | 3300014497 | Ga0182008_10058991 | Ga0182008_100589912 | 168 |
| 353 | 3300021384 | Ga0213876_10000322 | Ga0213876_1000032241 | 168 |
| 354 | 3300025254 | Ga0209148_1000136 | Ga0209148_100013649 | 168 |
| 355 | 3300025261 | Ga0209233_1000247 | Ga0209233_10002475 | 168 |
| 356 | 3300025261 | Ga0209233_1012279 | Ga0209233_10122792 | 168 |
| 357 | 3300025272 | Ga0209455_1000085 | Ga0209455_100008572 | 168 |
| 358 | 3300025297 | Ga0209758_1010633 | Ga0209758_10106332 | 168 |
| 359 | 3300025901 | Ga0207688_10170343 | Ga0207688_101703431 | 168 |
| 360 | 3300025903 | Ga0207680_10790681 | Ga0207680_107906811 | 168 |
| 361 | 3300025904 | Ga0207647_10072715 | Ga0207647_100727152 | 168 |
| 362 | 3300025911 | Ga0207654_10309471 | Ga0207654_103094711 | 168 |
| 363 | 3300025914 | Ga0207671_10011582 | Ga0207671_100115824 | 168 |
| 364 | 3300025916 | Ga0207663_10591179 | Ga0207663_105911792 | 168 |
| 365 | 3300025932 | Ga0207690_10707383 | Ga0207690_107073831 | 168 |
| 366 | 3300025937 | Ga0207669_10309607 | Ga0207669_103096072 | 168 |
| 367 | 3300025937 | Ga0207669_10797359 | Ga0207669_107973591 | 168 |
| 368 | 3300025940 | Ga0207691_10194840 | Ga0207691_101948402 | 168 |
| 369 | 3300025941 | Ga0207711_11006526 | Ga0207711_110065261 | 168 |
| 370 | 3300025949 | Ga0207667_10674959 | Ga0207667_106749592 | 168 |
| 371 | 3300025949 | Ga0207667_11000395 | Ga0207667_110003951 | 168 |
| 372 | 3300025981 | Ga0207640_10232565 | Ga0207640_102325651 | 168 |
| 373 | 3300026041 | Ga0207639_10796919 | Ga0207639_107969192 | 168 |
| 374 | 3300026041 | Ga0207639_11120032 | Ga0207639_111200321 | 168 |
| 375 | 3300026067 | Ga0207678_10140813 | Ga0207678_101408132 | 168 |
| 376 | 3300026067 | Ga0207678_10440088 | Ga0207678_104400882 | 168 |
| 377 | 3300026078 | Ga0207702_10151964 | Ga0207702_101519642 | 168 |
| 378 | 3300026078 | Ga0207702_10384304 | Ga0207702_103843042 | 168 |
| 379 | 3300026078 | Ga0207702_10640741 | Ga0207702_106407412 | 168 |
| 380 | 3300026078 | Ga0207702_11069656 | Ga0207702_110696561 | 168 |
| 381 | 3300026116 | Ga0207674_10167756 | Ga0207674_101677563 | 168 |
| 382 | 3300026121 | Ga0207683_10067864 | Ga0207683_100678642 | 168 |
| 383 | 3300026142 | Ga0207698_10754272 | Ga0207698_107542721 | 168 |
| 384 | 3300027866 | Ga0209813_10043531 | Ga0209813_100435312 | 168 |
| 385 | 3300027866 | Ga0209813_10049024 | Ga0209813_100490242 | 168 |
| 386 | 3300028379 | Ga0268266_10883445 | Ga0268266_108834452 | 168 |
| 387 | 3300031456 | Ga0307513_10264400 | Ga0307513_102644002 | 168 |
| 388 | 3300031911 | Ga0307412_10170987 | Ga0307412_101709874 | 168 |
| 389 | 3300035172 | Ga0373955_0098514 | Ga0373955_0098514_1021_1602 | 168 |
| 390 | 3300036401 | Ga0373937_0160065 | Ga0373937_0160065_45_605 | 168 |
| 391 | 3300037312 | Ga0395899_0000014 | Ga0395899_0000014_440913_441443 | 168 |
| 392 | 3300037418 | Ga0395900_0000007 | Ga0395900_0000007_440932_441462 | 168 |
| 393 | 3300037418 | Ga0395900_0069262 | Ga0395900_0069262_2458_2988 | 168 |
| 394 | 3300037418 | Ga0395900_0173763 | Ga0395900_0173763_851_1381 | 168 |
| 395 | 3300037418 | Ga0395900_0264908 | Ga0395900_0264908_220_750 | 168 |
| 396 | 3300037418 | Ga0395900_0519780 | Ga0395900_0519780_373_903 | 168 |
| 397 | 3300037418 | Ga0395900_0860138 | Ga0395900_0860138_25_555 | 168 |
| 398 | 3300037466 | Ga0395898_0000011 | Ga0395898_0000011_47399_47929 | 168 |
| 399 | 3300037466 | Ga0395898_1186545 | Ga0395898_1186545_52_564 | 168 |
| 400 | 3300037471 | Ga0395905_0000008 | Ga0395905_0000008_440932_441462 | 168 |
| 401 | 3300037471 | Ga0395905_0029180 | Ga0395905_0029180_3901_4431 | 168 |
| 402 | 3300037471 | Ga0395905_0032726 | Ga0395905_0032726_3805_4317 | 168 |
| 403 | 3300037471 | Ga0395905_0063129 | Ga0395905_0063129_1384_1914 | 168 |
| 404 | 3300037471 | Ga0395905_0220342 | Ga0395905_0220342_51_581 | 168 |
| 405 | 3300037471 | Ga0395905_0821692 | Ga0395905_0821692_147_677 | 168 |
| 406 | 3300037853 | Ga0436364_0856601 | Ga0436364_0856601_3661_4320 | 168 |
| 407 | 3300038443 | Ga0395901_0000020 | Ga0395901_0000020_266990_267520 | 168 |
| 408 | 3300038443 | Ga0395901_0459333 | Ga0395901_0459333_196_726 | 168 |
| 409 | 3300039437 | Ga0436365_0173471 | Ga0436365_0173471_98089_98607 | 168 |
| 410 | 3300039450 | Ga0436363_0489279 | Ga0436363_0489279_75_647 | 168 |
| 411 | 3300041413 | Ga0439465_0176880 | Ga0439465_0176880_183_713 | 168 |
| 412 | 3300042157 | Ga0439458_0061672 | Ga0439458_0061672_132_662 | 168 |
| 413 | 3300042461 | Ga0439460_0046886 | Ga0439460_0046886_34_651 | 168 |
| 414 | 3300044658 | Ga0466972_0012273 | Ga0466972_0012273_3360_3890 | 168 |
| 415 | 3300044901 | Ga0466960_0035900 | Ga0466960_0035900_1569_2099 | 168 |
| 416 | 3300045976 | Ga0466967_0441608 | Ga0466967_0441608_499_1029 | 168 |
| 417 | 3300046460 | Ga0495638_0047638 | Ga0495638_0047638_249_761 | 168 |
| 418 | 3300046512 | Ga0495610_0065737 | Ga0495610_0065737_93_623 | 168 |
| 419 | 3300046520 | Ga0495637_0071599 | Ga0495637_0071599_626_1156 | 168 |
| 420 | 3300046522 | Ga0495643_0065747 | Ga0495643_0065747_1093_1623 | 168 |
| 421 | 3300046535 | Ga0495586_0058619 | Ga0495586_0058619_206_748 | 168 |
| 422 | 3300046542 | Ga0495597_0096249 | Ga0495597_0096249_149_679 | 168 |
| 423 | 3300046660 | Ga0495625_0489786 | Ga0495625_0489786_207_737 | 168 |
| 424 | 3300046694 | Ga0495649_0238450 | Ga0495649_0238450_223_753 | 168 |
| 425 | 3300046810 | Ga0495660_0059355 | Ga0495660_0059355_276_806 | 168 |
| 426 | 3300047443 | Ga0495687_125786 | Ga0495687_125786_54_584 | 168 |
| 427 | 3300047472 | Ga0495686_0222770 | Ga0495686_0222770_109_639 | 168 |
| 428 | 3300048905 | Ga0496102_0309499 | Ga0496102_0309499_67_696 | 168 |
| 429 | 3300048905 | Ga0496102_0591259 | Ga0496102_0591259_332_862 | 168 |
| 430 | 3300048906 | Ga0496103_0144432 | Ga0496103_0144432_79_609 | 168 |
| 431 | 3300048912 | Ga0496109_0750467 | Ga0496109_0750467_113_643 | 168 |
| 432 | 3300048917 | Ga0496114_1065550 | Ga0496114_1065550_34_564 | 168 |
| 433 | 3300048918 | Ga0496115_0083231 | Ga0496115_0083231_140_670 | 168 |
| 434 | 3300048921 | Ga0496118_0201605 | Ga0496118_0201605_68_616 | 168 |
| 435 | 3300048922 | Ga0496119_0060239 | Ga0496119_0060239_1608_2138 | 168 |
| 436 | 3300048922 | Ga0496119_0074460 | Ga0496119_0074460_615_1145 | 168 |
| 437 | 3300048923 | Ga0496120_0002673 | Ga0496120_0002673_5096_5626 | 168 |
| 438 | 3300048924 | Ga0496121_0153215 | Ga0496121_0153215_214_744 | 168 |
| 439 | 3300048928 | Ga0496125_0148194 | Ga0496125_0148194_268_798 | 168 |
| 440 | 3300049568 | Ga0501031_0000076 | Ga0501031_0000076_42840_43370 | 168 |
| 441 | 3300049569 | Ga0501032_0000001 | Ga0501032_0000001_183377_183910 | 168 |
| 442 | 3300049569 | Ga0501032_0000004 | Ga0501032_0000004_301825_302355 | 168 |
| 443 | 3300049570 | Ga0501033_0000156 | Ga0501033_0000156_56817_57347 | 168 |
| 444 | 3300049570 | Ga0501033_0000275 | Ga0501033_0000275_44086_44619 | 168 |
| 445 | 3300049570 | Ga0501033_0243242 | Ga0501033_0243242_49_579 | 168 |
| 446 | 3300049571 | Ga0501034_0000011 | Ga0501034_0000011_301825_302355 | 168 |
| 447 | 3300049571 | Ga0501034_0000036 | Ga0501034_0000036_237199_237732 | 168 |
| 448 | 3300049571 | Ga0501034_0101428 | Ga0501034_0101428_1314_1955 | 168 |
| 449 | 3300049571 | Ga0501034_0157893 | Ga0501034_0157893_660_1190 | 168 |
| 450 | 3300049571 | Ga0501034_0329833 | Ga0501034_0329833_787_1299 | 168 |
| 451 | 3300049572 | Ga0501036_0000001 | Ga0501036_0000001_301825_302355 | 168 |
| 452 | 3300049572 | Ga0501036_0000358 | Ga0501036_0000358_22983_23516 | 168 |
| 453 | 3300049573 | Ga0501037_0000064 | Ga0501037_0000064_12126_12656 | 168 |
| 454 | 3300049573 | Ga0501037_0000091 | Ga0501037_0000091_52244_52777 | 168 |
| 455 | 3300049574 | Ga0501038_0000003 | Ga0501038_0000003_301825_302355 | 168 |
| 456 | 3300049574 | Ga0501038_0003916 | Ga0501038_0003916_5072_5605 | 168 |
| 457 | 3300049575 | Ga0501039_0000004 | Ga0501039_0000004_301825_302355 | 168 |
| 458 | 3300049575 | Ga0501039_0000011 | Ga0501039_0000011_239648_240181 | 168 |
| 459 | 3300049576 | Ga0501040_0009503 | Ga0501040_0009503_2688_3218 | 168 |
| 460 | 3300049579 | Ga0501043_0000016 | Ga0501043_0000016_160269_160802 | 168 |
| 461 | 3300049579 | Ga0501043_0017948 | Ga0501043_0017948_1810_2340 | 168 |
| 462 | 3300049581 | Ga0501047_0004675 | Ga0501047_0004675_8394_8924 | 168 |
| 463 | 3300049581 | Ga0501047_0138675 | Ga0501047_0138675_452_982 | 168 |
| 464 | 3300049581 | Ga0501047_0594242 | Ga0501047_0594242_191_721 | 168 |
| 465 | 3300049586 | Ga0501070_0009150 | Ga0501070_0009150_40_570 | 168 |
| 466 | 3300049586 | Ga0501070_0164737 | Ga0501070_0164737_1196_1726 | 168 |
| 467 | 3300049588 | Ga0501072_0641820 | Ga0501072_0641820_20_550 | 168 |
| 468 | 3300049822 | Ga0501035_0000009 | Ga0501035_0000009_8473_9003 | 168 |
| 469 | 3300049822 | Ga0501035_0022781 | Ga0501035_0022781_124_681 | 168 |
| 470 | 3300049822 | Ga0501035_0057893 | Ga0501035_0057893_1393_1923 | 168 |
| 471 | 3300049822 | Ga0501035_0779129 | Ga0501035_0779129_227_742 | 168 |
| 472 | 3300049823 | Ga0501044_0000005 | Ga0501044_0000005_301825_302355 | 168 |
| 473 | 3300049823 | Ga0501044_0021762 | Ga0501044_0021762_4798_5328 | 168 |
| 474 | 3300049823 | Ga0501044_0042055 | Ga0501044_0042055_411_944 | 168 |
| 475 | 3300050489 | nmdc:mga03683_29702_c1 | nmdc:mga03683_29702_c1_671_1201 | 168 |
| 476 | 3300050490 | nmdc:mga03n38_29730_c1 | nmdc:mga03n38_29730_c1_1480_2010 | 168 |
| 477 | 3300050490 | nmdc:mga03n38_370229_c1 | nmdc:mga03n38_370229_c1_33_563 | 168 |
| 478 | 3300050490 | nmdc:mga03n38_71670_c1 | nmdc:mga03n38_71670_c1_508_1038 | 168 |
| 479 | 3300050491 | nmdc:mga00v17_270354_c1 | nmdc:mga00v17_270354_c1_238_768 | 168 |
| 480 | 3300050491 | nmdc:mga00v17_43681_c1 | nmdc:mga00v17_43681_c1_965_1495 | 168 |
| 481 | 3300050492 | nmdc:mga0yw44_156695_c1 | nmdc:mga0yw44_156695_c1_792_1322 | 168 |
| 482 | 3300050492 | nmdc:mga0yw44_245944_c1 | nmdc:mga0yw44_245944_c1_395_925 | 168 |
| 483 | 3300050492 | nmdc:mga0yw44_73747_c1 | nmdc:mga0yw44_73747_c1_528_1058 | 168 |
| 484 | 3300050494 | nmdc:mga06z11_309815_c1 | nmdc:mga06z11_309815_c1_154_684 | 168 |
| 485 | 3300050494 | nmdc:mga06z11_31721_c1 | nmdc:mga06z11_31721_c1_1710_2240 | 168 |
| 486 | 3300050495 | nmdc:mga04h51_145057_c1 | nmdc:mga04h51_145057_c1_134_664 | 168 |
| 487 | 3300050495 | nmdc:mga04h51_58792_c1 | nmdc:mga04h51_58792_c1_537_1067 | 168 |
| 488 | 3300050496 | nmdc:mga07m45_169244_c1 | nmdc:mga07m45_169244_c1_285_815 | 168 |
| 489 | 3300050496 | nmdc:mga07m45_185778_c1 | nmdc:mga07m45_185778_c1_198_728 | 168 |
| 490 | 3300053079 | Ga0500610_0026528 | Ga0500610_0026528_2257_2787 | 168 |
| 491 | 3300053083 | Ga0495655_0008528 | Ga0495655_0008528_1084_1614 | 168 |
| 492 | 3300053088 | Ga0500644_0007223 | Ga0500644_0007223_2174_2686 | 168 |
| 493 | 3300053119 | Ga0500595_049173 | Ga0500595_049173_191_721 | 168 |
| 494 | 3300053139 | Ga0500568_0000052 | Ga0500568_0000052_43867_44397 | 168 |
| 495 | 3300053155 | Ga0500620_001541 | Ga0500620_001541_1136_1666 | 168 |
| 496 | 3300053155 | Ga0500620_034796 | Ga0500620_034796_721_1251 | 168 |
| 497 | 3300053156 | Ga0500622_0000446 | Ga0500622_0000446_29490_30002 | 168 |
| 498 | 3300053727 | Ga0500611_006335 | Ga0500611_006335_1130_1660 | 168 |
| 499 | 3300053727 | Ga0500611_020789 | Ga0500611_020789_239_769 | 168 |
| 500 | iso_pu_bacteria | 2903448605 | 2903454121 | 168 |
| 501 | iso_pu_bacteria | 2937848649 | 2937848923 | 168 |
| 502 | iso_pu_bacteria | 2968083720 | 2968089847 | 168 |
| 503 | iso_pu_bacteria | 2977922695 | 2977925564 | 168 |
| 504 | iso_pu_bacteria | 2977986579 | 2977993021 | 168 |
| 505 | iso_pu_bacteria | 3004211236 | 3004217099 | 168 |
| 506 | iso_pu_bacteria | 3004218560 | 3004225308 | 168 |
| 507 | iso_pu_bacteria | 3004268573 | 3004269267 | 168 |
| 508 | iso_pu_bacteria | 3004334049 | 3004337421 | 168 |
| 509 | 3300006038 | Ga0075365_10130849 | Ga0075365_101308492 | 169 |
| 510 | 3300009177 | Ga0105248_11287666 | Ga0105248_112876661 | 169 |
| 511 | 3300009551 | Ga0105238_10733426 | Ga0105238_107334262 | 169 |
| 512 | 3300031731 | Ga0307405_10956516 | Ga0307405_109565161 | 169 |
| 513 | 3300031824 | Ga0307413_10870662 | Ga0307413_108706622 | 169 |
| 514 | 3300031911 | Ga0307412_10178649 | Ga0307412_101786492 | 169 |
| 515 | 3300046660 | Ga0495625_0209302 | Ga0495625_0209302_529_1074 | 169 |
| 516 | 3300046691 | Ga0495670_0555521 | Ga0495670_0555521_29_562 | 169 |
| 517 | 3300049580 | Ga0501046_0143406 | Ga0501046_0143406_1204_1740 | 169 |
| 518 | 3300053153 | Ga0500616_0065036 | Ga0500616_0065036_336_848 | 169 |
| 519 | 3300053158 | Ga0500627_0031410 | Ga0500627_0031410_502_1035 | 169 |
| 520 | iso_pu_bacteria | 2582581305 | 2585260204 | 170 |
| 521 | 3300002076 | JGI24749J21850_1000462 | JGI24749J21850_10004623 | 174 |
| 522 | 3300002459 | JGI24751J29686_10000081 | JGI24751J29686_1000008169 | 174 |
| 523 | 3300002459 | JGI24751J29686_10002201 | JGI24751J29686_100022015 | 174 |
| 524 | 3300005295 | Ga0065707_10141752 | Ga0065707_101417522 | 174 |
| 525 | 3300005295 | Ga0065707_10231886 | Ga0065707_102318862 | 174 |
| 526 | 3300005295 | Ga0065707_10380431 | Ga0065707_103804312 | 174 |
| 527 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003127 | 174 |
| 528 | 3300005347 | Ga0070668_100000045 | Ga0070668_1000000458 | 174 |
| 529 | 3300005347 | Ga0070668_100155178 | Ga0070668_1001551783 | 174 |
| 530 | 3300005353 | Ga0070669_100000044 | Ga0070669_10000004453 | 174 |
| 531 | 3300005353 | Ga0070669_100036565 | Ga0070669_1000365654 | 174 |
| 532 | 3300005355 | Ga0070671_100001787 | Ga0070671_1000017874 | 174 |
| 533 | 3300005367 | Ga0070667_100000009 | Ga0070667_100000009198 | 174 |
| 534 | 3300005367 | Ga0070667_100021344 | Ga0070667_1000213441 | 174 |
| 535 | 3300005445 | Ga0070708_100693105 | Ga0070708_1006931051 | 174 |
| 536 | 3300005548 | Ga0070665_100175017 | Ga0070665_1001750172 | 174 |
| 537 | 3300005577 | Ga0068857_100015287 | Ga0068857_1000152874 | 174 |
| 538 | 3300005578 | Ga0068854_100003080 | Ga0068854_1000030806 | 174 |
| 539 | 3300005617 | Ga0068859_100016797 | Ga0068859_1000167979 | 174 |
| 540 | 3300005617 | Ga0068859_100018845 | Ga0068859_1000188458 | 174 |
| 541 | 3300005618 | Ga0068864_100000158 | Ga0068864_10000015871 | 174 |
| 542 | 3300005618 | Ga0068864_100012183 | Ga0068864_1000121837 | 174 |
| 543 | 3300005719 | Ga0068861_100410290 | Ga0068861_1004102902 | 174 |
| 544 | 3300005841 | Ga0068863_100000822 | Ga0068863_1000008224 | 174 |
| 545 | 3300005842 | Ga0068858_100003919 | Ga0068858_10000391911 | 174 |
| 546 | 3300005843 | Ga0068860_100000193 | Ga0068860_10000019333 | 174 |
| 547 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001477 | 174 |
| 548 | 3300005844 | Ga0068862_100000031 | Ga0068862_10000003198 | 174 |
| 549 | 3300005844 | Ga0068862_101424814 | Ga0068862_1014248141 | 174 |
| 550 | 3300006058 | Ga0075432_10329807 | Ga0075432_103298071 | 174 |
| 551 | 3300006195 | Ga0075366_10513460 | Ga0075366_105134601 | 174 |
| 552 | 3300006931 | Ga0097620_100016796 | Ga0097620_1000167969 | 174 |
| 553 | 3300006931 | Ga0097620_100018845 | Ga0097620_1000188458 | 174 |
| 554 | 3300009177 | Ga0105248_10000287 | Ga0105248_1000028712 | 174 |
| 555 | 3300009553 | Ga0105249_10132768 | Ga0105249_101327683 | 174 |
| 556 | 3300014326 | Ga0157380_10000755 | Ga0157380_100007553 | 174 |
| 557 | 3300017792 | Ga0163161_10229857 | Ga0163161_102298573 | 174 |
| 558 | 3300025903 | Ga0207680_10339347 | Ga0207680_103393472 | 174 |
| 559 | 3300025923 | Ga0207681_10000041 | Ga0207681_1000004178 | 174 |
| 560 | 3300025923 | Ga0207681_10022998 | Ga0207681_100229984 | 174 |
| 561 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004124 | 174 |
| 562 | 3300025931 | Ga0207644_10000084 | Ga0207644_1000008418 | 174 |
| 563 | 3300025941 | Ga0207711_10000658 | Ga0207711_1000065829 | 174 |
| 564 | 3300025941 | Ga0207711_10030728 | Ga0207711_100307285 | 174 |
| 565 | 3300025961 | Ga0207712_10183777 | Ga0207712_101837772 | 174 |
| 566 | 3300025972 | Ga0207668_10000031 | Ga0207668_1000003120 | 174 |
| 567 | 3300025972 | Ga0207668_10497404 | Ga0207668_104974041 | 174 |
| 568 | 3300025981 | Ga0207640_10150829 | Ga0207640_101508292 | 174 |
| 569 | 3300025986 | Ga0207658_10000009 | Ga0207658_1000000968 | 174 |
| 570 | 3300025986 | Ga0207658_10010969 | Ga0207658_100109697 | 174 |
| 571 | 3300026035 | Ga0207703_10003409 | Ga0207703_100034096 | 174 |
| 572 | 3300026088 | Ga0207641_10000580 | Ga0207641_1000058027 | 174 |
| 573 | 3300026088 | Ga0207641_10005050 | Ga0207641_100050505 | 174 |
| 574 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006586 | 174 |
| 575 | 3300026095 | Ga0207676_10008879 | Ga0207676_100088794 | 174 |
| 576 | 3300026116 | Ga0207674_10021817 | Ga0207674_100218177 | 174 |
| 577 | 3300026118 | Ga0207675_100000309 | Ga0207675_10000030950 | 174 |
| 578 | 3300026118 | Ga0207675_100042371 | Ga0207675_1000423714 | 174 |
| 579 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001559 | 174 |
| 580 | 3300028380 | Ga0268265_10000118 | Ga0268265_1000011856 | 174 |
| 581 | 3300028380 | Ga0268265_11005154 | Ga0268265_110051542 | 174 |
| 582 | 3300028381 | Ga0268264_10000001 | Ga0268264_1000000168 | 174 |
| 583 | 3300031548 | Ga0307408_100029193 | Ga0307408_1000291933 | 174 |
| 584 | 3300031731 | Ga0307405_10015134 | Ga0307405_100151342 | 174 |
| 585 | 3300031731 | Ga0307405_10452030 | Ga0307405_104520301 | 174 |
| 586 | 3300031901 | Ga0307406_10683182 | Ga0307406_106831822 | 174 |
| 587 | 3300031911 | Ga0307412_10001551 | Ga0307412_100015514 | 174 |
| 588 | 3300031911 | Ga0307412_10001980 | Ga0307412_1000198010 | 174 |
| 589 | 3300031911 | Ga0307412_10051786 | Ga0307412_100517861 | 174 |
| 590 | 3300031911 | Ga0307412_10727531 | Ga0307412_107275312 | 174 |
| 591 | 3300032004 | Ga0307414_10000486 | Ga0307414_100004869 | 174 |
| 592 | 3300032005 | Ga0307411_10143810 | Ga0307411_101438101 | 174 |
| 593 | 3300033180 | Ga0307510_10381649 | Ga0307510_103816491 | 174 |
| 594 | 3300041453 | Ga0451797_0921940 | Ga0451797_0921940_168_701 | 174 |
| 595 | 3300046522 | Ga0495643_0046095 | Ga0495643_0046095_362_895 | 174 |
| 596 | 3300046524 | Ga0495648_0149853 | Ga0495648_0149853_349_882 | 174 |
| 597 | 3300046542 | Ga0495597_0010903 | Ga0495597_0010903_259_792 | 174 |
| 598 | 3300046558 | Ga0495633_0095646 | Ga0495633_0095646_803_1336 | 174 |
| 599 | 3300046616 | Ga0495668_0009397 | Ga0495668_0009397_80_613 | 174 |
| 600 | 3300046616 | Ga0495668_0015679 | Ga0495668_0015679_136_669 | 174 |
| 601 | 3300048928 | Ga0496125_0083970 | Ga0496125_0083970_1044_1577 | 174 |
| 602 | 3300049127 | Ga0501306_010832 | Ga0501306_010832_434_967 | 174 |
| 603 | 3300049571 | Ga0501034_0040933 | Ga0501034_0040933_436_1086 | 174 |
| 604 | 3300049579 | Ga0501043_0018243 | Ga0501043_0018243_663_1196 | 174 |
| 605 | 3300049581 | Ga0501047_0000876 | Ga0501047_0000876_14372_14905 | 174 |
| 606 | 3300049679 | Ga0501249_000464 | Ga0501249_000464_5690_6223 | 174 |
| 607 | 3300049850 | Ga0501204_005586 | Ga0501204_005586_248_781 | 174 |
| 608 | 3300053087 | Ga0500643_000167 | Ga0500643_000167_40196_40729 | 174 |
| 609 | 3300053087 | Ga0500643_057773 | Ga0500643_057773_460_993 | 174 |
| 610 | 3300053091 | Ga0500647_0200154 | Ga0500647_0200154_207_740 | 174 |
| 611 | 3300053093 | Ga0500651_0002180 | Ga0500651_0002180_8036_8569 | 174 |
| 612 | 3300053096 | Ga0500641_0023205 | Ga0500641_0023205_141_674 | 174 |
| 613 | 3300053125 | Ga0500618_027385 | Ga0500618_027385_751_1284 | 174 |
| 614 | 3300053130 | Ga0500642_0001008 | Ga0500642_0001008_5646_6179 | 174 |
| 615 | 3300053133 | Ga0500655_000162 | Ga0500655_000162_1229_1762 | 174 |
| 616 | 3300053148 | Ga0500590_000967 | Ga0500590_000967_5273_5806 | 174 |
| 617 | 3300053156 | Ga0500622_0006224 | Ga0500622_0006224_998_1531 | 174 |
| 618 | 3300053163 | Ga0500639_016444 | Ga0500639_016444_1445_1978 | 174 |
| 619 | 3300053177 | Ga0500636_0148639 | Ga0500636_0148639_364_897 | 174 |
| 620 | 3300053724 | Ga0500570_005298 | Ga0500570_005298_5498_6031 | 174 |
| 621 | 3300044712 | Ga0453684_0064389 | Ga0453684_0064389_3961_4533 | 177 |
| 622 | 3300045051 | Ga0451576_0480621 | Ga0451576_0480621_430_996 | 177 |
| 623 | 2162886007 | SwRhRL2b_contig_3955086 | SwRhRL2b_0187.00004220 | 180 |
| 624 | 3300005330 | Ga0070690_100157457 | Ga0070690_1001574572 | 181 |
| 625 | 3300005331 | Ga0070670_100434494 | Ga0070670_1004344941 | 181 |
| 626 | 3300005353 | Ga0070669_100001258 | Ga0070669_1000012588 | 181 |
| 627 | 3300005355 | Ga0070671_100000066 | Ga0070671_10000006654 | 181 |
| 628 | 3300005367 | Ga0070667_100034559 | Ga0070667_1000345593 | 181 |
| 629 | 3300005617 | Ga0068859_100159372 | Ga0068859_1001593722 | 181 |
| 630 | 3300005843 | Ga0068860_100014365 | Ga0068860_1000143659 | 181 |
| 631 | 3300006931 | Ga0097620_100159381 | Ga0097620_1001593812 | 181 |
| 632 | 3300009553 | Ga0105249_10189138 | Ga0105249_101891383 | 181 |
| 633 | 3300013306 | Ga0163162_10404337 | Ga0163162_104043372 | 181 |
| 634 | 3300014968 | Ga0157379_10856085 | Ga0157379_108560851 | 181 |
| 635 | 3300025923 | Ga0207681_10000505 | Ga0207681_1000050522 | 181 |
| 636 | 3300025925 | Ga0207650_10116137 | Ga0207650_101161372 | 181 |
| 637 | 3300025931 | Ga0207644_10000087 | Ga0207644_1000008722 | 181 |
| 638 | 3300025941 | Ga0207711_10269870 | Ga0207711_102698702 | 181 |
| 639 | 3300025961 | Ga0207712_10081378 | Ga0207712_100813783 | 181 |
| 640 | 3300025986 | Ga0207658_10074300 | Ga0207658_100743001 | 181 |
| 641 | 3300026035 | Ga0207703_10053515 | Ga0207703_100535152 | 181 |
| 642 | 3300028381 | Ga0268264_10128118 | Ga0268264_101281181 | 181 |
| 643 | 3300048903 | Ga0496100_0247481 | Ga0496100_0247481_95_664 | 181 |
| 644 | 3300048904 | Ga0496101_0009564 | Ga0496101_0009564_2835_3404 | 181 |
| 645 | 3300048905 | Ga0496102_0155142 | Ga0496102_0155142_1377_1946 | 181 |
| 646 | 3300048907 | Ga0496104_0028553 | Ga0496104_0028553_408_977 | 181 |
| 647 | 3300048908 | Ga0496105_0116263 | Ga0496105_0116263_872_1441 | 181 |
| 648 | 3300048909 | Ga0496106_0009457 | Ga0496106_0009457_5428_5997 | 181 |
| 649 | 3300048910 | Ga0496107_0000740 | Ga0496107_0000740_16378_16947 | 181 |
| 650 | 3300048913 | Ga0496110_0090794 | Ga0496110_0090794_2082_2651 | 181 |
| 651 | 3300048914 | Ga0496111_0037922 | Ga0496111_0037922_907_1476 | 181 |
| 652 | 3300002459 | JGI24751J29686_10000080 | JGI24751J29686_1000008039 | 182 |
| 653 | 3300005347 | Ga0070668_100021139 | Ga0070668_1000211393 | 182 |
| 654 | 3300005347 | Ga0070668_100786227 | Ga0070668_1007862271 | 182 |
| 655 | 3300005353 | Ga0070669_100017575 | Ga0070669_1000175753 | 182 |
| 656 | 3300005355 | Ga0070671_100002573 | Ga0070671_10000257313 | 182 |
| 657 | 3300005548 | Ga0070665_100000530 | Ga0070665_10000053037 | 182 |
| 658 | 3300005563 | Ga0068855_100314010 | Ga0068855_1003140102 | 182 |
| 659 | 3300005841 | Ga0068863_100000879 | Ga0068863_10000087913 | 182 |
| 660 | 3300005842 | Ga0068858_100052666 | Ga0068858_1000526663 | 182 |
| 661 | 3300005843 | Ga0068860_100061894 | Ga0068860_1000618944 | 182 |
| 662 | 3300025735 | Ga0207713_1008764 | Ga0207713_10087646 | 182 |
| 663 | 3300025900 | Ga0207710_10014255 | Ga0207710_100142553 | 182 |
| 664 | 3300025909 | Ga0207705_10602867 | Ga0207705_106028671 | 182 |
| 665 | 3300025923 | Ga0207681_10000394 | Ga0207681_1000039426 | 182 |
| 666 | 3300025931 | Ga0207644_10062790 | Ga0207644_100627902 | 182 |
| 667 | 3300025949 | Ga0207667_10154190 | Ga0207667_101541902 | 182 |
| 668 | 3300025972 | Ga0207668_10012433 | Ga0207668_100124335 | 182 |
| 669 | 3300026088 | Ga0207641_10033920 | Ga0207641_100339202 | 182 |
| 670 | 3300026095 | Ga0207676_10073680 | Ga0207676_100736803 | 182 |
| 671 | 3300028379 | Ga0268266_10001263 | Ga0268266_1000126315 | 182 |
| 672 | 3300028380 | Ga0268265_10019466 | Ga0268265_100194663 | 182 |
| 673 | 3300028381 | Ga0268264_10013961 | Ga0268264_100139616 | 182 |
| 674 | 3300039437 | Ga0436365_1559618 | Ga0436365_1559618_25_582 | 182 |
| 675 | 3300048906 | Ga0496103_0008264 | Ga0496103_0008264_3117_3686 | 182 |
| 676 | 3300048921 | Ga0496118_0088916 | Ga0496118_0088916_15_584 | 182 |
| 677 | 3300048924 | Ga0496121_0002650 | Ga0496121_0002650_9784_10353 | 182 |
| 678 | 3300048924 | Ga0496121_0649927 | Ga0496121_0649927_59_628 | 182 |
| 679 | 3300048927 | Ga0496124_0069030 | Ga0496124_0069030_1858_2427 | 182 |
| 680 | 3300048927 | Ga0496124_0203651 | Ga0496124_0203651_68_637 | 182 |
| 681 | 3300048928 | Ga0496125_0604038 | Ga0496125_0604038_10_579 | 182 |
| 682 | 3300041498 | Ga0451841_0961289 | Ga0451841_0961289_558_1127 | 184 |
| 683 | 3300048924 | Ga0496121_0087821 | Ga0496121_0087821_1010_1579 | 184 |
| 684 | 3300006195 | Ga0075366_10006178 | Ga0075366_100061788 | 186 |
| 685 | 3300050493 | nmdc:mga0k408_1951_c1 | nmdc:mga0k408_1951_c1_5471_6049 | 186 |
| 686 | 2162886006 | SwRhRL3b_contig_2562353 | SwRhRL3b_0567.00000930 | 189 |
| 687 | 3300005289 | Ga0065704_10116303 | Ga0065704_101163031 | 189 |
| 688 | 3300005290 | Ga0065712_10167921 | Ga0065712_101679211 | 189 |
| 689 | 3300005295 | Ga0065707_10082647 | Ga0065707_1008264717 | 189 |
| 690 | 3300005337 | Ga0070682_100166249 | Ga0070682_1001662492 | 189 |
| 691 | 3300005367 | Ga0070667_100074388 | Ga0070667_1000743884 | 189 |
| 692 | 3300005440 | Ga0070705_100096833 | Ga0070705_1000968333 | 189 |
| 693 | 3300005455 | Ga0070663_100145454 | Ga0070663_1001454543 | 189 |
| 694 | 3300005548 | Ga0070665_100169767 | Ga0070665_1001697671 | 189 |
| 695 | 3300005563 | Ga0068855_100028633 | Ga0068855_1000286336 | 189 |
| 696 | 3300005616 | Ga0068852_100345220 | Ga0068852_1003452201 | 189 |
| 697 | 3300005843 | Ga0068860_100027395 | Ga0068860_1000273952 | 189 |
| 698 | 3300006042 | Ga0075368_10001554 | Ga0075368_100015543 | 189 |
| 699 | 3300006048 | Ga0075363_100013689 | Ga0075363_1000136894 | 189 |
| 700 | 3300006048 | Ga0075363_100061286 | Ga0075363_1000612862 | 189 |
| 701 | 3300006051 | Ga0075364_10046622 | Ga0075364_100466223 | 189 |
| 702 | 3300006051 | Ga0075364_10085148 | Ga0075364_100851483 | 189 |
| 703 | 3300006177 | Ga0075362_10000066 | Ga0075362_1000006622 | 189 |
| 704 | 3300006177 | Ga0075362_10009381 | Ga0075362_100093813 | 189 |
| 705 | 3300006177 | Ga0075362_10030466 | Ga0075362_100304662 | 189 |
| 706 | 3300006178 | Ga0075367_10004752 | Ga0075367_100047523 | 189 |
| 707 | 3300006178 | Ga0075367_10438862 | Ga0075367_104388621 | 189 |
| 708 | 3300006186 | Ga0075369_10003434 | Ga0075369_100034342 | 189 |
| 709 | 3300006186 | Ga0075369_10050354 | Ga0075369_100503542 | 189 |
| 710 | 3300006195 | Ga0075366_10034299 | Ga0075366_100342993 | 189 |
| 711 | 3300006195 | Ga0075366_10381965 | Ga0075366_103819651 | 189 |
| 712 | 3300006353 | Ga0075370_10000055 | Ga0075370_1000005529 | 189 |
| 713 | 3300006353 | Ga0075370_10166361 | Ga0075370_101663612 | 189 |
| 714 | 3300006353 | Ga0075370_10167035 | Ga0075370_101670351 | 189 |
| 715 | 3300009551 | Ga0105238_10273152 | Ga0105238_102731522 | 189 |
| 716 | 3300014326 | Ga0157380_10293081 | Ga0157380_102930813 | 189 |
| 717 | 3300017792 | Ga0163161_10121940 | Ga0163161_101219402 | 189 |
| 718 | 3300025903 | Ga0207680_10100329 | Ga0207680_101003293 | 189 |
| 719 | 3300025926 | Ga0207659_10315723 | Ga0207659_103157232 | 189 |
| 720 | 3300025949 | Ga0207667_10009772 | Ga0207667_1000977211 | 189 |
| 721 | 3300025986 | Ga0207658_10002560 | Ga0207658_1000256019 | 189 |
| 722 | 3300026067 | Ga0207678_10335537 | Ga0207678_103355373 | 189 |
| 723 | 3300026142 | Ga0207698_10398965 | Ga0207698_103989651 | 189 |
| 724 | 3300027866 | Ga0209813_10000064 | Ga0209813_1000006440 | 189 |
| 725 | 3300028381 | Ga0268264_10014246 | Ga0268264_100142462 | 189 |
| 726 | 3300031911 | Ga0307412_10074956 | Ga0307412_100749562 | 189 |
| 727 | 3300032004 | Ga0307414_10157303 | Ga0307414_101573032 | 189 |
| 728 | 3300035242 | Ga0373962_0019321 | Ga0373962_0019321_750_1319 | 189 |
| 729 | 3300035691 | Ga0373931_0021413 | Ga0373931_0021413_1913_2482 | 189 |
| 730 | 3300041453 | Ga0451797_0546020 | Ga0451797_0546020_197_766 | 189 |
| 731 | 3300046530 | Ga0495654_0162867 | Ga0495654_0162867_61_630 | 189 |
| 732 | 3300046539 | Ga0495621_0029886 | Ga0495621_0029886_1237_1806 | 189 |
| 733 | 3300046660 | Ga0495625_0123923 | Ga0495625_0123923_67_636 | 189 |
| 734 | 3300048090 | Ga0495615_0000025 | Ga0495615_0000025_3196_3810 | 189 |
| 735 | 3300048925 | Ga0496122_0005810 | Ga0496122_0005810_9646_10260 | 189 |
| 736 | 3300048926 | Ga0496123_0005504 | Ga0496123_0005504_11247_11861 | 189 |
| 737 | 3300049581 | Ga0501047_0554912 | Ga0501047_0554912_131_700 | 189 |
| 738 | 3300049823 | Ga0501044_0241792 | Ga0501044_0241792_1109_1678 | 189 |
| 739 | 3300050489 | nmdc:mga03683_5140_c2 | nmdc:mga03683_5140_c2_774_1433 | 189 |
| 740 | 3300050489 | nmdc:mga03683_55_c1 | nmdc:mga03683_55_c1_21608_22177 | 189 |
| 741 | 3300050490 | nmdc:mga03n38_3343_c1 | nmdc:mga03n38_3343_c1_3344_3913 | 189 |
| 742 | 3300050491 | nmdc:mga00v17_1644_c1 | nmdc:mga00v17_1644_c1_959_1618 | 189 |
| 743 | 3300050491 | nmdc:mga00v17_257278_c1 | nmdc:mga00v17_257278_c1_161_730 | 189 |
| 744 | 3300050492 | nmdc:mga0yw44_162014_c1 | nmdc:mga0yw44_162014_c1_464_1033 | 189 |
| 745 | 3300050493 | nmdc:mga0k408_450637_c1 | nmdc:mga0k408_450637_c1_124_693 | 189 |
| 746 | 3300050494 | nmdc:mga06z11_1082_c1 | nmdc:mga06z11_1082_c1_7096_7665 | 189 |
| 747 | 3300050494 | nmdc:mga06z11_80514_c1 | nmdc:mga06z11_80514_c1_231_800 | 189 |
| 748 | 3300050495 | nmdc:mga04h51_1318_c1 | nmdc:mga04h51_1318_c1_1975_2544 | 189 |
| 749 | 3300050496 | nmdc:mga07m45_27326_c1 | nmdc:mga07m45_27326_c1_136_705 | 189 |
| 750 | 3300050496 | nmdc:mga07m45_3_c1 | nmdc:mga07m45_3_c1_175492_176061 | 189 |
| 751 | 3300050496 | nmdc:mga07m45_55_c1 | nmdc:mga07m45_55_c1_30017_30586 | 189 |
| 752 | 3300050516 | nmdc:mga0sz30_132359_c1 | nmdc:mga0sz30_132359_c1_292_861 | 189 |
| 753 | 3300050516 | nmdc:mga0sz30_2912_c1 | nmdc:mga0sz30_2912_c1_5167_5736 | 189 |
| 754 | 3300050516 | nmdc:mga0sz30_303_c1 | nmdc:mga0sz30_303_c1_18002_18571 | 189 |
| 755 | 3300053087 | Ga0500643_039415 | Ga0500643_039415_191_760 | 189 |
| 756 | 3300053091 | Ga0500647_0059268 | Ga0500647_0059268_870_1439 | 189 |
| 757 | 3300053118 | Ga0500594_0117019 | Ga0500594_0117019_54_623 | 189 |
| 758 | 3300053121 | Ga0500607_000354 | Ga0500607_000354_29931_30500 | 189 |
| 759 | 3300053121 | Ga0500607_075177 | Ga0500607_075177_529_1098 | 189 |
| 760 | 3300053122 | Ga0500608_000755 | Ga0500608_000755_3764_4333 | 189 |
| 761 | 3300053136 | Ga0500559_0006081 | Ga0500559_0006081_253_822 | 189 |
| 762 | 3300053136 | Ga0500559_0015561 | Ga0500559_0015561_1958_2527 | 189 |
| 763 | 3300053138 | Ga0500564_015388 | Ga0500564_015388_807_1376 | 189 |
| 764 | 3300053139 | Ga0500568_0105762 | Ga0500568_0105762_101_670 | 189 |
| 765 | 3300053156 | Ga0500622_0000145 | Ga0500622_0000145_38023_38643 | 189 |
| 766 | 3300053178 | Ga0500637_0006247 | Ga0500637_0006247_1048_1617 | 189 |
| 767 | 3300053723 | Ga0500567_000039 | Ga0500567_000039_19672_20241 | 189 |
| 768 | 3300053729 | Ga0500625_000021 | Ga0500625_000021_43498_44067 | 189 |
| 769 | 3300053730 | Ga0500645_007973 | Ga0500645_007973_860_1429 | 189 |
| 770 | iso_pu_bacteria | 2739367865 | 2740027591 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9764 | 3 | 182 |
| 1lme-assembly2.cif.gz_B | crystal structure of peptide deformylase from thermotoga maritima | 0.9646 | 1 | 171 |
| 3k6l-assembly3.cif.gz_C | the structure of e.coli peptide deformylase (pdf) in complex with peptidomimetic ligand bb2827 | 0.9639 | 3 | 182 |
| 6jf5-assembly1.cif.gz_A | k2u bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii | 0.9575 | 1 | 168 |
| 5j46-assembly1.cif.gz_A | crystal structure of a peptide deformylase from burkholderia multivorans | 0.9544 | 1 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9643 | 1 | 171 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9513 | 1 | 171 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9471 | 1 | 172 | 3.90.45.10 |
| 2ew5A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9388 | 2 | 184 | 3.90.45.10 |
| 4dr9B00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9305 | 4 | 181 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W5MXD6-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9931 | 1 | 189 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A6I4SNS8-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9911 | 1 | 189 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A7W5MXD6-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9879 | 1 | 189 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A365VLT1-F1-model_v4 | deleted | 0.9816 | 91 | 188 |
|
| AF-A0A2X3L1W3-F1-model_v4 | Peptide deformylase (EC 3.5.1.88) | 0.9808 | 91 | 185 |
GO:0042586
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar