F480038
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 770 | 396 | 641 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300027876|Ga0209974_10041971|Ga0209974_100419711 |
| Length | 362 |
| Sequence | VSHLGEGGSAPNIHHGKPVPNPFHGCYGTDRGTGFSPDPYREHSEVIDDMSVVTELRKTAKGAKAAPSRRGLRNGDGKAAAVFLLPWFLGLGLITIGPMIASGYLSFTDYNLLQPPQWTGLENYTRLFEDPRLLNSLRVTFTYVFTAVPLQLLAALALALILDRGLKGLPFYRSVLYLPSLLGGSVAVAILWRQVFGIDGLVNQFLALFGIQGKGWVSDPETALWTLVLLHIWTFGAPMIIFLAGLRQIPEMYYEAAAIDGAGVVRKFRSITLPLLTPIIFFNLVLQVIGAFQSFTQAFVVSGGTGGPADSTMFYTLYLYQKGFTAFDMGYASAMAWLLVLIVAVMTLINFFASKFWVFYDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 4 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 5 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 6 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 7 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 8 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 9 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 10 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 11 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 12 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 13 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 14 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 15 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 16 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 17 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 18 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 19 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 20 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 21 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 22 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 23 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 24 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 25 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 26 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 27 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 28 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 29 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 30 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 31 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 32 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 33 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 34 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 35 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 36 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 37 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 38 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 39 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 40 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 41 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 42 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 43 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 44 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 45 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 46 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 47 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 48 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 49 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 50 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 51 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 52 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 53 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 54 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 55 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 56 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 57 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 58 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 59 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 60 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 61 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 62 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 63 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 64 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 65 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 66 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 67 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 68 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 69 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 70 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 71 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 72 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 73 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 74 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 75 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 76 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 77 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 78 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 79 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 80 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 81 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 82 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 83 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 84 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 85 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 86 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 87 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 88 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 89 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 90 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 91 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 92 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 93 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 94 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 95 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 96 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 97 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 98 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 99 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 100 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 102 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 103 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 104 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 105 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 107 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 108 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 109 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 111 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 112 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 130 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 133 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 135 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 137 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 138 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 139 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 140 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 141 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 142 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 143 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 144 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 145 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 147 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 148 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 149 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 150 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 151 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 152 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 153 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 154 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 155 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 164 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 165 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 170 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 175 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 214 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 215 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 226 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 227 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 239 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 240 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 241 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 242 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 243 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 244 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 247 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 248 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 249 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 250 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 251 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 254 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 255 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 256 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 257 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 258 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 259 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 260 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 261 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 262 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 310 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 318 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 345 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 349 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 350 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 363 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 364 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 367 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 385 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 386 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 387 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 388 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 389 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 390 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 391 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 392 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 393 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 394 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 395 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 396 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.48 |
| Metatranscriptomes | 3.77 |
| Isolates | 16.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.13 |
| Bulb | 0 |
| Endosphere | 2.47 |
| Nodule | 0.65 |
| Rhizoplane | 2.08 |
| Rhizosphere | 82.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10026220 | 3300001979 | Bacteria | 1955 |
| 2 | JGI24739J22299_10016370 | 3300001989 | Bacteria | 2683 |
| 3 | JGI24737J22298_10006891 | 3300001990 | Bacteria | 3856 |
| 4 | JGI24735J21928_10048850 | 3300002067 | Bacteria | 1223 |
| 5 | JGI25406J46586_10004063 | 3300003203 | Bacteria | 6841 |
| 6 | JGI25406J46586_10009823 | 3300003203 | Bacteria | 4273 |
| 7 | JGI25407J50210_10005774 | 3300003373 | Bacteria | 3056 |
| 8 | Ga0007417J51691_1081063 | 3300003544 | Bacteria | 1270 |
| 9 | Ga0007410J51695_1031054 | 3300003574 | Bacteria | 2430 |
| 10 | Ga0007429J51699_1042823 | 3300003579 | Bacteria | 2151 |
| 11 | Ga0007429J51699_1057706 | 3300003579 | Bacteria | 3141 |
| 12 | Ga0032354_1048032 | 3300003693 | Bacteria | 1346 |
| 13 | Ga0032354_1073790 | 3300003693 | Bacteria | 1484 |
| 14 | Ga0006780_1026334 | 3300003735 | Bacteria | 2410 |
| 15 | Ga0055531_10001269 | 3300003794 | Bacteria | 19111 |
| 16 | Ga0055541_1004319 | 3300003841 | Bacteria | 2591 |
| 17 | Ga0070658_10004384 | 3300005327 | Bacteria | 11511 |
| 18 | Ga0070658_10083098 | 3300005327 | Bacteria | 2632 |
| 19 | Ga0070683_100000882 | 3300005329 | Bacteria | 22251 |
| 20 | Ga0070683_100077862 | 3300005329 | Bacteria | 3101 |
| 21 | Ga0070683_100105705 | 3300005329 | Bacteria | 2654 |
| 22 | Ga0070680_100096116 | 3300005336 | Bacteria | 2456 |
| 23 | Ga0070680_100389063 | 3300005336 | Bacteria | 1188 |
| 24 | Ga0070682_100061657 | 3300005337 | Bacteria | 2374 |
| 25 | Ga0070682_100102394 | 3300005337 | Bacteria | 1893 |
| 26 | Ga0070661_100018909 | 3300005344 | Bacteria | 4906 |
| 27 | Ga0070668_100007262 | 3300005347 | Bacteria | 8215 |
| 28 | Ga0070668_100089555 | 3300005347 | Bacteria | 2424 |
| 29 | Ga0070674_100119227 | 3300005356 | Unclassified | 1951 |
| 30 | Ga0070703_10000038 | 3300005406 | Bacteria | 65056 |
| 31 | Ga0070709_10176209 | 3300005434 | Bacteria | 1498 |
| 32 | Ga0070714_100227534 | 3300005435 | Bacteria | 1717 |
| 33 | Ga0070713_100135816 | 3300005436 | Bacteria | 2173 |
| 34 | Ga0070710_10011350 | 3300005437 | Bacteria | 4402 |
| 35 | Ga0070705_100039424 | 3300005440 | Bacteria | 2680 |
| 36 | Ga0070705_100091684 | 3300005440 | Bacteria | 1895 |
| 37 | Ga0070694_100175413 | 3300005444 | Bacteria | 1582 |
| 38 | Ga0070708_100001328 | 3300005445 | Bacteria | 18924 |
| 39 | Ga0070708_100021086 | 3300005445 | Bacteria | 5503 |
| 40 | Ga0070708_100370467 | 3300005445 | Bacteria | 1350 |
| 41 | Ga0070663_100000278 | 3300005455 | Bacteria | 25887 |
| 42 | Ga0070678_100063940 | 3300005456 | Bacteria | 2725 |
| 43 | Ga0070681_10037212 | 3300005458 | Bacteria | 4885 |
| 44 | Ga0070681_10039137 | 3300005458 | Bacteria | 4753 |
| 45 | Ga0070706_100000237 | 3300005467 | Bacteria | 67422 |
| 46 | Ga0070707_100001654 | 3300005468 | Bacteria | 21570 |
| 47 | Ga0070707_100026614 | 3300005468 | Bacteria | 5494 |
| 48 | Ga0070698_100005492 | 3300005471 | Bacteria | 13838 |
| 49 | Ga0070698_100062896 | 3300005471 | Bacteria | 3744 |
| 50 | Ga0070679_100032656 | 3300005530 | Bacteria | 5150 |
| 51 | Ga0070679_100064633 | 3300005530 | Bacteria | 3647 |
| 52 | Ga0070684_100098326 | 3300005535 | Bacteria | 2611 |
| 53 | Ga0070684_100176787 | 3300005535 | Bacteria | 1940 |
| 54 | Ga0068853_100019680 | 3300005539 | Bacteria | 5603 |
| 55 | Ga0068853_100259231 | 3300005539 | Bacteria | 1598 |
| 56 | Ga0070696_100024725 | 3300005546 | Bacteria | 4082 |
| 57 | Ga0068855_100008798 | 3300005563 | Bacteria | 12204 |
| 58 | Ga0068855_100515390 | 3300005563 | Bacteria | 1298 |
| 59 | Ga0070664_100468728 | 3300005564 | Bacteria | 1158 |
| 60 | Ga0068857_100023416 | 3300005577 | Bacteria | 5437 |
| 61 | Ga0068856_100239503 | 3300005614 | Bacteria | 1830 |
| 62 | Ga0068866_10094119 | 3300005718 | Unclassified | 1638 |
| 63 | Ga0081455_10000737 | 3300005937 | Bacteria | 42512 |
| 64 | Ga0081455_10012967 | 3300005937 | Bacteria | 8266 |
| 65 | Ga0081455_10017573 | 3300005937 | Bacteria | 6849 |
| 66 | Ga0081455_10026568 | 3300005937 | Bacteria | 5321 |
| 67 | Ga0081455_10035417 | 3300005937 | Bacteria | 4461 |
| 68 | Ga0081455_10040335 | 3300005937 | Bacteria | 4118 |
| 69 | Ga0081455_10045232 | 3300005937 | Bacteria | 3831 |
| 70 | Ga0081455_10068617 | 3300005937 | Bacteria | 2950 |
| 71 | Ga0081455_10091337 | 3300005937 | Bacteria | 2466 |
| 72 | Ga0081538_10000050 | 3300005981 | Bacteria | 110501 |
| 73 | Ga0081539_10000057 | 3300005985 | Bacteria | 256264 |
| 74 | Ga0081539_10002019 | 3300005985 | Bacteria | 30676 |
| 75 | Ga0081539_10003375 | 3300005985 | Bacteria | 19774 |
| 76 | Ga0081539_10004428 | 3300005985 | Bacteria | 15523 |
| 77 | Ga0081539_10042400 | 3300005985 | Bacteria | 2651 |
| 78 | Ga0075365_10000802 | 3300006038 | Bacteria | 12899 |
| 79 | Ga0075364_10009781 | 3300006051 | Bacteria | 5765 |
| 80 | Ga0075432_10000007 | 3300006058 | Bacteria | 41144 |
| 81 | Ga0075432_10000222 | 3300006058 | Bacteria | 15141 |
| 82 | Ga0075432_10007054 | 3300006058 | Bacteria | 3827 |
| 83 | Ga0097621_100346750 | 3300006237 | Bacteria | 1320 |
| 84 | Ga0075428_100046304 | 3300006844 | Bacteria | 4777 |
| 85 | Ga0075428_100065149 | 3300006844 | Bacteria | 3990 |
| 86 | Ga0075430_100002168 | 3300006846 | Bacteria | 16252 |
| 87 | Ga0075430_100406290 | 3300006846 | Bacteria | 1124 |
| 88 | Ga0075431_100018665 | 3300006847 | Bacteria | 7066 |
| 89 | Ga0075431_100139831 | 3300006847 | Bacteria | 2496 |
| 90 | Ga0075433_10000482 | 3300006852 | Bacteria | 26002 |
| 91 | Ga0075433_10006291 | 3300006852 | Bacteria | 9376 |
| 92 | Ga0075433_10291281 | 3300006852 | Bacteria | 1446 |
| 93 | Ga0075434_100000163 | 3300006871 | Bacteria | 42178 |
| 94 | Ga0075434_100025397 | 3300006871 | Bacteria | 5796 |
| 95 | Ga0075434_100072255 | 3300006871 | Bacteria | 3442 |
| 96 | Ga0068865_100072151 | 3300006881 | Bacteria | 2452 |
| 97 | Ga0075436_100001036 | 3300006914 | Bacteria | 18743 |
| 98 | Ga0099826_10116643 | 3300006948 | Bacteria | 1580 |
| 99 | Ga0075435_100000274 | 3300007076 | Bacteria | 32020 |
| 100 | Ga0075435_100001686 | 3300007076 | Bacteria | 14353 |
| 101 | Ga0105244_10011771 | 3300009036 | Bacteria | 5218 |
| 102 | Ga0105240_10026509 | 3300009093 | Bacteria | 7605 |
| 103 | Ga0111539_10000078 | 3300009094 | Bacteria | 97928 |
| 104 | Ga0111539_10031641 | 3300009094 | Bacteria | 6428 |
| 105 | Ga0111539_10093908 | 3300009094 | Bacteria | 3524 |
| 106 | Ga0105245_10025177 | 3300009098 | Bacteria | 5232 |
| 107 | Ga0114129_10046748 | 3300009147 | Bacteria | 6083 |
| 108 | Ga0114129_10075130 | 3300009147 | Bacteria | 4706 |
| 109 | Ga0114129_10146256 | 3300009147 | Bacteria | 3238 |
| 110 | Ga0114129_10222741 | 3300009147 | Bacteria | 2544 |
| 111 | Ga0105243_10011986 | 3300009148 | Bacteria | 6555 |
| 112 | Ga0105242_10003785 | 3300009176 | Bacteria | 11757 |
| 113 | Ga0105242_10317164 | 3300009176 | Bacteria | 1428 |
| 114 | Ga0105242_10337297 | 3300009176 | Bacteria | 1388 |
| 115 | Ga0105242_10386668 | 3300009176 | Bacteria | 1302 |
| 116 | Ga0105238_10063405 | 3300009551 | Bacteria | 3696 |
| 117 | Ga0105238_10081928 | 3300009551 | Bacteria | 3217 |
| 118 | Ga0123341_1000059 | 3300009765 | Bacteria | 46893 |
| 119 | Ga0123342_1020203 | 3300009766 | Bacteria | 4915 |
| 120 | Ga0105239_10225290 | 3300010375 | Bacteria | 2103 |
| 121 | Ga0105246_10006494 | 3300011119 | Bacteria | 7143 |
| 122 | Ga0105246_10006584 | 3300011119 | Bacteria | 7094 |
| 123 | Ga0105246_10019358 | 3300011119 | Bacteria | 4348 |
| 124 | Ga0157371_10079321 | 3300013102 | Bacteria | 2325 |
| 125 | Ga0157369_10026207 | 3300013105 | Bacteria | 6469 |
| 126 | Ga0157369_10103516 | 3300013105 | Bacteria | 3032 |
| 127 | Ga0157369_10106278 | 3300013105 | Bacteria | 2987 |
| 128 | Ga0157369_10402858 | 3300013105 | Bacteria | 1419 |
| 129 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 130 | Ga0157374_10283643 | 3300013296 | Bacteria | 1635 |
| 131 | Ga0157378_10040745 | 3300013297 | Bacteria | 4120 |
| 132 | Ga0157372_10141724 | 3300013307 | Bacteria | 2770 |
| 133 | Ga0157372_10236101 | 3300013307 | Bacteria | 2121 |
| 134 | Ga0157372_10279135 | 3300013307 | Bacteria | 1942 |
| 135 | Ga0157375_10269392 | 3300013308 | Bacteria | 1865 |
| 136 | Ga0182008_10002078 | 3300014497 | Bacteria | 12808 |
| 137 | Ga0182008_10092721 | 3300014497 | Bacteria | 1490 |
| 138 | Ga0206353_11355273 | 3300020082 | Unclassified | 1911 |
| 139 | Ga0209566_100696 | 3300025225 | Bacteria | 19459 |
| 140 | Ga0209566_102919 | 3300025225 | Bacteria | 2867 |
| 141 | Ga0209051_1001809 | 3300025303 | Bacteria | 16949 |
| 142 | Ga0209257_1002324 | 3300025304 | Bacteria | 19185 |
| 143 | Ga0207697_10004027 | 3300025315 | Bacteria | 7120 |
| 144 | Ga0207655_1009481 | 3300025728 | Bacteria | 6037 |
| 145 | Ga0207653_10000093 | 3300025885 | Bacteria | 65950 |
| 146 | Ga0207692_10001908 | 3300025898 | Bacteria | 7931 |
| 147 | Ga0207692_10026359 | 3300025898 | Bacteria | 2726 |
| 148 | Ga0207642_10002328 | 3300025899 | Bacteria | 5928 |
| 149 | Ga0207688_10051785 | 3300025901 | Bacteria | 2299 |
| 150 | Ga0207647_10009069 | 3300025904 | Bacteria | 7083 |
| 151 | Ga0207705_10034135 | 3300025909 | Bacteria | 3637 |
| 152 | Ga0207684_10000683 | 3300025910 | Bacteria | 40239 |
| 153 | Ga0207684_10022598 | 3300025910 | Bacteria | 5369 |
| 154 | Ga0207684_10213382 | 3300025910 | Bacteria | 1665 |
| 155 | Ga0207707_10043989 | 3300025912 | Bacteria | 3894 |
| 156 | Ga0207695_10021186 | 3300025913 | Bacteria | 7423 |
| 157 | Ga0207663_10283782 | 3300025916 | Bacteria | 1231 |
| 158 | Ga0207660_10126010 | 3300025917 | Bacteria | 1945 |
| 159 | Ga0207660_10349459 | 3300025917 | Bacteria | 1185 |
| 160 | Ga0207657_10011659 | 3300025919 | Bacteria | 8713 |
| 161 | Ga0207652_10019397 | 3300025921 | Bacteria | 5592 |
| 162 | Ga0207652_10049243 | 3300025921 | Bacteria | 3606 |
| 163 | Ga0207646_10023685 | 3300025922 | Bacteria | 5635 |
| 164 | Ga0207646_10030748 | 3300025922 | Bacteria | 4865 |
| 165 | Ga0207646_10061626 | 3300025922 | Bacteria | 3348 |
| 166 | Ga0207646_10103475 | 3300025922 | Bacteria | 2553 |
| 167 | Ga0207694_10032919 | 3300025924 | Bacteria | 3970 |
| 168 | Ga0207700_10312034 | 3300025928 | Bacteria | 1361 |
| 169 | Ga0207664_10190780 | 3300025929 | Bacteria | 1764 |
| 170 | Ga0207690_10287722 | 3300025932 | Bacteria | 1282 |
| 171 | Ga0207709_10008942 | 3300025935 | Bacteria | 5527 |
| 172 | Ga0207669_10015911 | 3300025937 | Bacteria | 3807 |
| 173 | Ga0207661_10007847 | 3300025944 | Bacteria | 7602 |
| 174 | Ga0207661_10247902 | 3300025944 | Bacteria | 1582 |
| 175 | Ga0207679_10386208 | 3300025945 | Bacteria | 1228 |
| 176 | Ga0207667_10042345 | 3300025949 | Bacteria | 4841 |
| 177 | Ga0207712_10423300 | 3300025961 | Bacteria | 1124 |
| 178 | Ga0207668_10164995 | 3300025972 | Bacteria | 1730 |
| 179 | Ga0207658_10133646 | 3300025986 | Bacteria | 1997 |
| 180 | Ga0207639_10076301 | 3300026041 | Bacteria | 2639 |
| 181 | Ga0207639_10190915 | 3300026041 | Bacteria | 1750 |
| 182 | Ga0207678_10000166 | 3300026067 | Bacteria | 55793 |
| 183 | Ga0207678_10126680 | 3300026067 | Bacteria | 2178 |
| 184 | Ga0207674_10049585 | 3300026116 | Bacteria | 4294 |
| 185 | Ga0207675_100161684 | 3300026118 | Bacteria | 2136 |
| 186 | Ga0209974_10041971 | 3300027876 | Bacteria | 1523 |
| 187 | Ga0207428_10000662 | 3300027907 | Bacteria | 40307 |
| 188 | Ga0207428_10006298 | 3300027907 | Bacteria | 10973 |
| 189 | Ga0207428_10032916 | 3300027907 | Bacteria | 4262 |
| 190 | Ga0207428_10045197 | 3300027907 | Bacteria | 3549 |
| 191 | Ga0207428_10088416 | 3300027907 | Bacteria | 2410 |
| 192 | Ga0207428_10110571 | 3300027907 | Bacteria | 2116 |
| 193 | Ga0307512_10005080 | 3300030522 | Bacteria | 13975 |
| 194 | Ga0316176_1172987 | 3300030732 | Bacteria | 5914 |
| 195 | Ga0316176_1189152 | 3300030732 | Bacteria | 2520 |
| 196 | Ga0314311_1040023 | 3300030733 | Bacteria | 7981 |
| 197 | Ga0314311_1073438 | 3300030733 | Bacteria | 2608 |
| 198 | Ga0307513_10020769 | 3300031456 | Bacteria | 7774 |
| 199 | Ga0307513_10114752 | 3300031456 | Bacteria | 2678 |
| 200 | Ga0307408_100001012 | 3300031548 | Bacteria | 21616 |
| 201 | Ga0307408_100002815 | 3300031548 | Bacteria | 12077 |
| 202 | Ga0307408_100020440 | 3300031548 | Bacteria | 4469 |
| 203 | Ga0307408_100020696 | 3300031548 | Bacteria | 4444 |
| 204 | Ga0307408_100043234 | 3300031548 | Bacteria | 3205 |
| 205 | Ga0307408_100047284 | 3300031548 | Bacteria | 3080 |
| 206 | Ga0307408_100080760 | 3300031548 | Bacteria | 2429 |
| 207 | Ga0307408_100087272 | 3300031548 | Bacteria | 2346 |
| 208 | Ga0307408_100125168 | 3300031548 | Bacteria | 1997 |
| 209 | Ga0307408_100396952 | 3300031548 | Bacteria | 1183 |
| 210 | Ga0307405_10013188 | 3300031731 | Bacteria | 4403 |
| 211 | Ga0307405_10016478 | 3300031731 | Bacteria | 4031 |
| 212 | Ga0307405_10019311 | 3300031731 | Bacteria | 3783 |
| 213 | Ga0307405_10020274 | 3300031731 | Bacteria | 3712 |
| 214 | Ga0307405_10045587 | 3300031731 | Bacteria | 2688 |
| 215 | Ga0307405_10066943 | 3300031731 | Bacteria | 2292 |
| 216 | Ga0307405_10107100 | 3300031731 | Bacteria | 1886 |
| 217 | Ga0307405_10108904 | 3300031731 | Bacteria | 1873 |
| 218 | Ga0307405_10217141 | 3300031731 | Bacteria | 1400 |
| 219 | Ga0307405_10274589 | 3300031731 | Bacteria | 1265 |
| 220 | Ga0307413_10004079 | 3300031824 | Bacteria | 6282 |
| 221 | Ga0307413_10017992 | 3300031824 | Bacteria | 3695 |
| 222 | Ga0307413_10018500 | 3300031824 | Bacteria | 3658 |
| 223 | Ga0307413_10019858 | 3300031824 | Bacteria | 3560 |
| 224 | Ga0307413_10033541 | 3300031824 | Bacteria | 2925 |
| 225 | Ga0307413_10059226 | 3300031824 | Bacteria | 2352 |
| 226 | Ga0307413_10098148 | 3300031824 | Bacteria | 1928 |
| 227 | Ga0307413_10141722 | 3300031824 | Bacteria | 1662 |
| 228 | Ga0307413_10156560 | 3300031824 | Bacteria | 1595 |
| 229 | Ga0307413_10166355 | 3300031824 | Bacteria | 1556 |
| 230 | Ga0307410_10001236 | 3300031852 | Bacteria | 11352 |
| 231 | Ga0307410_10003812 | 3300031852 | Bacteria | 7658 |
| 232 | Ga0307410_10008801 | 3300031852 | Bacteria | 5623 |
| 233 | Ga0307410_10022119 | 3300031852 | Bacteria | 3924 |
| 234 | Ga0307410_10027075 | 3300031852 | Bacteria | 3619 |
| 235 | Ga0307410_10035602 | 3300031852 | Bacteria | 3234 |
| 236 | Ga0307410_10067432 | 3300031852 | Bacteria | 2468 |
| 237 | Ga0307410_10084852 | 3300031852 | Bacteria | 2233 |
| 238 | Ga0307410_10088514 | 3300031852 | Bacteria | 2192 |
| 239 | Ga0307410_10106889 | 3300031852 | Bacteria | 2017 |
| 240 | Ga0307410_10108360 | 3300031852 | Bacteria | 2005 |
| 241 | Ga0307410_10250108 | 3300031852 | Bacteria | 1378 |
| 242 | Ga0326468_10000014 | 3300031889 | Bacteria | 12922 |
| 243 | Ga0307406_10000019 | 3300031901 | Bacteria | 98555 |
| 244 | Ga0307406_10022526 | 3300031901 | Bacteria | 3738 |
| 245 | Ga0307406_10073391 | 3300031901 | Bacteria | 2250 |
| 246 | Ga0307406_10083097 | 3300031901 | Bacteria | 2135 |
| 247 | Ga0307406_10140767 | 3300031901 | Bacteria | 1707 |
| 248 | Ga0307406_10167552 | 3300031901 | Bacteria | 1586 |
| 249 | Ga0307406_10231643 | 3300031901 | Bacteria | 1380 |
| 250 | Ga0307407_10001070 | 3300031903 | Bacteria | 9497 |
| 251 | Ga0307407_10001475 | 3300031903 | Bacteria | 8553 |
| 252 | Ga0307407_10010268 | 3300031903 | Bacteria | 4409 |
| 253 | Ga0307407_10011039 | 3300031903 | Bacteria | 4283 |
| 254 | Ga0307407_10033918 | 3300031903 | Bacteria | 2789 |
| 255 | Ga0307407_10039140 | 3300031903 | Bacteria | 2634 |
| 256 | Ga0307407_10044386 | 3300031903 | Bacteria | 2505 |
| 257 | Ga0307407_10236808 | 3300031903 | Bacteria | 1243 |
| 258 | Ga0307412_10001015 | 3300031911 | Bacteria | 16083 |
| 259 | Ga0307412_10021870 | 3300031911 | Bacteria | 3912 |
| 260 | Ga0307412_10026992 | 3300031911 | Bacteria | 3575 |
| 261 | Ga0307412_10036484 | 3300031911 | Bacteria | 3150 |
| 262 | Ga0307412_10041593 | 3300031911 | Bacteria | 2980 |
| 263 | Ga0307412_10101953 | 3300031911 | Bacteria | 2031 |
| 264 | Ga0307412_10108712 | 3300031911 | Bacteria | 1976 |
| 265 | Ga0307412_10136452 | 3300031911 | Bacteria | 1790 |
| 266 | Ga0307412_10148849 | 3300031911 | Bacteria | 1725 |
| 267 | Ga0307412_10223628 | 3300031911 | Bacteria | 1444 |
| 268 | Ga0307412_10230707 | 3300031911 | Bacteria | 1425 |
| 269 | Ga0307412_10236276 | 3300031911 | Bacteria | 1411 |
| 270 | Ga0307412_10252403 | 3300031911 | Bacteria | 1370 |
| 271 | Ga0307412_10308910 | 3300031911 | Bacteria | 1253 |
| 272 | Ga0307412_10430297 | 3300031911 | Bacteria | 1082 |
| 273 | Ga0307409_100000024 | 3300031995 | Bacteria | 51734 |
| 274 | Ga0307409_100011584 | 3300031995 | Bacteria | 5572 |
| 275 | Ga0307409_100020099 | 3300031995 | Bacteria | 4542 |
| 276 | Ga0307409_100037824 | 3300031995 | Bacteria | 3561 |
| 277 | Ga0307409_100082241 | 3300031995 | Bacteria | 2606 |
| 278 | Ga0307409_100137952 | 3300031995 | Bacteria | 2096 |
| 279 | Ga0307409_100159704 | 3300031995 | Bacteria | 1969 |
| 280 | Ga0307409_100187481 | 3300031995 | Bacteria | 1838 |
| 281 | Ga0307409_100305770 | 3300031995 | Bacteria | 1481 |
| 282 | Ga0307416_100000040 | 3300032002 | Bacteria | 132572 |
| 283 | Ga0307416_100004959 | 3300032002 | Bacteria | 8113 |
| 284 | Ga0307416_100008345 | 3300032002 | Bacteria | 6674 |
| 285 | Ga0307416_100020331 | 3300032002 | Bacteria | 4734 |
| 286 | Ga0307416_100022408 | 3300032002 | Bacteria | 4559 |
| 287 | Ga0307416_100048054 | 3300032002 | Bacteria | 3382 |
| 288 | Ga0307416_100051376 | 3300032002 | Bacteria | 3292 |
| 289 | Ga0307416_100073802 | 3300032002 | Bacteria | 2847 |
| 290 | Ga0307416_100085684 | 3300032002 | Bacteria | 2682 |
| 291 | Ga0307416_100128287 | 3300032002 | Bacteria | 2277 |
| 292 | Ga0307416_100163213 | 3300032002 | Bacteria | 2063 |
| 293 | Ga0307416_100223997 | 3300032002 | Bacteria | 1806 |
| 294 | Ga0307416_100268381 | 3300032002 | Bacteria | 1673 |
| 295 | Ga0307414_10042056 | 3300032004 | Bacteria | 3102 |
| 296 | Ga0307411_10008197 | 3300032005 | Bacteria | 5393 |
| 297 | Ga0307411_10008677 | 3300032005 | Bacteria | 5284 |
| 298 | Ga0307411_10055609 | 3300032005 | Bacteria | 2604 |
| 299 | Ga0307411_10059469 | 3300032005 | Bacteria | 2534 |
| 300 | Ga0307411_10093907 | 3300032005 | Bacteria | 2102 |
| 301 | Ga0307411_10108517 | 3300032005 | Bacteria | 1980 |
| 302 | Ga0307411_10186726 | 3300032005 | Bacteria | 1578 |
| 303 | Ga0307411_10252513 | 3300032005 | Bacteria | 1387 |
| 304 | Ga0307411_10268687 | 3300032005 | Bacteria | 1351 |
| 305 | Ga0307411_10319289 | 3300032005 | Bacteria | 1253 |
| 306 | Ga0307415_100004657 | 3300032126 | Bacteria | 7169 |
| 307 | Ga0307415_100006009 | 3300032126 | Bacteria | 6502 |
| 308 | Ga0307415_100011198 | 3300032126 | Bacteria | 5119 |
| 309 | Ga0307415_100021129 | 3300032126 | Bacteria | 3993 |
| 310 | Ga0307415_100022429 | 3300032126 | Bacteria | 3896 |
| 311 | Ga0307415_100035008 | 3300032126 | Bacteria | 3276 |
| 312 | Ga0307415_100066323 | 3300032126 | Bacteria | 2518 |
| 313 | Ga0373936_0062404 | 3300035113 | Bacteria | 1524 |
| 314 | Ga0373947_0008987 | 3300035725 | Bacteria | 5744 |
| 315 | Ga0373925_0184755 | 3300037068 | Bacteria | 1652 |
| 316 | Ga0395899_0022179 | 3300037312 | Bacteria | 4815 |
| 317 | Ga0395899_0026239 | 3300037312 | Bacteria | 4396 |
| 318 | Ga0395899_0027135 | 3300037312 | Bacteria | 4320 |
| 319 | Ga0395899_0034783 | 3300037312 | Bacteria | 3784 |
| 320 | Ga0395899_0050999 | 3300037312 | Bacteria | 3072 |
| 321 | Ga0395899_0073520 | 3300037312 | Bacteria | 2499 |
| 322 | Ga0395900_0008527 | 3300037418 | Bacteria | 10535 |
| 323 | Ga0395900_0015527 | 3300037418 | Bacteria | 7762 |
| 324 | Ga0395900_0024493 | 3300037418 | Bacteria | 6181 |
| 325 | Ga0395900_0053543 | 3300037418 | Bacteria | 4154 |
| 326 | Ga0395900_0080579 | 3300037418 | Bacteria | 3345 |
| 327 | Ga0395900_0196649 | 3300037418 | Bacteria | 2042 |
| 328 | Ga0395900_0213790 | 3300037418 | Bacteria | 1946 |
| 329 | Ga0395900_0241201 | 3300037418 | Bacteria | 1813 |
| 330 | Ga0395898_0026693 | 3300037466 | Bacteria | 5806 |
| 331 | Ga0395898_0035644 | 3300037466 | Bacteria | 4945 |
| 332 | Ga0395898_0048677 | 3300037466 | Bacteria | 4155 |
| 333 | Ga0395898_0063855 | 3300037466 | Bacteria | 3573 |
| 334 | Ga0395898_0080224 | 3300037466 | Bacteria | 3147 |
| 335 | Ga0395905_0061834 | 3300037471 | Bacteria | 3503 |
| 336 | Ga0395901_0007234 | 3300038443 | Bacteria | 11196 |
| 337 | Ga0395901_0017791 | 3300038443 | Bacteria | 7254 |
| 338 | Ga0395901_0060065 | 3300038443 | Bacteria | 3955 |
| 339 | Ga0395901_0073476 | 3300038443 | Bacteria | 3566 |
| 340 | Ga0395901_0074737 | 3300038443 | Bacteria | 3535 |
| 341 | Ga0395901_0170079 | 3300038443 | Bacteria | 2286 |
| 342 | Ga0395901_0193977 | 3300038443 | Bacteria | 2130 |
| 343 | Ga0395901_0645952 | 3300038443 | Bacteria | 1062 |
| 344 | Ga0400483_091492 | 3300039062 | Bacteria | 1313 |
| 345 | Ga0400489_88148 | 3300039093 | Bacteria | 10154 |
| 346 | Ga0439436_0000683 | 3300041404 | Bacteria | 9113 |
| 347 | Ga0439436_0006583 | 3300041404 | Bacteria | 3569 |
| 348 | Ga0439436_0010657 | 3300041404 | Bacteria | 2801 |
| 349 | Ga0439439_0001501 | 3300041406 | Bacteria | 4670 |
| 350 | Ga0439466_0007754 | 3300041411 | Bacteria | 4055 |
| 351 | Ga0439465_0043928 | 3300041413 | Bacteria | 1451 |
| 352 | Ga0451800_0408773 | 3300041459 | Bacteria | 1060 |
| 353 | Ga0451853_2589370 | 3300041512 | Bacteria | 1397 |
| 354 | Ga0439431_0030026 | 3300041997 | Bacteria | 1345 |
| 355 | Ga0439433_0000729 | 3300041999 | Bacteria | 6425 |
| 356 | Ga0439433_0000759 | 3300041999 | Bacteria | 6347 |
| 357 | Ga0439433_0001416 | 3300041999 | Bacteria | 4942 |
| 358 | Ga0439433_0009460 | 3300041999 | Bacteria | 2123 |
| 359 | Ga0439442_000821 | 3300042002 | Bacteria | 6429 |
| 360 | Ga0439442_002321 | 3300042002 | Bacteria | 3736 |
| 361 | Ga0439442_007444 | 3300042002 | Bacteria | 2200 |
| 362 | Ga0439442_030779 | 3300042002 | Bacteria | 1121 |
| 363 | Ga0439449_0001548 | 3300042007 | Bacteria | 9005 |
| 364 | Ga0439449_0006758 | 3300042007 | Bacteria | 4377 |
| 365 | Ga0439449_0008433 | 3300042007 | Bacteria | 3916 |
| 366 | Ga0439449_0008676 | 3300042007 | Bacteria | 3857 |
| 367 | Ga0439449_0128658 | 3300042007 | Bacteria | 941 |
| 368 | Ga0439451_006354 | 3300042009 | Bacteria | 2417 |
| 369 | Ga0439457_003241 | 3300042014 | Bacteria | 4471 |
| 370 | Ga0439457_004666 | 3300042014 | Bacteria | 3544 |
| 371 | Ga0439457_028029 | 3300042014 | Bacteria | 1246 |
| 372 | Ga0439462_0002117 | 3300042015 | Bacteria | 4559 |
| 373 | Ga0439462_0007302 | 3300042015 | Bacteria | 2762 |
| 374 | Ga0439463_003841 | 3300042016 | Bacteria | 3789 |
| 375 | Ga0450920_000660 | 3300042122 | Bacteria | 5495 |
| 376 | Ga0439446_0019718 | 3300042156 | Bacteria | 1896 |
| 377 | Ga0439434_0002507 | 3300042435 | Bacteria | 5346 |
| 378 | Ga0439434_0072571 | 3300042435 | Bacteria | 1085 |
| 379 | Ga0439444_0004741 | 3300042437 | Bacteria | 1989 |
| 380 | Ga0466972_0001921 | 3300044658 | Bacteria | 10193 |
| 381 | Ga0466972_0002862 | 3300044658 | Bacteria | 8540 |
| 382 | Ga0466972_0046832 | 3300044658 | Bacteria | 2092 |
| 383 | Ga0466965_0000019 | 3300044683 | Bacteria | 63668 |
| 384 | Ga0466965_0002706 | 3300044683 | Bacteria | 7594 |
| 385 | Ga0466965_0002969 | 3300044683 | Bacteria | 7348 |
| 386 | Ga0466965_0003150 | 3300044683 | Bacteria | 7197 |
| 387 | Ga0466965_0005823 | 3300044683 | Bacteria | 5562 |
| 388 | Ga0466966_0018721 | 3300044684 | Bacteria | 4562 |
| 389 | Ga0466966_0080996 | 3300044684 | Bacteria | 2022 |
| 390 | Ga0466961_0030055 | 3300044693 | Bacteria | 3491 |
| 391 | Ga0466963_0004047 | 3300044694 | Bacteria | 8483 |
| 392 | Ga0466963_0035136 | 3300044694 | Bacteria | 3264 |
| 393 | Ga0466963_0187118 | 3300044694 | Bacteria | 1446 |
| 394 | Ga0466968_0018202 | 3300044735 | Bacteria | 2816 |
| 395 | Ga0466970_0007827 | 3300044765 | Bacteria | 5365 |
| 396 | Ga0466970_0056039 | 3300044765 | Bacteria | 2106 |
| 397 | Ga0466970_0089980 | 3300044765 | Bacteria | 1665 |
| 398 | Ga0466957_0047267 | 3300044842 | Bacteria | 2615 |
| 399 | Ga0466960_0020911 | 3300044901 | Bacteria | 2906 |
| 400 | Ga0466959_0011880 | 3300045049 | Bacteria | 6272 |
| 401 | Ga0466958_0009923 | 3300045836 | Bacteria | 5318 |
| 402 | Ga0466967_0010710 | 3300045976 | Bacteria | 6893 |
| 403 | Ga0466967_0045955 | 3300045976 | Bacteria | 3798 |
| 404 | Ga0466967_0071530 | 3300045976 | Bacteria | 3106 |
| 405 | Ga0466967_0126537 | 3300045976 | Bacteria | 2367 |
| 406 | Ga0466967_0483565 | 3300045976 | Bacteria | 1213 |
| 407 | Ga0495627_034204 | 3300046453 | Bacteria | 1589 |
| 408 | Ga0495603_0003372 | 3300046455 | Bacteria | 9509 |
| 409 | Ga0495651_0010267 | 3300046462 | Bacteria | 7190 |
| 410 | Ga0495653_0010508 | 3300046463 | Bacteria | 7577 |
| 411 | Ga0495653_0017174 | 3300046463 | Bacteria | 5885 |
| 412 | Ga0495662_0000888 | 3300046476 | Bacteria | 14627 |
| 413 | Ga0495664_0007517 | 3300046477 | Bacteria | 6058 |
| 414 | Ga0495585_0039341 | 3300046492 | Bacteria | 2659 |
| 415 | Ga0495585_0113760 | 3300046492 | Bacteria | 1437 |
| 416 | Ga0495608_0007841 | 3300046511 | Bacteria | 7507 |
| 417 | Ga0495628_0005634 | 3300046516 | Bacteria | 10961 |
| 418 | Ga0495630_0064890 | 3300046517 | Bacteria | 2743 |
| 419 | Ga0495666_0005974 | 3300046526 | Bacteria | 6135 |
| 420 | Ga0495652_0017084 | 3300046529 | Bacteria | 6479 |
| 421 | Ga0495665_0001299 | 3300046531 | Bacteria | 13324 |
| 422 | Ga0495640_0001598 | 3300046533 | Bacteria | 17890 |
| 423 | Ga0495586_0042887 | 3300046535 | Bacteria | 2436 |
| 424 | Ga0495597_0049274 | 3300046542 | Bacteria | 1862 |
| 425 | Ga0495667_0006995 | 3300046559 | Bacteria | 7653 |
| 426 | Ga0495656_0002387 | 3300046615 | Bacteria | 6224 |
| 427 | Ga0495611_0148875 | 3300046648 | Bacteria | 1093 |
| 428 | Ga0495635_0032471 | 3300046663 | Bacteria | 3621 |
| 429 | Ga0495657_0000779 | 3300046675 | Bacteria | 28366 |
| 430 | Ga0495599_0008391 | 3300046678 | Bacteria | 6280 |
| 431 | Ga0495646_0107077 | 3300046680 | Bacteria | 1595 |
| 432 | Ga0495613_0001340 | 3300046689 | Bacteria | 18759 |
| 433 | Ga0495624_0079514 | 3300046690 | Bacteria | 2033 |
| 434 | Ga0495670_0000463 | 3300046691 | Bacteria | 19403 |
| 435 | Ga0495600_0009498 | 3300046809 | Bacteria | 6011 |
| 436 | Ga0495604_0000995 | 3300047317 | Bacteria | 23556 |
| 437 | Ga0495672_0037147 | 3300047320 | Bacteria | 2984 |
| 438 | Ga0495676_0031060 | 3300047321 | Bacteria | 4524 |
| 439 | Ga0495675_0004875 | 3300047444 | Bacteria | 8169 |
| 440 | Ga0495684_0039034 | 3300047471 | Bacteria | 3640 |
| 441 | Ga0495602_0025227 | 3300048088 | Bacteria | 5754 |
| 442 | Ga0496101_0083830 | 3300048904 | Bacteria | 2360 |
| 443 | Ga0496102_0721474 | 3300048905 | Bacteria | 920 |
| 444 | Ga0496103_0010753 | 3300048906 | Bacteria | 5414 |
| 445 | Ga0496107_0007873 | 3300048910 | Bacteria | 7356 |
| 446 | Ga0496108_0020549 | 3300048911 | Bacteria | 5427 |
| 447 | Ga0496110_0438368 | 3300048913 | Bacteria | 1191 |
| 448 | Ga0496110_0499289 | 3300048913 | Bacteria | 1108 |
| 449 | Ga0496112_0104518 | 3300048915 | Bacteria | 2802 |
| 450 | Ga0496112_0184459 | 3300048915 | Bacteria | 2050 |
| 451 | Ga0496113_0440471 | 3300048916 | Bacteria | 1047 |
| 452 | Ga0496114_0012605 | 3300048917 | Bacteria | 6772 |
| 453 | Ga0496114_0040127 | 3300048917 | Bacteria | 3874 |
| 454 | Ga0496114_0588262 | 3300048917 | Bacteria | 982 |
| 455 | Ga0496115_0000823 | 3300048918 | Bacteria | 22727 |
| 456 | Ga0496115_0034821 | 3300048918 | Bacteria | 3980 |
| 457 | Ga0496118_0156851 | 3300048921 | Bacteria | 1414 |
| 458 | Ga0496119_0000533 | 3300048922 | Bacteria | 51798 |
| 459 | Ga0496119_0002468 | 3300048922 | Bacteria | 20289 |
| 460 | Ga0496120_0011887 | 3300048923 | Bacteria | 5956 |
| 461 | Ga0496120_0031436 | 3300048923 | Bacteria | 3214 |
| 462 | Ga0496121_0000015 | 3300048924 | Bacteria | 571958 |
| 463 | Ga0496122_0160474 | 3300048925 | Bacteria | 1372 |
| 464 | Ga0496122_0161786 | 3300048925 | Bacteria | 1364 |
| 465 | Ga0496123_0088922 | 3300048926 | Bacteria | 1842 |
| 466 | Ga0496124_0019651 | 3300048927 | Bacteria | 6276 |
| 467 | Ga0496124_0047953 | 3300048927 | Bacteria | 3652 |
| 468 | Ga0501031_0000112 | 3300049568 | Bacteria | 43234 |
| 469 | Ga0501032_0004795 | 3300049569 | Bacteria | 10137 |
| 470 | Ga0501032_0006992 | 3300049569 | Bacteria | 8273 |
| 471 | Ga0501032_0014569 | 3300049569 | Bacteria | 5568 |
| 472 | Ga0501032_0027505 | 3300049569 | Bacteria | 3907 |
| 473 | Ga0501032_0046041 | 3300049569 | Bacteria | 2948 |
| 474 | Ga0501032_0102303 | 3300049569 | Bacteria | 1898 |
| 475 | Ga0501033_0002294 | 3300049570 | Bacteria | 16338 |
| 476 | Ga0501033_0027059 | 3300049570 | Bacteria | 4315 |
| 477 | Ga0501033_0027543 | 3300049570 | Bacteria | 4273 |
| 478 | Ga0501033_0034953 | 3300049570 | Bacteria | 3767 |
| 479 | Ga0501033_0036631 | 3300049570 | Bacteria | 3675 |
| 480 | Ga0501033_0065927 | 3300049570 | Bacteria | 2663 |
| 481 | Ga0501033_0066468 | 3300049570 | Bacteria | 2651 |
| 482 | Ga0501034_0000042 | 3300049571 | Bacteria | 229124 |
| 483 | Ga0501034_0004214 | 3300049571 | Bacteria | 16056 |
| 484 | Ga0501034_0005763 | 3300049571 | Bacteria | 13469 |
| 485 | Ga0501034_0010113 | 3300049571 | Bacteria | 9843 |
| 486 | Ga0501034_0037972 | 3300049571 | Bacteria | 4877 |
| 487 | Ga0501034_0038852 | 3300049571 | Bacteria | 4821 |
| 488 | Ga0501034_0080887 | 3300049571 | Bacteria | 3252 |
| 489 | Ga0501034_0122003 | 3300049571 | Bacteria | 2592 |
| 490 | Ga0501034_0224328 | 3300049571 | Bacteria | 1830 |
| 491 | Ga0501036_0001867 | 3300049572 | Bacteria | 16331 |
| 492 | Ga0501036_0002582 | 3300049572 | Bacteria | 14247 |
| 493 | Ga0501036_0155354 | 3300049572 | Bacteria | 1930 |
| 494 | Ga0501037_0007023 | 3300049573 | Bacteria | 8222 |
| 495 | Ga0501037_0011660 | 3300049573 | Bacteria | 6471 |
| 496 | Ga0501037_0012729 | 3300049573 | Bacteria | 6197 |
| 497 | Ga0501037_0014282 | 3300049573 | Bacteria | 5853 |
| 498 | Ga0501037_0014339 | 3300049573 | Bacteria | 5839 |
| 499 | Ga0501037_0022295 | 3300049573 | Bacteria | 4685 |
| 500 | Ga0501037_0030276 | 3300049573 | Bacteria | 4000 |
| 501 | Ga0501037_0064035 | 3300049573 | Bacteria | 2680 |
| 502 | Ga0501037_0371114 | 3300049573 | Bacteria | 984 |
| 503 | Ga0501038_0002639 | 3300049574 | Bacteria | 16772 |
| 504 | Ga0501038_0007160 | 3300049574 | Bacteria | 10310 |
| 505 | Ga0501038_0024834 | 3300049574 | Bacteria | 5342 |
| 506 | Ga0501038_0090819 | 3300049574 | Bacteria | 2559 |
| 507 | Ga0501038_0101199 | 3300049574 | Bacteria | 2399 |
| 508 | Ga0501038_0124605 | 3300049574 | Bacteria | 2121 |
| 509 | Ga0501038_0220437 | 3300049574 | Bacteria | 1513 |
| 510 | Ga0501039_0000369 | 3300049575 | Bacteria | 32246 |
| 511 | Ga0501039_0027635 | 3300049575 | Bacteria | 4363 |
| 512 | Ga0501039_0052534 | 3300049575 | Bacteria | 3153 |
| 513 | Ga0501039_0064929 | 3300049575 | Bacteria | 2830 |
| 514 | Ga0501039_0095822 | 3300049575 | Bacteria | 2313 |
| 515 | Ga0501039_0217070 | 3300049575 | Bacteria | 1504 |
| 516 | Ga0501040_0030288 | 3300049576 | Bacteria | 3656 |
| 517 | Ga0501042_0005141 | 3300049578 | Bacteria | 8398 |
| 518 | Ga0501042_0124193 | 3300049578 | Bacteria | 1858 |
| 519 | Ga0501042_0173918 | 3300049578 | Bacteria | 1553 |
| 520 | Ga0501043_0000679 | 3300049579 | Bacteria | 29946 |
| 521 | Ga0501043_0003795 | 3300049579 | Bacteria | 12422 |
| 522 | Ga0501043_0031651 | 3300049579 | Bacteria | 4158 |
| 523 | Ga0501043_0058798 | 3300049579 | Bacteria | 3017 |
| 524 | Ga0501043_0061837 | 3300049579 | Bacteria | 2940 |
| 525 | Ga0501043_0092421 | 3300049579 | Bacteria | 2379 |
| 526 | Ga0501043_0119822 | 3300049579 | Bacteria | 2064 |
| 527 | Ga0501043_0293199 | 3300049579 | Bacteria | 1245 |
| 528 | Ga0501046_0000230 | 3300049580 | Bacteria | 57666 |
| 529 | Ga0501046_0011051 | 3300049580 | Bacteria | 7734 |
| 530 | Ga0501046_0035615 | 3300049580 | Bacteria | 4010 |
| 531 | Ga0501047_0002902 | 3300049581 | Bacteria | 16263 |
| 532 | Ga0501047_0007924 | 3300049581 | Bacteria | 10015 |
| 533 | Ga0501047_0023386 | 3300049581 | Bacteria | 5933 |
| 534 | Ga0501047_0114553 | 3300049581 | Bacteria | 2578 |
| 535 | Ga0501047_0137918 | 3300049581 | Bacteria | 2319 |
| 536 | Ga0501047_0344354 | 3300049581 | Bacteria | 1328 |
| 537 | Ga0501047_0369025 | 3300049581 | Bacteria | 1270 |
| 538 | Ga0501048_0000713 | 3300049582 | Bacteria | 24290 |
| 539 | Ga0501048_0003800 | 3300049582 | Bacteria | 11528 |
| 540 | Ga0501048_0010942 | 3300049582 | Bacteria | 6768 |
| 541 | Ga0501067_0009741 | 3300049583 | Bacteria | 5318 |
| 542 | Ga0501067_0023660 | 3300049583 | Bacteria | 3405 |
| 543 | Ga0501067_0025109 | 3300049583 | Bacteria | 3304 |
| 544 | Ga0501067_0184274 | 3300049583 | Bacteria | 1163 |
| 545 | Ga0501069_0001968 | 3300049585 | Bacteria | 10265 |
| 546 | Ga0501069_0091185 | 3300049585 | Bacteria | 1723 |
| 547 | Ga0501070_0000838 | 3300049586 | Bacteria | 27930 |
| 548 | Ga0501070_0008293 | 3300049586 | Bacteria | 8780 |
| 549 | Ga0501070_0027789 | 3300049586 | Bacteria | 4745 |
| 550 | Ga0501070_0162154 | 3300049586 | Bacteria | 1843 |
| 551 | Ga0501070_0253599 | 3300049586 | Bacteria | 1439 |
| 552 | Ga0501071_0208364 | 3300049587 | Bacteria | 1470 |
| 553 | Ga0501071_0236294 | 3300049587 | Bacteria | 1377 |
| 554 | Ga0501072_0007590 | 3300049588 | Bacteria | 8228 |
| 555 | Ga0501072_0198727 | 3300049588 | Bacteria | 1599 |
| 556 | Ga0501073_0002405 | 3300049589 | Bacteria | 14007 |
| 557 | Ga0501073_0006475 | 3300049589 | Bacteria | 8712 |
| 558 | Ga0501073_0025766 | 3300049589 | Bacteria | 4213 |
| 559 | Ga0501073_0180741 | 3300049589 | Bacteria | 1460 |
| 560 | Ga0501074_0001383 | 3300049590 | Bacteria | 16099 |
| 561 | Ga0501074_0008483 | 3300049590 | Bacteria | 7447 |
| 562 | Ga0501074_0049266 | 3300049590 | Bacteria | 3041 |
| 563 | Ga0501074_0070939 | 3300049590 | Bacteria | 2504 |
| 564 | Ga0501243_001947 | 3300049675 | Bacteria | 3003 |
| 565 | Ga0501080_0000870 | 3300049742 | Bacteria | 24737 |
| 566 | Ga0501080_0005330 | 3300049742 | Bacteria | 11460 |
| 567 | Ga0501080_0195571 | 3300049742 | Bacteria | 1857 |
| 568 | Ga0501083_0000019 | 3300049744 | Bacteria | 147154 |
| 569 | Ga0501083_0000558 | 3300049744 | Bacteria | 23877 |
| 570 | Ga0501083_0012760 | 3300049744 | Bacteria | 5876 |
| 571 | Ga0501083_0076248 | 3300049744 | Bacteria | 2225 |
| 572 | Ga0501265_022947 | 3300049762 | Bacteria | 856 |
| 573 | Ga0501035_0005907 | 3300049822 | Bacteria | 11524 |
| 574 | Ga0501035_0010851 | 3300049822 | Bacteria | 8438 |
| 575 | Ga0501035_0066759 | 3300049822 | Bacteria | 3192 |
| 576 | Ga0501035_0244145 | 3300049822 | Bacteria | 1527 |
| 577 | Ga0501044_0024180 | 3300049823 | Bacteria | 6454 |
| 578 | Ga0501044_0030914 | 3300049823 | Bacteria | 5639 |
| 579 | Ga0501044_0031624 | 3300049823 | Bacteria | 5569 |
| 580 | Ga0501044_0051092 | 3300049823 | Bacteria | 4264 |
| 581 | Ga0501044_0051674 | 3300049823 | Bacteria | 4237 |
| 582 | Ga0501044_0075853 | 3300049823 | Bacteria | 3414 |
| 583 | Ga0501044_0319860 | 3300049823 | Bacteria | 1476 |
| 584 | Ga0501045_0036568 | 3300049824 | Bacteria | 3566 |
| 585 | Ga0501212_003302 | 3300049851 | Bacteria | 2015 |
| 586 | nmdc:mga00v17_5185_c1 | 3300050491 | Bacteria | 6855 |
| 587 | nmdc:mga00v17_93544_c1 | 3300050491 | Bacteria | 1890 |
| 588 | nmdc:mga0yw44_6554_c1 | 3300050492 | Bacteria | 5292 |
| 589 | nmdc:mga05p37_177898_c1 | 3300050507 | Bacteria | 2591 |
| 590 | nmdc:mga05p37_35924_c1 | 3300050507 | Bacteria | 6080 |
| 591 | nmdc:mga0qj67_358556_c1 | 3300050509 | Bacteria | 1178 |
| 592 | nmdc:mga0qj67_966_c1 | 3300050509 | Bacteria | 19788 |
| 593 | nmdc:mga06r32_47408_c1 | 3300050510 | Bacteria | 4104 |
| 594 | nmdc:mga08y16_22896_c1 | 3300050511 | Bacteria | 6594 |
| 595 | nmdc:mga08y16_73623_c1 | 3300050511 | Bacteria | 3560 |
| 596 | nmdc:mga08y16_80833_c1 | 3300050511 | Bacteria | 3389 |
| 597 | nmdc:mga0n895_187954_c1 | 3300050512 | Bacteria | 2097 |
| 598 | nmdc:mga0n895_200_c1 | 3300050512 | Bacteria | 37296 |
| 599 | nmdc:mga0n895_66676_c1 | 3300050512 | Bacteria | 3564 |
| 600 | nmdc:mga0n895_78222_c1 | 3300050512 | Bacteria | 3292 |
| 601 | nmdc:mga0n895_987_c1 | 3300050512 | Bacteria | 20606 |
| 602 | nmdc:mga0rr50_842_c1 | 3300050513 | Bacteria | 16524 |
| 603 | nmdc:mga08x19_1049_c1 | 3300050514 | Bacteria | 17282 |
| 604 | nmdc:mga0a205_109336_c1 | 3300050515 | Bacteria | 2663 |
| 605 | nmdc:mga0a205_116_c3 | 3300050515 | Bacteria | 9931 |
| 606 | nmdc:mga0a205_14642_c1 | 3300050515 | Bacteria | 7320 |
| 607 | nmdc:mga0a205_93973_c2 | 3300050515 | Bacteria | 2267 |
| 608 | Ga0495619_0013668 | 3300053085 | Bacteria | 5118 |
| 609 | Ga0500562_000853 | 3300053108 | Bacteria | 7384 |
| 610 | Ga0500642_0011785 | 3300053130 | Bacteria | 3143 |
| 611 | Ga0500568_0000742 | 3300053139 | Bacteria | 23269 |
| 612 | Ga0500588_0001406 | 3300053146 | Bacteria | 4570 |
| 613 | Ga0500604_0010602 | 3300053151 | Bacteria | 2468 |
| 614 | Ga0500616_0000384 | 3300053153 | Bacteria | 61859 |
| 615 | Ga0500616_0003567 | 3300053153 | Bacteria | 11784 |
| 616 | Ga0500636_0009533 | 3300053177 | Bacteria | 5648 |
| 617 | Ga0501084_0007981 | 3300054114 | Bacteria | 8714 |
| 618 | Ga0501084_0396219 | 3300054114 | Bacteria | 1167 |
| 619 | Ga0587066_008637 | 3300059490 | Bacteria | 1420 |
| 620 | Ga0587070_007899 | 3300059491 | Bacteria | 1491 |
| 621 | Ga0587070_010517 | 3300059491 | Bacteria | 1365 |
| 622 | Ga0587070_014117 | 3300059491 | Bacteria | 1243 |
| 623 | Ga0587073_0002528 | 3300059492 | Bacteria | 2362 |
| 624 | Ga0587073_0002778 | 3300059492 | Bacteria | 2301 |
| 625 | Ga0587077_003123 | 3300059493 | Bacteria | 2053 |
| 626 | Ga0587077_005203 | 3300059493 | Bacteria | 1766 |
| 627 | Ga0587082_000911 | 3300059504 | Bacteria | 2801 |
| 628 | Ga0587083_0002276 | 3300059505 | Bacteria | 2360 |
| 629 | Ga0587083_0002815 | 3300059505 | Bacteria | 2222 |
| 630 | Ga0587091_001408 | 3300059511 | Bacteria | 2589 |
| 631 | Ga0587092_001200 | 3300059512 | Bacteria | 2452 |
| 632 | Ga0587092_003139 | 3300059512 | Bacteria | 1847 |
| 633 | Ga0587101_000801 | 3300059623 | Bacteria | 2443 |
| 634 | Ga0587117_011500 | 3300059627 | Bacteria | 1100 |
| 635 | Ga0587067_002917 | 3300059640 | Bacteria | 2086 |
| 636 | Ga0587075_001649 | 3300059644 | Bacteria | 2211 |
| 637 | Ga0587075_003232 | 3300059644 | Bacteria | 1796 |
| 638 | Ga0587079_005537 | 3300059647 | Bacteria | 1793 |
| 639 | Ga0587107_002398 | 3300059652 | Bacteria | 1689 |
| 640 | Ga0501082_0094460 | 3300060353 | Bacteria | 2584 |
| 641 | Ga0466962_0164657 | 3300061719 | Bacteria | 1078 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031824 | Ga0307413_10156560 | Ga0307413_101565601 | 227 |
| 2 | 3300005356 | Ga0070674_100119227 | Ga0070674_1001192272 | 231 |
| 3 | 3300005440 | Ga0070705_100039424 | Ga0070705_1000394242 | 231 |
| 4 | 3300005444 | Ga0070694_100175413 | Ga0070694_1001754132 | 231 |
| 5 | 3300005546 | Ga0070696_100024725 | Ga0070696_1000247253 | 231 |
| 6 | 3300005718 | Ga0068866_10094119 | Ga0068866_100941192 | 231 |
| 7 | 3300006881 | Ga0068865_100072151 | Ga0068865_1000721511 | 231 |
| 8 | 3300025899 | Ga0207642_10002328 | Ga0207642_100023284 | 231 |
| 9 | 3300025935 | Ga0207709_10008942 | Ga0207709_100089425 | 231 |
| 10 | 3300025937 | Ga0207669_10015911 | Ga0207669_100159112 | 231 |
| 11 | 3300026118 | Ga0207675_100161684 | Ga0207675_1001616843 | 231 |
| 12 | 3300005471 | Ga0070698_100005492 | Ga0070698_1000054927 | 233 |
| 13 | 3300025922 | Ga0207646_10023685 | Ga0207646_100236853 | 233 |
| 14 | 3300006852 | Ga0075433_10291281 | Ga0075433_102912812 | 234 |
| 15 | 3300050512 | nmdc:mga0n895_187954_c1 | nmdc:mga0n895_187954_c1_1153_2040 | 234 |
| 16 | 3300048917 | Ga0496114_0588262 | Ga0496114_0588262_135_968 | 243 |
| 17 | 3300042007 | Ga0439449_0128658 | Ga0439449_0128658_11_823 | 244 |
| 18 | 3300005445 | Ga0070708_100021086 | Ga0070708_1000210862 | 246 |
| 19 | 3300025910 | Ga0207684_10213382 | Ga0207684_102133822 | 246 |
| 20 | 3300025922 | Ga0207646_10103475 | Ga0207646_101034752 | 246 |
| 21 | 3300005406 | Ga0070703_10000038 | Ga0070703_1000003829 | 249 |
| 22 | 3300005440 | Ga0070705_100091684 | Ga0070705_1000916842 | 249 |
| 23 | 3300005445 | Ga0070708_100001328 | Ga0070708_1000013283 | 249 |
| 24 | 3300005467 | Ga0070706_100000237 | Ga0070706_10000023751 | 249 |
| 25 | 3300005468 | Ga0070707_100001654 | Ga0070707_10000165417 | 249 |
| 26 | 3300025885 | Ga0207653_10000093 | Ga0207653_1000009324 | 249 |
| 27 | 3300025910 | Ga0207684_10000683 | Ga0207684_1000068348 | 249 |
| 28 | 3300049762 | Ga0501265_022947 | Ga0501265_022947_37_846 | 249 |
| 29 | 3300006852 | Ga0075433_10000482 | Ga0075433_100004823 | 250 |
| 30 | 3300006871 | Ga0075434_100025397 | Ga0075434_1000253973 | 250 |
| 31 | 3300007076 | Ga0075435_100000274 | Ga0075435_10000027431 | 250 |
| 32 | 3300048905 | Ga0496102_0721474 | Ga0496102_0721474_33_857 | 252 |
| 33 | 3300009098 | Ga0105245_10025177 | Ga0105245_100251773 | 254 |
| 34 | 3300009148 | Ga0105243_10011986 | Ga0105243_100119862 | 254 |
| 35 | 3300009176 | Ga0105242_10003785 | Ga0105242_1000378511 | 254 |
| 36 | 3300013297 | Ga0157378_10040745 | Ga0157378_100407453 | 254 |
| 37 | 3300048910 | Ga0496107_0007873 | Ga0496107_0007873_686_1669 | 256 |
| 38 | 3300049823 | Ga0501044_0319860 | Ga0501044_0319860_497_1450 | 256 |
| 39 | 3300039093 | Ga0400489_88148 | Ga0400489_88148_6398_7372 | 258 |
| 40 | 3300049573 | Ga0501037_0012729 | Ga0501037_0012729_611_1564 | 259 |
| 41 | 3300049574 | Ga0501038_0024834 | Ga0501038_0024834_4138_5091 | 259 |
| 42 | 3300049586 | Ga0501070_0027789 | Ga0501070_0027789_2326_3279 | 259 |
| 43 | 3300005937 | Ga0081455_10012967 | Ga0081455_100129678 | 264 |
| 44 | 3300005437 | Ga0070710_10011350 | Ga0070710_100113502 | 265 |
| 45 | 3300025898 | Ga0207692_10026359 | Ga0207692_100263592 | 265 |
| 46 | 3300044694 | Ga0466963_0035136 | Ga0466963_0035136_2038_3018 | 266 |
| 47 | 3300050509 | nmdc:mga0qj67_966_c1 | nmdc:mga0qj67_966_c1_2270_3175 | 266 |
| 48 | 3300031731 | Ga0307405_10019311 | Ga0307405_100193113 | 267 |
| 49 | 3300031824 | Ga0307413_10098148 | Ga0307413_100981482 | 267 |
| 50 | 3300031852 | Ga0307410_10003812 | Ga0307410_100038126 | 267 |
| 51 | 3300031903 | Ga0307407_10010268 | Ga0307407_100102682 | 267 |
| 52 | 3300031995 | Ga0307409_100020099 | Ga0307409_1000200996 | 267 |
| 53 | 3300032002 | Ga0307416_100008345 | Ga0307416_1000083454 | 267 |
| 54 | 3300032005 | Ga0307411_10059469 | Ga0307411_100594692 | 267 |
| 55 | 3300041999 | Ga0439433_0001416 | Ga0439433_0001416_3799_4716 | 267 |
| 56 | iso_pu_bacteria | 2821111986 | 2821112438 | 267 |
| 57 | iso_pu_bacteria | 2856741275 | 2856744713 | 267 |
| 58 | iso_pu_bacteria | 2891562705 | 2891566520 | 267 |
| 59 | 3300005327 | Ga0070658_10004384 | Ga0070658_100043848 | 268 |
| 60 | 3300005336 | Ga0070680_100389063 | Ga0070680_1003890632 | 268 |
| 61 | 3300005344 | Ga0070661_100018909 | Ga0070661_1000189092 | 268 |
| 62 | 3300005458 | Ga0070681_10037212 | Ga0070681_100372124 | 268 |
| 63 | 3300005563 | Ga0068855_100008798 | Ga0068855_1000087988 | 268 |
| 64 | 3300009093 | Ga0105240_10026509 | Ga0105240_100265095 | 268 |
| 65 | 3300009551 | Ga0105238_10081928 | Ga0105238_100819282 | 268 |
| 66 | 3300025909 | Ga0207705_10034135 | Ga0207705_100341353 | 268 |
| 67 | 3300025913 | Ga0207695_10021186 | Ga0207695_100211864 | 268 |
| 68 | 3300025919 | Ga0207657_10011659 | Ga0207657_100116596 | 268 |
| 69 | 3300025949 | Ga0207667_10042345 | Ga0207667_100423452 | 268 |
| 70 | 3300031911 | Ga0307412_10148849 | Ga0307412_101488492 | 268 |
| 71 | 3300032002 | Ga0307416_100073802 | Ga0307416_1000738021 | 268 |
| 72 | 3300032126 | Ga0307415_100004657 | Ga0307415_1000046575 | 268 |
| 73 | 3300045976 | Ga0466967_0010710 | Ga0466967_0010710_3416_4369 | 268 |
| 74 | 3300048913 | Ga0496110_0438368 | Ga0496110_0438368_62_976 | 268 |
| 75 | 3300049569 | Ga0501032_0046041 | Ga0501032_0046041_297_1220 | 268 |
| 76 | 3300049571 | Ga0501034_0122003 | Ga0501034_0122003_1033_1956 | 268 |
| 77 | 3300049573 | Ga0501037_0371114 | Ga0501037_0371114_39_962 | 268 |
| 78 | 3300049575 | Ga0501039_0064929 | Ga0501039_0064929_998_1921 | 268 |
| 79 | 3300049578 | Ga0501042_0124193 | Ga0501042_0124193_856_1779 | 268 |
| 80 | 3300049580 | Ga0501046_0035615 | Ga0501046_0035615_2863_3786 | 268 |
| 81 | 3300049581 | Ga0501047_0007924 | Ga0501047_0007924_6062_6985 | 268 |
| 82 | 3300049582 | Ga0501048_0010942 | Ga0501048_0010942_1428_2351 | 268 |
| 83 | 3300049823 | Ga0501044_0051674 | Ga0501044_0051674_1693_2709 | 268 |
| 84 | 3300049824 | Ga0501045_0036568 | Ga0501045_0036568_2514_3437 | 268 |
| 85 | 3300025225 | Ga0209566_102919 | Ga0209566_1029192 | 269 |
| 86 | 3300048925 | Ga0496122_0161786 | Ga0496122_0161786_252_1145 | 269 |
| 87 | 3300048926 | Ga0496123_0088922 | Ga0496123_0088922_605_1498 | 269 |
| 88 | 3300005937 | Ga0081455_10068617 | Ga0081455_100686172 | 270 |
| 89 | 3300031731 | Ga0307405_10108904 | Ga0307405_101089042 | 270 |
| 90 | 3300031852 | Ga0307410_10250108 | Ga0307410_102501082 | 270 |
| 91 | 3300032005 | Ga0307411_10268687 | Ga0307411_102686871 | 270 |
| 92 | 3300044684 | Ga0466966_0018721 | Ga0466966_0018721_3096_4052 | 270 |
| 93 | 3300046453 | Ga0495627_034204 | Ga0495627_034204_534_1430 | 270 |
| 94 | 3300046492 | Ga0495585_0039341 | Ga0495585_0039341_348_1244 | 270 |
| 95 | 3300046648 | Ga0495611_0148875 | Ga0495611_0148875_182_1066 | 270 |
| 96 | 3300054114 | Ga0501084_0396219 | Ga0501084_0396219_38_943 | 270 |
| 97 | iso_pu_bacteria | 2816332119 | 2816424716 | 270 |
| 98 | iso_pu_bacteria | 2837268691 | 2837270789 | 270 |
| 99 | iso_pu_bacteria | 2884693830 | 2884698386 | 270 |
| 100 | iso_pu_bacteria | 2895442618 | 2895450981 | 270 |
| 101 | iso_pu_bacteria | 2904755435 | 2904758075 | 270 |
| 102 | iso_pu_bacteria | 2919425241 | 2919428016 | 270 |
| 103 | iso_pu_bacteria | 3006988479 | 3006991527 | 270 |
| 104 | 3300005445 | Ga0070708_100370467 | Ga0070708_1003704672 | 271 |
| 105 | 3300005468 | Ga0070707_100026614 | Ga0070707_1000266143 | 271 |
| 106 | 3300005471 | Ga0070698_100062896 | Ga0070698_1000628962 | 271 |
| 107 | 3300005937 | Ga0081455_10091337 | Ga0081455_100913372 | 271 |
| 108 | 3300025910 | Ga0207684_10022598 | Ga0207684_100225982 | 271 |
| 109 | 3300025922 | Ga0207646_10030748 | Ga0207646_100307484 | 271 |
| 110 | 3300025922 | Ga0207646_10061626 | Ga0207646_100616262 | 271 |
| 111 | 3300037312 | Ga0395899_0050999 | Ga0395899_0050999_1516_2463 | 271 |
| 112 | 3300050515 | nmdc:mga0a205_93973_c2 | nmdc:mga0a205_93973_c2_348_1274 | 271 |
| 113 | 3300003841 | Ga0055541_1004319 | Ga0055541_10043192 | 272 |
| 114 | 3300013105 | Ga0157369_10106278 | Ga0157369_101062782 | 272 |
| 115 | 3300013307 | Ga0157372_10141724 | Ga0157372_101417242 | 272 |
| 116 | 3300025225 | Ga0209566_100696 | Ga0209566_1006965 | 272 |
| 117 | iso_pu_bacteria | 2839986021 | 2839988654 | 272 |
| 118 | iso_pu_bacteria | 2919171160 | 2919173784 | 272 |
| 119 | 3300005539 | Ga0068853_100019680 | Ga0068853_1000196803 | 273 |
| 120 | 3300005563 | Ga0068855_100515390 | Ga0068855_1005153902 | 273 |
| 121 | 3300009551 | Ga0105238_10063405 | Ga0105238_100634054 | 273 |
| 122 | 3300025924 | Ga0207694_10032919 | Ga0207694_100329194 | 273 |
| 123 | 3300025944 | Ga0207661_10247902 | Ga0207661_102479022 | 273 |
| 124 | 3300026041 | Ga0207639_10076301 | Ga0207639_100763013 | 273 |
| 125 | 3300038443 | Ga0395901_0007234 | Ga0395901_0007234_7623_8627 | 273 |
| 126 | 3300044658 | Ga0466972_0002862 | Ga0466972_0002862_3892_4869 | 273 |
| 127 | 3300044765 | Ga0466970_0089980 | Ga0466970_0089980_198_1175 | 273 |
| 128 | 3300048918 | Ga0496115_0000823 | Ga0496115_0000823_7366_8295 | 273 |
| 129 | iso_pu_bacteria | 2816332139 | 2816506753 | 273 |
| 130 | 3300003579 | Ga0007429J51699_1042823 | Ga0007429J51699_10428232 | 274 |
| 131 | 3300003693 | Ga0032354_1048032 | Ga0032354_10480322 | 274 |
| 132 | 3300003794 | Ga0055531_10001269 | Ga0055531_100012691 | 274 |
| 133 | 3300006846 | Ga0075430_100002168 | Ga0075430_1000021684 | 274 |
| 134 | 3300009147 | Ga0114129_10146256 | Ga0114129_101462562 | 274 |
| 135 | 3300025304 | Ga0209257_1002324 | Ga0209257_10023242 | 274 |
| 136 | 3300046455 | Ga0495603_0003372 | Ga0495603_0003372_2302_3285 | 274 |
| 137 | iso_pu_bacteria | 2747842429 | 2747952171 | 274 |
| 138 | iso_pu_bacteria | 2816332119 | 2816424286 | 274 |
| 139 | iso_pu_bacteria | 2862705112 | 2862711118 | 274 |
| 140 | iso_pu_bacteria | 2919446982 | 2919450165 | 274 |
| 141 | iso_pu_bacteria | 8008485437 | 8008490663 | 274 |
| 142 | iso_pu_bacteria | 8025524527 | 8025525751 | 274 |
| 143 | 3300032005 | Ga0307411_10008197 | Ga0307411_100081972 | 275 |
| 144 | 3300037418 | Ga0395900_0024493 | Ga0395900_0024493_2905_3828 | 275 |
| 145 | 3300037418 | Ga0395900_0080579 | Ga0395900_0080579_578_1558 | 275 |
| 146 | 3300037466 | Ga0395898_0080224 | Ga0395898_0080224_744_1724 | 275 |
| 147 | 3300038443 | Ga0395901_0060065 | Ga0395901_0060065_682_1662 | 275 |
| 148 | 3300038443 | Ga0395901_0193977 | Ga0395901_0193977_475_1398 | 275 |
| 149 | 3300049581 | Ga0501047_0114553 | Ga0501047_0114553_717_1673 | 275 |
| 150 | 3300049588 | Ga0501072_0198727 | Ga0501072_0198727_205_1161 | 275 |
| 151 | 3300049823 | Ga0501044_0051092 | Ga0501044_0051092_219_1175 | 275 |
| 152 | iso_pu_bacteria | 2808606366 | 2808877737 | 275 |
| 153 | iso_pu_bacteria | 2808606370 | 2808892650 | 275 |
| 154 | iso_pu_bacteria | 2855670206 | 2855676422 | 275 |
| 155 | iso_pu_bacteria | 2855676851 | 2855678656 | 275 |
| 156 | iso_pu_bacteria | 2857288857 | 2857289313 | 275 |
| 157 | iso_pu_bacteria | 2858848962 | 2858855175 | 275 |
| 158 | iso_pu_bacteria | 2858882152 | 2858888740 | 275 |
| 159 | iso_pu_bacteria | 2858888857 | 2858888993 | 275 |
| 160 | iso_pu_bacteria | 2858895516 | 2858897413 | 275 |
| 161 | iso_pu_bacteria | 2869048445 | 2869050900 | 275 |
| 162 | iso_pu_bacteria | 2869061728 | 2869062664 | 275 |
| 163 | iso_pu_bacteria | 2869068681 | 2869074521 | 275 |
| 164 | iso_pu_bacteria | 2887443736 | 2887447790 | 275 |
| 165 | iso_pu_bacteria | 2902582711 | 2902583311 | 275 |
| 166 | iso_pu_bacteria | 2929219909 | 2929224706 | 275 |
| 167 | iso_pu_bacteria | 8003314358 | 8003317981 | 275 |
| 168 | iso_pu_bacteria | 8003830390 | 8003834305 | 275 |
| 169 | iso_pu_bacteria | 8003870546 | 8003877938 | 275 |
| 170 | 3300005329 | Ga0070683_100077862 | Ga0070683_1000778622 | 276 |
| 171 | 3300005535 | Ga0070684_100098326 | Ga0070684_1000983262 | 276 |
| 172 | 3300005564 | Ga0070664_100468728 | Ga0070664_1004687281 | 276 |
| 173 | 3300005985 | Ga0081539_10004428 | Ga0081539_100044285 | 276 |
| 174 | 3300025945 | Ga0207679_10386208 | Ga0207679_103862081 | 276 |
| 175 | 3300031456 | Ga0307513_10020769 | Ga0307513_100207692 | 276 |
| 176 | 3300035113 | Ga0373936_0062404 | Ga0373936_0062404_388_1356 | 276 |
| 177 | 3300035725 | Ga0373947_0008987 | Ga0373947_0008987_986_1954 | 276 |
| 178 | 3300046690 | Ga0495624_0079514 | Ga0495624_0079514_49_1017 | 276 |
| 179 | 3300047321 | Ga0495676_0031060 | Ga0495676_0031060_2384_3352 | 276 |
| 180 | 3300048915 | Ga0496112_0184459 | Ga0496112_0184459_754_1722 | 276 |
| 181 | iso_pu_bacteria | 2738541272 | 2738694018 | 276 |
| 182 | iso_pu_bacteria | 2738543027 | 2739327397 | 276 |
| 183 | iso_pu_bacteria | 2739367654 | 2739607176 | 276 |
| 184 | iso_pu_bacteria | 2808606394 | 2809026049 | 276 |
| 185 | iso_pu_bacteria | 2816332139 | 2816508800 | 276 |
| 186 | iso_pu_bacteria | 2867346516 | 2867352317 | 276 |
| 187 | iso_pu_bacteria | 2996221748 | 2996222274 | 276 |
| 188 | iso_pu_bacteria | 8047710418 | 8047717163 | 276 |
| 189 | iso_pu_bacteria | 8056579771 | 8056579845 | 276 |
| 190 | 3300005455 | Ga0070663_100000278 | Ga0070663_1000002788 | 277 |
| 191 | 3300009176 | Ga0105242_10317164 | Ga0105242_103171642 | 277 |
| 192 | 3300026067 | Ga0207678_10000166 | Ga0207678_1000016611 | 277 |
| 193 | 3300045049 | Ga0466959_0011880 | Ga0466959_0011880_207_1169 | 277 |
| 194 | 3300049571 | Ga0501034_0004214 | Ga0501034_0004214_376_1323 | 277 |
| 195 | 3300049572 | Ga0501036_0002582 | Ga0501036_0002582_10745_11692 | 277 |
| 196 | 3300049573 | Ga0501037_0007023 | Ga0501037_0007023_2197_3144 | 277 |
| 197 | 3300049574 | Ga0501038_0002639 | Ga0501038_0002639_2503_3450 | 277 |
| 198 | 3300049575 | Ga0501039_0027635 | Ga0501039_0027635_241_1188 | 277 |
| 199 | 3300049578 | Ga0501042_0005141 | Ga0501042_0005141_5980_6927 | 277 |
| 200 | 3300049579 | Ga0501043_0003795 | Ga0501043_0003795_9964_10911 | 277 |
| 201 | 3300049582 | Ga0501048_0003800 | Ga0501048_0003800_3325_4272 | 277 |
| 202 | 3300049589 | Ga0501073_0002405 | Ga0501073_0002405_1766_2713 | 277 |
| 203 | 3300049590 | Ga0501074_0001383 | Ga0501074_0001383_2893_3840 | 277 |
| 204 | iso_pu_bacteria | 2643221566 | 2643848853 | 277 |
| 205 | iso_pu_bacteria | 2721755702 | 2723640723 | 277 |
| 206 | iso_pu_bacteria | 2867302475 | 2867303526 | 277 |
| 207 | iso_pu_bacteria | 2919443155 | 2919444073 | 277 |
| 208 | iso_pu_bacteria | 2935409751 | 2935410198 | 277 |
| 209 | iso_pu_bacteria | 8003856774 | 8003857892 | 277 |
| 210 | iso_pu_bacteria | 8045830549 | 8045834179 | 277 |
| 211 | 3300005435 | Ga0070714_100227534 | Ga0070714_1002275341 | 278 |
| 212 | 3300005456 | Ga0070678_100063940 | Ga0070678_1000639402 | 278 |
| 213 | 3300005937 | Ga0081455_10045232 | Ga0081455_100452323 | 278 |
| 214 | 3300009147 | Ga0114129_10046748 | Ga0114129_100467484 | 278 |
| 215 | 3300009765 | Ga0123341_1000059 | Ga0123341_100005916 | 278 |
| 216 | 3300009766 | Ga0123342_1020203 | Ga0123342_10202032 | 278 |
| 217 | 3300025917 | Ga0207660_10349459 | Ga0207660_103494592 | 278 |
| 218 | 3300025929 | Ga0207664_10190780 | Ga0207664_101907802 | 278 |
| 219 | 3300031548 | Ga0307408_100020696 | Ga0307408_1000206963 | 278 |
| 220 | 3300031731 | Ga0307405_10013188 | Ga0307405_100131883 | 278 |
| 221 | 3300031824 | Ga0307413_10017992 | Ga0307413_100179922 | 278 |
| 222 | 3300031852 | Ga0307410_10001236 | Ga0307410_100012367 | 278 |
| 223 | 3300031901 | Ga0307406_10022526 | Ga0307406_100225263 | 278 |
| 224 | 3300031903 | Ga0307407_10001070 | Ga0307407_100010705 | 278 |
| 225 | 3300031903 | Ga0307407_10039140 | Ga0307407_100391402 | 278 |
| 226 | 3300031995 | Ga0307409_100082241 | Ga0307409_1000822413 | 278 |
| 227 | 3300032002 | Ga0307416_100004959 | Ga0307416_1000049597 | 278 |
| 228 | 3300032002 | Ga0307416_100051376 | Ga0307416_1000513762 | 278 |
| 229 | 3300032002 | Ga0307416_100085684 | Ga0307416_1000856842 | 278 |
| 230 | 3300032126 | Ga0307415_100021129 | Ga0307415_1000211293 | 278 |
| 231 | 3300032126 | Ga0307415_100022429 | Ga0307415_1000224292 | 278 |
| 232 | 3300037418 | Ga0395900_0241201 | Ga0395900_0241201_525_1499 | 278 |
| 233 | 3300044683 | Ga0466965_0005823 | Ga0466965_0005823_1915_2862 | 278 |
| 234 | 3300050507 | nmdc:mga05p37_35924_c1 | nmdc:mga05p37_35924_c1_3000_3992 | 278 |
| 235 | 3300050512 | nmdc:mga0n895_987_c1 | nmdc:mga0n895_987_c1_16739_17731 | 278 |
| 236 | 3300050515 | nmdc:mga0a205_14642_c1 | nmdc:mga0a205_14642_c1_4454_5446 | 278 |
| 237 | 3300053139 | Ga0500568_0000742 | Ga0500568_0000742_6702_7622 | 278 |
| 238 | iso_pu_bacteria | 2751185734 | 2753071720 | 278 |
| 239 | iso_pu_bacteria | 2808606365 | 2808874950 | 278 |
| 240 | iso_pu_bacteria | 2808606447 | 2809228567 | 278 |
| 241 | iso_pu_bacteria | 2868088558 | 2868094236 | 278 |
| 242 | iso_pu_bacteria | 2870721527 | 2870722840 | 278 |
| 243 | iso_pu_bacteria | 8056054917 | 8056057600 | 278 |
| 244 | iso_pu_bacteria | 8056054917 | 8056058402 | 278 |
| 245 | 3300005329 | Ga0070683_100000882 | Ga0070683_1000008827 | 279 |
| 246 | 3300005329 | Ga0070683_100105705 | Ga0070683_1001057052 | 279 |
| 247 | 3300005336 | Ga0070680_100096116 | Ga0070680_1000961162 | 279 |
| 248 | 3300005434 | Ga0070709_10176209 | Ga0070709_101762091 | 279 |
| 249 | 3300005436 | Ga0070713_100135816 | Ga0070713_1001358162 | 279 |
| 250 | 3300005458 | Ga0070681_10039137 | Ga0070681_100391373 | 279 |
| 251 | 3300005530 | Ga0070679_100032656 | Ga0070679_1000326564 | 279 |
| 252 | 3300005530 | Ga0070679_100064633 | Ga0070679_1000646332 | 279 |
| 253 | 3300005535 | Ga0070684_100176787 | Ga0070684_1001767872 | 279 |
| 254 | 3300005614 | Ga0068856_100239503 | Ga0068856_1002395032 | 279 |
| 255 | 3300013102 | Ga0157371_10079321 | Ga0157371_100793212 | 279 |
| 256 | 3300013296 | Ga0157374_10283643 | Ga0157374_102836432 | 279 |
| 257 | 3300013307 | Ga0157372_10236101 | Ga0157372_102361012 | 279 |
| 258 | 3300014497 | Ga0182008_10002078 | Ga0182008_100020787 | 279 |
| 259 | 3300020082 | Ga0206353_11355273 | Ga0206353_113552732 | 279 |
| 260 | 3300025912 | Ga0207707_10043989 | Ga0207707_100439893 | 279 |
| 261 | 3300025917 | Ga0207660_10126010 | Ga0207660_101260102 | 279 |
| 262 | 3300025921 | Ga0207652_10019397 | Ga0207652_100193975 | 279 |
| 263 | 3300025921 | Ga0207652_10049243 | Ga0207652_100492432 | 279 |
| 264 | 3300025928 | Ga0207700_10312034 | Ga0207700_103120342 | 279 |
| 265 | 3300025944 | Ga0207661_10007847 | Ga0207661_100078473 | 279 |
| 266 | 3300030732 | Ga0316176_1172987 | Ga0316176_11729873 | 279 |
| 267 | 3300030732 | Ga0316176_1189152 | Ga0316176_11891522 | 279 |
| 268 | 3300030733 | Ga0314311_1040023 | Ga0314311_10400233 | 279 |
| 269 | 3300030733 | Ga0314311_1073438 | Ga0314311_10734382 | 279 |
| 270 | 3300031548 | Ga0307408_100047284 | Ga0307408_1000472843 | 279 |
| 271 | 3300031824 | Ga0307413_10004079 | Ga0307413_100040793 | 279 |
| 272 | 3300031824 | Ga0307413_10059226 | Ga0307413_100592262 | 279 |
| 273 | 3300031852 | Ga0307410_10008801 | Ga0307410_100088012 | 279 |
| 274 | 3300031852 | Ga0307410_10022119 | Ga0307410_100221193 | 279 |
| 275 | 3300031911 | Ga0307412_10101953 | Ga0307412_101019532 | 279 |
| 276 | 3300031995 | Ga0307409_100011584 | Ga0307409_1000115844 | 279 |
| 277 | 3300031995 | Ga0307409_100187481 | Ga0307409_1001874812 | 279 |
| 278 | 3300031995 | Ga0307409_100305770 | Ga0307409_1003057702 | 279 |
| 279 | 3300032002 | Ga0307416_100223997 | Ga0307416_1002239972 | 279 |
| 280 | 3300032005 | Ga0307411_10186726 | Ga0307411_101867262 | 279 |
| 281 | 3300032005 | Ga0307411_10319289 | Ga0307411_103192892 | 279 |
| 282 | 3300037068 | Ga0373925_0184755 | Ga0373925_0184755_93_1043 | 279 |
| 283 | 3300037312 | Ga0395899_0026239 | Ga0395899_0026239_1589_2542 | 279 |
| 284 | 3300037418 | Ga0395900_0196649 | Ga0395900_0196649_726_1679 | 279 |
| 285 | 3300041406 | Ga0439439_0001501 | Ga0439439_0001501_3394_4377 | 279 |
| 286 | 3300041997 | Ga0439431_0030026 | Ga0439431_0030026_272_1255 | 279 |
| 287 | 3300042009 | Ga0439451_006354 | Ga0439451_006354_143_1120 | 279 |
| 288 | 3300042015 | Ga0439462_0002117 | Ga0439462_0002117_3518_4501 | 279 |
| 289 | 3300042156 | Ga0439446_0019718 | Ga0439446_0019718_503_1486 | 279 |
| 290 | 3300042435 | Ga0439434_0002507 | Ga0439434_0002507_907_1890 | 279 |
| 291 | 3300044658 | Ga0466972_0001921 | Ga0466972_0001921_1607_2560 | 279 |
| 292 | 3300044683 | Ga0466965_0002969 | Ga0466965_0002969_5145_6098 | 279 |
| 293 | 3300044694 | Ga0466963_0004047 | Ga0466963_0004047_1789_2769 | 279 |
| 294 | 3300044694 | Ga0466963_0187118 | Ga0466963_0187118_194_1174 | 279 |
| 295 | 3300044842 | Ga0466957_0047267 | Ga0466957_0047267_714_1694 | 279 |
| 296 | 3300044901 | Ga0466960_0020911 | Ga0466960_0020911_1427_2380 | 279 |
| 297 | 3300045836 | Ga0466958_0009923 | Ga0466958_0009923_2446_3426 | 279 |
| 298 | 3300045976 | Ga0466967_0045955 | Ga0466967_0045955_823_1800 | 279 |
| 299 | 3300045976 | Ga0466967_0071530 | Ga0466967_0071530_484_1470 | 279 |
| 300 | 3300045976 | Ga0466967_0126537 | Ga0466967_0126537_886_1866 | 279 |
| 301 | 3300048911 | Ga0496108_0020549 | Ga0496108_0020549_1233_2213 | 279 |
| 302 | 3300048915 | Ga0496112_0104518 | Ga0496112_0104518_771_1751 | 279 |
| 303 | 3300048916 | Ga0496113_0440471 | Ga0496113_0440471_11_988 | 279 |
| 304 | 3300048923 | Ga0496120_0031436 | Ga0496120_0031436_1201_2262 | 279 |
| 305 | 3300049571 | Ga0501034_0005763 | Ga0501034_0005763_2400_3380 | 279 |
| 306 | 3300049573 | Ga0501037_0011660 | Ga0501037_0011660_3363_4316 | 279 |
| 307 | 3300049574 | Ga0501038_0220437 | Ga0501038_0220437_544_1497 | 279 |
| 308 | 3300049579 | Ga0501043_0119822 | Ga0501043_0119822_611_1549 | 279 |
| 309 | 3300049583 | Ga0501067_0009741 | Ga0501067_0009741_1825_2802 | 279 |
| 310 | 3300049583 | Ga0501067_0023660 | Ga0501067_0023660_1724_2704 | 279 |
| 311 | 3300049585 | Ga0501069_0091185 | Ga0501069_0091185_665_1642 | 279 |
| 312 | 3300049586 | Ga0501070_0162154 | Ga0501070_0162154_476_1429 | 279 |
| 313 | 3300049589 | Ga0501073_0006475 | Ga0501073_0006475_6335_7315 | 279 |
| 314 | 3300049590 | Ga0501074_0008483 | Ga0501074_0008483_2201_3181 | 279 |
| 315 | 3300049742 | Ga0501080_0005330 | Ga0501080_0005330_886_1866 | 279 |
| 316 | 3300049823 | Ga0501044_0075853 | Ga0501044_0075853_953_1906 | 279 |
| 317 | 3300053130 | Ga0500642_0011785 | Ga0500642_0011785_1692_2633 | 279 |
| 318 | 3300053146 | Ga0500588_0001406 | Ga0500588_0001406_1298_2263 | 279 |
| 319 | 3300061719 | Ga0466962_0164657 | Ga0466962_0164657_41_1018 | 279 |
| 320 | iso_pu_bacteria | 2558860280 | 2559425395 | 279 |
| 321 | iso_pu_bacteria | 2811994872 | 2812325464 | 279 |
| 322 | iso_pu_bacteria | 2857720070 | 2857721434 | 279 |
| 323 | iso_pu_bacteria | 2857729791 | 2857732880 | 279 |
| 324 | iso_pu_bacteria | 2862705112 | 2862710556 | 279 |
| 325 | iso_pu_bacteria | 2867346516 | 2867348464 | 279 |
| 326 | iso_pu_bacteria | 2906799679 | 2906800012 | 279 |
| 327 | iso_pu_bacteria | 2928121344 | 2928123958 | 279 |
| 328 | iso_pu_bacteria | 2984580707 | 2984583512 | 279 |
| 329 | iso_pu_bacteria | 8008485437 | 8008490626 | 279 |
| 330 | iso_pu_bacteria | 8025524527 | 8025525714 | 279 |
| 331 | 3300005327 | Ga0070658_10083098 | Ga0070658_100830982 | 280 |
| 332 | 3300005347 | Ga0070668_100007262 | Ga0070668_1000072623 | 280 |
| 333 | 3300006058 | Ga0075432_10000222 | Ga0075432_100002226 | 280 |
| 334 | 3300025972 | Ga0207668_10164995 | Ga0207668_101649952 | 280 |
| 335 | 3300027907 | Ga0207428_10032916 | Ga0207428_100329164 | 280 |
| 336 | 3300039062 | Ga0400483_091492 | Ga0400483_091492_88_1065 | 280 |
| 337 | 3300047320 | Ga0495672_0037147 | Ga0495672_0037147_1681_2604 | 280 |
| 338 | 3300048921 | Ga0496118_0156851 | Ga0496118_0156851_299_1228 | 280 |
| 339 | 3300049570 | Ga0501033_0027543 | Ga0501033_0027543_1838_2779 | 280 |
| 340 | 3300049570 | Ga0501033_0036631 | Ga0501033_0036631_2004_2927 | 280 |
| 341 | 3300049572 | Ga0501036_0155354 | Ga0501036_0155354_865_1788 | 280 |
| 342 | 3300049573 | Ga0501037_0064035 | Ga0501037_0064035_941_1915 | 280 |
| 343 | 3300049579 | Ga0501043_0293199 | Ga0501043_0293199_221_1183 | 280 |
| 344 | 3300049744 | Ga0501083_0000019 | Ga0501083_0000019_17022_17954 | 280 |
| 345 | 3300049823 | Ga0501044_0024180 | Ga0501044_0024180_913_1887 | 280 |
| 346 | 3300053177 | Ga0500636_0009533 | Ga0500636_0009533_1605_2525 | 280 |
| 347 | iso_pu_bacteria | 2515154155 | 2515856070 | 280 |
| 348 | iso_pu_bacteria | 2758568522 | 2760304915 | 280 |
| 349 | iso_pu_bacteria | 2758568621 | 2760621252 | 280 |
| 350 | iso_pu_bacteria | 2758568621 | 2760623481 | 280 |
| 351 | iso_pu_bacteria | 2773857759 | 2774382157 | 280 |
| 352 | iso_pu_bacteria | 2837268691 | 2837270891 | 280 |
| 353 | iso_pu_bacteria | 2837268691 | 2837272475 | 280 |
| 354 | iso_pu_bacteria | 2848551377 | 2848553896 | 280 |
| 355 | 3300013250 | Ga0171462_1004 | Ga0171462_1004589 | 281 |
| 356 | 3300013308 | Ga0157375_10269392 | Ga0157375_102693922 | 281 |
| 357 | 3300030522 | Ga0307512_10005080 | Ga0307512_100050801 | 281 |
| 358 | 3300031901 | Ga0307406_10073391 | Ga0307406_100733912 | 281 |
| 359 | 3300031901 | Ga0307406_10167552 | Ga0307406_101675521 | 281 |
| 360 | 3300031903 | Ga0307407_10236808 | Ga0307407_102368082 | 281 |
| 361 | 3300041404 | Ga0439436_0000683 | Ga0439436_0000683_858_1811 | 281 |
| 362 | 3300041413 | Ga0439465_0043928 | Ga0439465_0043928_470_1423 | 281 |
| 363 | 3300041999 | Ga0439433_0000729 | Ga0439433_0000729_4637_5590 | 281 |
| 364 | 3300042007 | Ga0439449_0008433 | Ga0439449_0008433_1514_2467 | 281 |
| 365 | 3300042014 | Ga0439457_028029 | Ga0439457_028029_112_1065 | 281 |
| 366 | 3300048922 | Ga0496119_0002468 | Ga0496119_0002468_1457_2383 | 281 |
| 367 | 3300049570 | Ga0501033_0066468 | Ga0501033_0066468_533_1474 | 281 |
| 368 | 3300049571 | Ga0501034_0010113 | Ga0501034_0010113_4514_5455 | 281 |
| 369 | 3300049579 | Ga0501043_0058798 | Ga0501043_0058798_1661_2602 | 281 |
| 370 | 3300049586 | Ga0501070_0008293 | Ga0501070_0008293_7386_8372 | 281 |
| 371 | 3300049586 | Ga0501070_0253599 | Ga0501070_0253599_438_1379 | 281 |
| 372 | 3300049588 | Ga0501072_0007590 | Ga0501072_0007590_4835_5821 | 281 |
| 373 | 3300049590 | Ga0501074_0049266 | Ga0501074_0049266_1150_2136 | 281 |
| 374 | 3300049742 | Ga0501080_0195571 | Ga0501080_0195571_501_1487 | 281 |
| 375 | 3300049744 | Ga0501083_0000558 | Ga0501083_0000558_2405_3391 | 281 |
| 376 | 3300049822 | Ga0501035_0066759 | Ga0501035_0066759_1197_2138 | 281 |
| 377 | 3300049823 | Ga0501044_0030914 | Ga0501044_0030914_3018_3959 | 281 |
| 378 | 3300060353 | Ga0501082_0094460 | Ga0501082_0094460_383_1369 | 281 |
| 379 | iso_pu_bacteria | 2811994880 | 2812363879 | 281 |
| 380 | iso_pu_bacteria | 2837268691 | 2837274862 | 281 |
| 381 | iso_pu_bacteria | 2884994152 | 2884996978 | 281 |
| 382 | iso_pu_bacteria | 2990088156 | 2990094486 | 281 |
| 383 | 3300006038 | Ga0075365_10000802 | Ga0075365_100008024 | 282 |
| 384 | 3300006051 | Ga0075364_10009781 | Ga0075364_100097815 | 282 |
| 385 | 3300006948 | Ga0099826_10116643 | Ga0099826_101166432 | 282 |
| 386 | 3300025898 | Ga0207692_10001908 | Ga0207692_100019084 | 282 |
| 387 | 3300041459 | Ga0451800_0408773 | Ga0451800_0408773_58_1011 | 282 |
| 388 | 3300044658 | Ga0466972_0046832 | Ga0466972_0046832_347_1300 | 282 |
| 389 | 3300044683 | Ga0466965_0002706 | Ga0466965_0002706_5142_6095 | 282 |
| 390 | 3300044683 | Ga0466965_0003150 | Ga0466965_0003150_1591_2544 | 282 |
| 391 | 3300044693 | Ga0466961_0030055 | Ga0466961_0030055_2456_3418 | 282 |
| 392 | 3300044765 | Ga0466970_0007827 | Ga0466970_0007827_3035_3997 | 282 |
| 393 | 3300046462 | Ga0495651_0010267 | Ga0495651_0010267_2578_3582 | 282 |
| 394 | 3300046463 | Ga0495653_0010508 | Ga0495653_0010508_2384_3388 | 282 |
| 395 | 3300046476 | Ga0495662_0000888 | Ga0495662_0000888_12869_13873 | 282 |
| 396 | 3300046477 | Ga0495664_0007517 | Ga0495664_0007517_3602_4606 | 282 |
| 397 | 3300046511 | Ga0495608_0007841 | Ga0495608_0007841_2314_3318 | 282 |
| 398 | 3300046516 | Ga0495628_0005634 | Ga0495628_0005634_8075_9079 | 282 |
| 399 | 3300046517 | Ga0495630_0064890 | Ga0495630_0064890_323_1327 | 282 |
| 400 | 3300046526 | Ga0495666_0005974 | Ga0495666_0005974_4692_5696 | 282 |
| 401 | 3300046529 | Ga0495652_0017084 | Ga0495652_0017084_1883_2887 | 282 |
| 402 | 3300046531 | Ga0495665_0001299 | Ga0495665_0001299_11843_12847 | 282 |
| 403 | 3300046533 | Ga0495640_0001598 | Ga0495640_0001598_16447_17451 | 282 |
| 404 | 3300046535 | Ga0495586_0042887 | Ga0495586_0042887_747_1751 | 282 |
| 405 | 3300046559 | Ga0495667_0006995 | Ga0495667_0006995_4134_5138 | 282 |
| 406 | 3300046663 | Ga0495635_0032471 | Ga0495635_0032471_282_1286 | 282 |
| 407 | 3300046675 | Ga0495657_0000779 | Ga0495657_0000779_2328_3332 | 282 |
| 408 | 3300046678 | Ga0495599_0008391 | Ga0495599_0008391_1417_2421 | 282 |
| 409 | 3300046680 | Ga0495646_0107077 | Ga0495646_0107077_24_1028 | 282 |
| 410 | 3300046689 | Ga0495613_0001340 | Ga0495613_0001340_15428_16432 | 282 |
| 411 | 3300046809 | Ga0495600_0009498 | Ga0495600_0009498_1417_2421 | 282 |
| 412 | 3300047317 | Ga0495604_0000995 | Ga0495604_0000995_2335_3339 | 282 |
| 413 | 3300047444 | Ga0495675_0004875 | Ga0495675_0004875_2339_3343 | 282 |
| 414 | 3300047471 | Ga0495684_0039034 | Ga0495684_0039034_2314_3318 | 282 |
| 415 | 3300048088 | Ga0495602_0025227 | Ga0495602_0025227_2388_3392 | 282 |
| 416 | 3300048922 | Ga0496119_0000533 | Ga0496119_0000533_5086_6030 | 282 |
| 417 | 3300048923 | Ga0496120_0011887 | Ga0496120_0011887_4997_5941 | 282 |
| 418 | 3300048924 | Ga0496121_0000015 | Ga0496121_0000015_448587_449531 | 282 |
| 419 | 3300049587 | Ga0501071_0208364 | Ga0501071_0208364_168_1121 | 282 |
| 420 | 3300050491 | nmdc:mga00v17_5185_c1 | nmdc:mga00v17_5185_c1_3551_4504 | 282 |
| 421 | 3300050491 | nmdc:mga00v17_93544_c1 | nmdc:mga00v17_93544_c1_260_1321 | 282 |
| 422 | 3300050492 | nmdc:mga0yw44_6554_c1 | nmdc:mga0yw44_6554_c1_900_1853 | 282 |
| 423 | 3300053085 | Ga0495619_0013668 | Ga0495619_0013668_514_1518 | 282 |
| 424 | 3300053108 | Ga0500562_000853 | Ga0500562_000853_1931_2884 | 282 |
| 425 | iso_pu_bacteria | 2643221690 | 2644505429 | 282 |
| 426 | iso_pu_bacteria | 2643221694 | 2644524770 | 282 |
| 427 | iso_pu_bacteria | 2643221722 | 2644668858 | 282 |
| 428 | iso_pu_bacteria | 2758568522 | 2760306156 | 282 |
| 429 | iso_pu_bacteria | 2895660088 | 2895662621 | 282 |
| 430 | 3300014497 | Ga0182008_10092721 | Ga0182008_100927212 | 283 |
| 431 | 3300025916 | Ga0207663_10283782 | Ga0207663_102837822 | 283 |
| 432 | 3300048925 | Ga0496122_0160474 | Ga0496122_0160474_426_1358 | 283 |
| 433 | 3300048927 | Ga0496124_0019651 | Ga0496124_0019651_3395_4327 | 283 |
| 434 | 3300053153 | Ga0500616_0000384 | Ga0500616_0000384_12907_13833 | 283 |
| 435 | 3300059491 | Ga0587070_014117 | Ga0587070_014117_20_976 | 283 |
| 436 | 3300059492 | Ga0587073_0002778 | Ga0587073_0002778_21_977 | 283 |
| 437 | 3300059493 | Ga0587077_003123 | Ga0587077_003123_334_1290 | 283 |
| 438 | 3300059505 | Ga0587083_0002276 | Ga0587083_0002276_47_1003 | 283 |
| 439 | 3300059512 | Ga0587092_003139 | Ga0587092_003139_825_1781 | 283 |
| 440 | 3300059623 | Ga0587101_000801 | Ga0587101_000801_1310_2266 | 283 |
| 441 | 3300059640 | Ga0587067_002917 | Ga0587067_002917_1009_1965 | 283 |
| 442 | iso_pu_bacteria | 2808606372 | 2808899586 | 283 |
| 443 | iso_pu_bacteria | 2816332119 | 2816427604 | 283 |
| 444 | iso_pu_bacteria | 2945968032 | 2945970989 | 283 |
| 445 | iso_pu_bacteria | 8046352972 | 8046355198 | 283 |
| 446 | 3300003544 | Ga0007417J51691_1081063 | Ga0007417J51691_10810631 | 284 |
| 447 | 3300003574 | Ga0007410J51695_1031054 | Ga0007410J51695_10310542 | 284 |
| 448 | 3300003579 | Ga0007429J51699_1057706 | Ga0007429J51699_10577062 | 284 |
| 449 | 3300003693 | Ga0032354_1073790 | Ga0032354_10737902 | 284 |
| 450 | 3300003735 | Ga0006780_1026334 | Ga0006780_10263342 | 284 |
| 451 | 3300005985 | Ga0081539_10002019 | Ga0081539_1000201918 | 284 |
| 452 | 3300006847 | Ga0075431_100018665 | Ga0075431_1000186654 | 284 |
| 453 | 3300031889 | Ga0326468_10000014 | Ga0326468_100000145 | 284 |
| 454 | 3300037312 | Ga0395899_0034783 | Ga0395899_0034783_1771_2715 | 284 |
| 455 | 3300037418 | Ga0395900_0213790 | Ga0395900_0213790_983_1927 | 284 |
| 456 | 3300037466 | Ga0395898_0026693 | Ga0395898_0026693_1273_2217 | 284 |
| 457 | 3300038443 | Ga0395901_0017791 | Ga0395901_0017791_5324_6268 | 284 |
| 458 | 3300038443 | Ga0395901_0645952 | Ga0395901_0645952_101_1045 | 284 |
| 459 | 3300041512 | Ga0451853_2589370 | Ga0451853_2589370_374_1318 | 284 |
| 460 | 3300044735 | Ga0466968_0018202 | Ga0466968_0018202_1610_2644 | 284 |
| 461 | 3300046463 | Ga0495653_0017174 | Ga0495653_0017174_3748_4704 | 284 |
| 462 | 3300049568 | Ga0501031_0000112 | Ga0501031_0000112_8529_9485 | 284 |
| 463 | 3300049569 | Ga0501032_0014569 | Ga0501032_0014569_2878_3834 | 284 |
| 464 | 3300049570 | Ga0501033_0002294 | Ga0501033_0002294_502_1458 | 284 |
| 465 | 3300049571 | Ga0501034_0037972 | Ga0501034_0037972_2496_3452 | 284 |
| 466 | 3300049572 | Ga0501036_0001867 | Ga0501036_0001867_2426_3382 | 284 |
| 467 | 3300049573 | Ga0501037_0030276 | Ga0501037_0030276_1554_2510 | 284 |
| 468 | 3300049574 | Ga0501038_0007160 | Ga0501038_0007160_6476_7432 | 284 |
| 469 | 3300049575 | Ga0501039_0000369 | Ga0501039_0000369_30582_31538 | 284 |
| 470 | 3300049576 | Ga0501040_0030288 | Ga0501040_0030288_916_1872 | 284 |
| 471 | 3300049578 | Ga0501042_0173918 | Ga0501042_0173918_17_973 | 284 |
| 472 | 3300049579 | Ga0501043_0000679 | Ga0501043_0000679_9208_10164 | 284 |
| 473 | 3300049580 | Ga0501046_0000230 | Ga0501046_0000230_53832_54788 | 284 |
| 474 | 3300049581 | Ga0501047_0002902 | Ga0501047_0002902_2548_3504 | 284 |
| 475 | 3300049582 | Ga0501048_0000713 | Ga0501048_0000713_9104_10060 | 284 |
| 476 | 3300049583 | Ga0501067_0025109 | Ga0501067_0025109_745_1701 | 284 |
| 477 | 3300049585 | Ga0501069_0001968 | Ga0501069_0001968_2306_3262 | 284 |
| 478 | 3300049586 | Ga0501070_0000838 | Ga0501070_0000838_11953_12909 | 284 |
| 479 | 3300049587 | Ga0501071_0236294 | Ga0501071_0236294_314_1270 | 284 |
| 480 | 3300049589 | Ga0501073_0025766 | Ga0501073_0025766_1734_2690 | 284 |
| 481 | 3300049590 | Ga0501074_0070939 | Ga0501074_0070939_1491_2447 | 284 |
| 482 | 3300049742 | Ga0501080_0000870 | Ga0501080_0000870_12622_13578 | 284 |
| 483 | 3300049744 | Ga0501083_0076248 | Ga0501083_0076248_756_1712 | 284 |
| 484 | 3300049822 | Ga0501035_0010851 | Ga0501035_0010851_1607_2563 | 284 |
| 485 | 3300049822 | Ga0501035_0244145 | Ga0501035_0244145_67_1041 | 284 |
| 486 | 3300049823 | Ga0501044_0031624 | Ga0501044_0031624_2879_3835 | 284 |
| 487 | 3300050510 | nmdc:mga06r32_47408_c1 | nmdc:mga06r32_47408_c1_2965_3954 | 284 |
| 488 | 3300054114 | Ga0501084_0007981 | Ga0501084_0007981_5263_6219 | 284 |
| 489 | 3300059491 | Ga0587070_010517 | Ga0587070_010517_390_1346 | 284 |
| 490 | 3300059492 | Ga0587073_0002528 | Ga0587073_0002528_1365_2321 | 284 |
| 491 | 3300059504 | Ga0587082_000911 | Ga0587082_000911_641_1597 | 284 |
| 492 | 3300059505 | Ga0587083_0002815 | Ga0587083_0002815_43_999 | 284 |
| 493 | 3300059511 | Ga0587091_001408 | Ga0587091_001408_1314_2270 | 284 |
| 494 | 3300059512 | Ga0587092_001200 | Ga0587092_001200_272_1228 | 284 |
| 495 | 3300059627 | Ga0587117_011500 | Ga0587117_011500_87_1043 | 284 |
| 496 | 3300059644 | Ga0587075_001649 | Ga0587075_001649_1216_2172 | 284 |
| 497 | 3300059652 | Ga0587107_002398 | Ga0587107_002398_21_977 | 284 |
| 498 | iso_pu_bacteria | 2690315906 | 2691515253 | 284 |
| 499 | iso_pu_bacteria | 2728369276 | 2729907432 | 284 |
| 500 | iso_pu_bacteria | 2775506735 | 2775655702 | 284 |
| 501 | iso_pu_bacteria | 2808606357 | 2808828435 | 284 |
| 502 | iso_pu_bacteria | 2808606360 | 2808849675 | 284 |
| 503 | iso_pu_bacteria | 2808606366 | 2808877728 | 284 |
| 504 | iso_pu_bacteria | 2808606370 | 2808892656 | 284 |
| 505 | iso_pu_bacteria | 2808606371 | 2808899181 | 284 |
| 506 | iso_pu_bacteria | 2811994871 | 2812319854 | 284 |
| 507 | iso_pu_bacteria | 2833709550 | 2833712784 | 284 |
| 508 | iso_pu_bacteria | 2857729791 | 2857732069 | 284 |
| 509 | iso_pu_bacteria | 2857740372 | 2857742287 | 284 |
| 510 | iso_pu_bacteria | 2904497146 | 2904500545 | 284 |
| 511 | iso_pu_bacteria | 2904776348 | 2904777207 | 284 |
| 512 | iso_pu_bacteria | 2910809715 | 2910814348 | 284 |
| 513 | iso_pu_bacteria | 2919034639 | 2919038274 | 284 |
| 514 | iso_pu_bacteria | 2919059106 | 2919059182 | 284 |
| 515 | iso_pu_bacteria | 2919538618 | 2919541212 | 284 |
| 516 | iso_pu_bacteria | 2928121344 | 2928124068 | 284 |
| 517 | iso_pu_bacteria | 2932426870 | 2932427364 | 284 |
| 518 | iso_pu_bacteria | 2933418574 | 2933420880 | 284 |
| 519 | iso_pu_bacteria | 2939598168 | 2939602437 | 284 |
| 520 | iso_pu_bacteria | 2939647034 | 2939650420 | 284 |
| 521 | iso_pu_bacteria | 2939674588 | 2939676781 | 284 |
| 522 | iso_pu_bacteria | 2945916053 | 2945917597 | 284 |
| 523 | iso_pu_bacteria | 2945920336 | 2945922116 | 284 |
| 524 | iso_pu_bacteria | 2945941187 | 2945941728 | 284 |
| 525 | iso_pu_bacteria | 2946037020 | 2946037632 | 284 |
| 526 | iso_pu_bacteria | 2946059875 | 2946061425 | 284 |
| 527 | iso_pu_bacteria | 2953998280 | 2953998905 | 284 |
| 528 | iso_pu_bacteria | 2974302888 | 2974305659 | 284 |
| 529 | iso_pu_bacteria | 8054107350 | 8054109681 | 284 |
| 530 | iso_pu_bacteria | 8056579771 | 8056583733 | 284 |
| 531 | 3300003203 | JGI25406J46586_10004063 | JGI25406J46586_100040636 | 285 |
| 532 | 3300003373 | JGI25407J50210_10005774 | JGI25407J50210_100057743 | 285 |
| 533 | 3300005981 | Ga0081538_10000050 | Ga0081538_1000005042 | 285 |
| 534 | 3300005985 | Ga0081539_10003375 | Ga0081539_100033759 | 285 |
| 535 | 3300031824 | Ga0307413_10166355 | Ga0307413_101663552 | 285 |
| 536 | 3300032002 | Ga0307416_100163213 | Ga0307416_1001632132 | 285 |
| 537 | 3300041404 | Ga0439436_0010657 | Ga0439436_0010657_594_1517 | 285 |
| 538 | 3300042002 | Ga0439442_007444 | Ga0439442_007444_542_1465 | 285 |
| 539 | 3300042007 | Ga0439449_0008676 | Ga0439449_0008676_652_1575 | 285 |
| 540 | 3300042014 | Ga0439457_003241 | Ga0439457_003241_3262_4185 | 285 |
| 541 | 3300044684 | Ga0466966_0080996 | Ga0466966_0080996_806_1789 | 285 |
| 542 | 3300044765 | Ga0466970_0056039 | Ga0466970_0056039_559_1524 | 285 |
| 543 | 3300045976 | Ga0466967_0483565 | Ga0466967_0483565_209_1174 | 285 |
| 544 | 3300048904 | Ga0496101_0083830 | Ga0496101_0083830_785_1762 | 285 |
| 545 | 3300048917 | Ga0496114_0040127 | Ga0496114_0040127_2654_3631 | 285 |
| 546 | 3300049570 | Ga0501033_0027059 | Ga0501033_0027059_1674_2615 | 285 |
| 547 | 3300049581 | Ga0501047_0344354 | Ga0501047_0344354_232_1173 | 285 |
| 548 | 3300049744 | Ga0501083_0012760 | Ga0501083_0012760_2069_3010 | 285 |
| 549 | 3300053151 | Ga0500604_0010602 | Ga0500604_0010602_934_1869 | 285 |
| 550 | 3300053153 | Ga0500616_0003567 | Ga0500616_0003567_6228_7163 | 285 |
| 551 | iso_pu_bacteria | 2739367654 | 2739608761 | 285 |
| 552 | iso_pu_bacteria | 2808606394 | 2809030256 | 285 |
| 553 | iso_pu_bacteria | 2816332119 | 2816421413 | 285 |
| 554 | iso_pu_bacteria | 8056060235 | 8056064585 | 285 |
| 555 | 3300003203 | JGI25406J46586_10009823 | JGI25406J46586_100098233 | 286 |
| 556 | 3300005985 | Ga0081539_10000057 | Ga0081539_10000057200 | 286 |
| 557 | 3300013105 | Ga0157369_10026207 | Ga0157369_100262073 | 286 |
| 558 | 3300013105 | Ga0157369_10402858 | Ga0157369_104028582 | 286 |
| 559 | 3300027876 | Ga0209974_10041971 | Ga0209974_100419711 | 286 |
| 560 | 3300037312 | Ga0395899_0022179 | Ga0395899_0022179_3843_4793 | 286 |
| 561 | 3300037312 | Ga0395899_0027135 | Ga0395899_0027135_2216_3157 | 286 |
| 562 | 3300037418 | Ga0395900_0008527 | Ga0395900_0008527_7660_8610 | 286 |
| 563 | 3300037466 | Ga0395898_0035644 | Ga0395898_0035644_410_1351 | 286 |
| 564 | 3300037466 | Ga0395898_0048677 | Ga0395898_0048677_2148_3098 | 286 |
| 565 | 3300037471 | Ga0395905_0061834 | Ga0395905_0061834_1784_2734 | 286 |
| 566 | 3300038443 | Ga0395901_0074737 | Ga0395901_0074737_1453_2394 | 286 |
| 567 | 3300046542 | Ga0495597_0049274 | Ga0495597_0049274_806_1762 | 286 |
| 568 | 3300048917 | Ga0496114_0012605 | Ga0496114_0012605_5310_6287 | 286 |
| 569 | 3300048918 | Ga0496115_0034821 | Ga0496115_0034821_2685_3662 | 286 |
| 570 | 3300049580 | Ga0501046_0011051 | Ga0501046_0011051_3490_4455 | 286 |
| 571 | 3300005337 | Ga0070682_100061657 | Ga0070682_1000616572 | 287 |
| 572 | 3300005937 | Ga0081455_10000737 | Ga0081455_1000073725 | 287 |
| 573 | 3300005937 | Ga0081455_10017573 | Ga0081455_100175735 | 287 |
| 574 | 3300005937 | Ga0081455_10026568 | Ga0081455_100265685 | 287 |
| 575 | 3300005937 | Ga0081455_10035417 | Ga0081455_100354173 | 287 |
| 576 | 3300005937 | Ga0081455_10040335 | Ga0081455_100403354 | 287 |
| 577 | 3300005985 | Ga0081539_10042400 | Ga0081539_100424002 | 287 |
| 578 | 3300006058 | Ga0075432_10000007 | Ga0075432_100000072 | 287 |
| 579 | 3300006844 | Ga0075428_100046304 | Ga0075428_1000463043 | 287 |
| 580 | 3300006844 | Ga0075428_100065149 | Ga0075428_1000651493 | 287 |
| 581 | 3300006846 | Ga0075430_100406290 | Ga0075430_1004062902 | 287 |
| 582 | 3300006847 | Ga0075431_100139831 | Ga0075431_1001398312 | 287 |
| 583 | 3300006852 | Ga0075433_10006291 | Ga0075433_100062912 | 287 |
| 584 | 3300006871 | Ga0075434_100000163 | Ga0075434_1000001634 | 287 |
| 585 | 3300006871 | Ga0075434_100072255 | Ga0075434_1000722552 | 287 |
| 586 | 3300006914 | Ga0075436_100001036 | Ga0075436_1000010362 | 287 |
| 587 | 3300007076 | Ga0075435_100001686 | Ga0075435_1000016862 | 287 |
| 588 | 3300009094 | Ga0111539_10000078 | Ga0111539_1000007890 | 287 |
| 589 | 3300009094 | Ga0111539_10031641 | Ga0111539_100316412 | 287 |
| 590 | 3300009094 | Ga0111539_10093908 | Ga0111539_100939082 | 287 |
| 591 | 3300009147 | Ga0114129_10075130 | Ga0114129_100751303 | 287 |
| 592 | 3300009147 | Ga0114129_10222741 | Ga0114129_102227412 | 287 |
| 593 | 3300009176 | Ga0105242_10386668 | Ga0105242_103866681 | 287 |
| 594 | 3300010375 | Ga0105239_10225290 | Ga0105239_102252902 | 287 |
| 595 | 3300025901 | Ga0207688_10051785 | Ga0207688_100517853 | 287 |
| 596 | 3300027907 | Ga0207428_10000662 | Ga0207428_100006622 | 287 |
| 597 | 3300027907 | Ga0207428_10006298 | Ga0207428_100062988 | 287 |
| 598 | 3300027907 | Ga0207428_10088416 | Ga0207428_100884161 | 287 |
| 599 | 3300031548 | Ga0307408_100002815 | Ga0307408_1000028152 | 287 |
| 600 | 3300031548 | Ga0307408_100043234 | Ga0307408_1000432343 | 287 |
| 601 | 3300031731 | Ga0307405_10016478 | Ga0307405_100164783 | 287 |
| 602 | 3300031731 | Ga0307405_10045587 | Ga0307405_100455872 | 287 |
| 603 | 3300031852 | Ga0307410_10067432 | Ga0307410_100674322 | 287 |
| 604 | 3300031852 | Ga0307410_10106889 | Ga0307410_101068891 | 287 |
| 605 | 3300031901 | Ga0307406_10000019 | Ga0307406_100000192 | 287 |
| 606 | 3300031903 | Ga0307407_10001475 | Ga0307407_100014752 | 287 |
| 607 | 3300031911 | Ga0307412_10021870 | Ga0307412_100218702 | 287 |
| 608 | 3300031911 | Ga0307412_10108712 | Ga0307412_101087121 | 287 |
| 609 | 3300031911 | Ga0307412_10308910 | Ga0307412_103089102 | 287 |
| 610 | 3300031911 | Ga0307412_10430297 | Ga0307412_104302971 | 287 |
| 611 | 3300031995 | Ga0307409_100000024 | Ga0307409_1000000249 | 287 |
| 612 | 3300032002 | Ga0307416_100000040 | Ga0307416_100000040108 | 287 |
| 613 | 3300032002 | Ga0307416_100048054 | Ga0307416_1000480543 | 287 |
| 614 | 3300032004 | Ga0307414_10042056 | Ga0307414_100420562 | 287 |
| 615 | 3300032005 | Ga0307411_10008677 | Ga0307411_100086774 | 287 |
| 616 | 3300032005 | Ga0307411_10108517 | Ga0307411_101085172 | 287 |
| 617 | 3300032126 | Ga0307415_100011198 | Ga0307415_1000111984 | 287 |
| 618 | 3300032126 | Ga0307415_100066323 | Ga0307415_1000663232 | 287 |
| 619 | 3300042016 | Ga0439463_003841 | Ga0439463_003841_308_1264 | 287 |
| 620 | 3300042437 | Ga0439444_0004741 | Ga0439444_0004741_967_1923 | 287 |
| 621 | 3300044683 | Ga0466965_0000019 | Ga0466965_0000019_2679_3614 | 287 |
| 622 | 3300049569 | Ga0501032_0027505 | Ga0501032_0027505_1328_2263 | 287 |
| 623 | 3300049569 | Ga0501032_0102303 | Ga0501032_0102303_225_1160 | 287 |
| 624 | 3300049570 | Ga0501033_0034953 | Ga0501033_0034953_2768_3703 | 287 |
| 625 | 3300049570 | Ga0501033_0065927 | Ga0501033_0065927_1049_1984 | 287 |
| 626 | 3300049571 | Ga0501034_0038852 | Ga0501034_0038852_975_1910 | 287 |
| 627 | 3300049571 | Ga0501034_0080887 | Ga0501034_0080887_163_1098 | 287 |
| 628 | 3300049571 | Ga0501034_0224328 | Ga0501034_0224328_420_1355 | 287 |
| 629 | 3300049573 | Ga0501037_0014339 | Ga0501037_0014339_1495_2430 | 287 |
| 630 | 3300049574 | Ga0501038_0101199 | Ga0501038_0101199_1425_2360 | 287 |
| 631 | 3300049574 | Ga0501038_0124605 | Ga0501038_0124605_72_1007 | 287 |
| 632 | 3300049575 | Ga0501039_0052534 | Ga0501039_0052534_280_1215 | 287 |
| 633 | 3300049579 | Ga0501043_0061837 | Ga0501043_0061837_411_1397 | 287 |
| 634 | 3300049579 | Ga0501043_0092421 | Ga0501043_0092421_1098_2033 | 287 |
| 635 | 3300049581 | Ga0501047_0023386 | Ga0501047_0023386_298_1284 | 287 |
| 636 | 3300049581 | Ga0501047_0137918 | Ga0501047_0137918_274_1209 | 287 |
| 637 | 3300049581 | Ga0501047_0369025 | Ga0501047_0369025_68_1003 | 287 |
| 638 | 3300049583 | Ga0501067_0184274 | Ga0501067_0184274_57_992 | 287 |
| 639 | 3300049589 | Ga0501073_0180741 | Ga0501073_0180741_92_1027 | 287 |
| 640 | 3300049675 | Ga0501243_001947 | Ga0501243_001947_1540_2496 | 287 |
| 641 | 3300049822 | Ga0501035_0005907 | Ga0501035_0005907_6811_7797 | 287 |
| 642 | 3300049851 | Ga0501212_003302 | Ga0501212_003302_419_1375 | 287 |
| 643 | 3300050507 | nmdc:mga05p37_177898_c1 | nmdc:mga05p37_177898_c1_1077_2033 | 287 |
| 644 | 3300050509 | nmdc:mga0qj67_358556_c1 | nmdc:mga0qj67_358556_c1_135_1091 | 287 |
| 645 | 3300050511 | nmdc:mga08y16_22896_c1 | nmdc:mga08y16_22896_c1_1279_2235 | 287 |
| 646 | 3300050511 | nmdc:mga08y16_73623_c1 | nmdc:mga08y16_73623_c1_1074_2030 | 287 |
| 647 | 3300050511 | nmdc:mga08y16_80833_c1 | nmdc:mga08y16_80833_c1_1419_2375 | 287 |
| 648 | 3300050512 | nmdc:mga0n895_200_c1 | nmdc:mga0n895_200_c1_2240_3196 | 287 |
| 649 | 3300050512 | nmdc:mga0n895_66676_c1 | nmdc:mga0n895_66676_c1_1412_2368 | 287 |
| 650 | 3300050512 | nmdc:mga0n895_78222_c1 | nmdc:mga0n895_78222_c1_464_1420 | 287 |
| 651 | 3300050513 | nmdc:mga0rr50_842_c1 | nmdc:mga0rr50_842_c1_12008_12964 | 287 |
| 652 | 3300050514 | nmdc:mga08x19_1049_c1 | nmdc:mga08x19_1049_c1_752_1708 | 287 |
| 653 | 3300050515 | nmdc:mga0a205_109336_c1 | nmdc:mga0a205_109336_c1_1385_2341 | 287 |
| 654 | 3300050515 | nmdc:mga0a205_116_c3 | nmdc:mga0a205_116_c3_2580_3536 | 287 |
| 655 | 3300059490 | Ga0587066_008637 | Ga0587066_008637_241_1197 | 287 |
| 656 | 3300059491 | Ga0587070_007899 | Ga0587070_007899_241_1197 | 287 |
| 657 | 3300059493 | Ga0587077_005203 | Ga0587077_005203_38_994 | 287 |
| 658 | 3300059644 | Ga0587075_003232 | Ga0587075_003232_120_1076 | 287 |
| 659 | 3300059647 | Ga0587079_005537 | Ga0587079_005537_827_1783 | 287 |
| 660 | 3300001979 | JGI24740J21852_10026220 | JGI24740J21852_100262202 | 288 |
| 661 | 3300001989 | JGI24739J22299_10016370 | JGI24739J22299_100163702 | 288 |
| 662 | 3300001990 | JGI24737J22298_10006891 | JGI24737J22298_100068913 | 288 |
| 663 | 3300002067 | JGI24735J21928_10048850 | JGI24735J21928_100488502 | 288 |
| 664 | 3300005337 | Ga0070682_100102394 | Ga0070682_1001023942 | 288 |
| 665 | 3300005347 | Ga0070668_100089555 | Ga0070668_1000895552 | 288 |
| 666 | 3300005539 | Ga0068853_100259231 | Ga0068853_1002592312 | 288 |
| 667 | 3300005577 | Ga0068857_100023416 | Ga0068857_1000234162 | 288 |
| 668 | 3300006058 | Ga0075432_10007054 | Ga0075432_100070543 | 288 |
| 669 | 3300006237 | Ga0097621_100346750 | Ga0097621_1003467501 | 288 |
| 670 | 3300009036 | Ga0105244_10011771 | Ga0105244_100117714 | 288 |
| 671 | 3300009176 | Ga0105242_10337297 | Ga0105242_103372972 | 288 |
| 672 | 3300011119 | Ga0105246_10006494 | Ga0105246_100064943 | 288 |
| 673 | 3300011119 | Ga0105246_10006584 | Ga0105246_100065842 | 288 |
| 674 | 3300011119 | Ga0105246_10019358 | Ga0105246_100193581 | 288 |
| 675 | 3300013105 | Ga0157369_10103516 | Ga0157369_101035163 | 288 |
| 676 | 3300013307 | Ga0157372_10279135 | Ga0157372_102791352 | 288 |
| 677 | 3300025303 | Ga0209051_1001809 | Ga0209051_10018093 | 288 |
| 678 | 3300025315 | Ga0207697_10004027 | Ga0207697_100040274 | 288 |
| 679 | 3300025728 | Ga0207655_1009481 | Ga0207655_10094814 | 288 |
| 680 | 3300025904 | Ga0207647_10009069 | Ga0207647_100090694 | 288 |
| 681 | 3300025932 | Ga0207690_10287722 | Ga0207690_102877221 | 288 |
| 682 | 3300025961 | Ga0207712_10423300 | Ga0207712_104233001 | 288 |
| 683 | 3300025986 | Ga0207658_10133646 | Ga0207658_101336462 | 288 |
| 684 | 3300026041 | Ga0207639_10190915 | Ga0207639_101909152 | 288 |
| 685 | 3300026067 | Ga0207678_10126680 | Ga0207678_101266802 | 288 |
| 686 | 3300026116 | Ga0207674_10049585 | Ga0207674_100495853 | 288 |
| 687 | 3300027907 | Ga0207428_10045197 | Ga0207428_100451972 | 288 |
| 688 | 3300027907 | Ga0207428_10110571 | Ga0207428_101105712 | 288 |
| 689 | 3300031456 | Ga0307513_10114752 | Ga0307513_101147523 | 288 |
| 690 | 3300031548 | Ga0307408_100001012 | Ga0307408_10000101212 | 288 |
| 691 | 3300031548 | Ga0307408_100020440 | Ga0307408_1000204403 | 288 |
| 692 | 3300031548 | Ga0307408_100080760 | Ga0307408_1000807602 | 288 |
| 693 | 3300031548 | Ga0307408_100087272 | Ga0307408_1000872722 | 288 |
| 694 | 3300031548 | Ga0307408_100125168 | Ga0307408_1001251682 | 288 |
| 695 | 3300031548 | Ga0307408_100396952 | Ga0307408_1003969521 | 288 |
| 696 | 3300031731 | Ga0307405_10020274 | Ga0307405_100202741 | 288 |
| 697 | 3300031731 | Ga0307405_10066943 | Ga0307405_100669432 | 288 |
| 698 | 3300031731 | Ga0307405_10107100 | Ga0307405_101071002 | 288 |
| 699 | 3300031731 | Ga0307405_10217141 | Ga0307405_102171412 | 288 |
| 700 | 3300031731 | Ga0307405_10274589 | Ga0307405_102745892 | 288 |
| 701 | 3300031824 | Ga0307413_10018500 | Ga0307413_100185002 | 288 |
| 702 | 3300031824 | Ga0307413_10019858 | Ga0307413_100198584 | 288 |
| 703 | 3300031824 | Ga0307413_10033541 | Ga0307413_100335413 | 288 |
| 704 | 3300031824 | Ga0307413_10141722 | Ga0307413_101417222 | 288 |
| 705 | 3300031852 | Ga0307410_10027075 | Ga0307410_100270752 | 288 |
| 706 | 3300031852 | Ga0307410_10035602 | Ga0307410_100356022 | 288 |
| 707 | 3300031852 | Ga0307410_10084852 | Ga0307410_100848521 | 288 |
| 708 | 3300031852 | Ga0307410_10088514 | Ga0307410_100885142 | 288 |
| 709 | 3300031852 | Ga0307410_10108360 | Ga0307410_101083602 | 288 |
| 710 | 3300031901 | Ga0307406_10083097 | Ga0307406_100830972 | 288 |
| 711 | 3300031901 | Ga0307406_10140767 | Ga0307406_101407672 | 288 |
| 712 | 3300031901 | Ga0307406_10231643 | Ga0307406_102316431 | 288 |
| 713 | 3300031903 | Ga0307407_10011039 | Ga0307407_100110392 | 288 |
| 714 | 3300031903 | Ga0307407_10033918 | Ga0307407_100339181 | 288 |
| 715 | 3300031903 | Ga0307407_10044386 | Ga0307407_100443863 | 288 |
| 716 | 3300031911 | Ga0307412_10001015 | Ga0307412_100010159 | 288 |
| 717 | 3300031911 | Ga0307412_10026992 | Ga0307412_100269922 | 288 |
| 718 | 3300031911 | Ga0307412_10036484 | Ga0307412_100364842 | 288 |
| 719 | 3300031911 | Ga0307412_10041593 | Ga0307412_100415932 | 288 |
| 720 | 3300031911 | Ga0307412_10136452 | Ga0307412_101364522 | 288 |
| 721 | 3300031911 | Ga0307412_10223628 | Ga0307412_102236282 | 288 |
| 722 | 3300031911 | Ga0307412_10230707 | Ga0307412_102307072 | 288 |
| 723 | 3300031911 | Ga0307412_10236276 | Ga0307412_102362762 | 288 |
| 724 | 3300031911 | Ga0307412_10252403 | Ga0307412_102524032 | 288 |
| 725 | 3300031995 | Ga0307409_100037824 | Ga0307409_1000378243 | 288 |
| 726 | 3300031995 | Ga0307409_100137952 | Ga0307409_1001379522 | 288 |
| 727 | 3300031995 | Ga0307409_100159704 | Ga0307409_1001597042 | 288 |
| 728 | 3300032002 | Ga0307416_100020331 | Ga0307416_1000203314 | 288 |
| 729 | 3300032002 | Ga0307416_100022408 | Ga0307416_1000224083 | 288 |
| 730 | 3300032002 | Ga0307416_100128287 | Ga0307416_1001282872 | 288 |
| 731 | 3300032002 | Ga0307416_100268381 | Ga0307416_1002683811 | 288 |
| 732 | 3300032005 | Ga0307411_10055609 | Ga0307411_100556091 | 288 |
| 733 | 3300032005 | Ga0307411_10093907 | Ga0307411_100939072 | 288 |
| 734 | 3300032005 | Ga0307411_10252513 | Ga0307411_102525132 | 288 |
| 735 | 3300032126 | Ga0307415_100006009 | Ga0307415_1000060093 | 288 |
| 736 | 3300032126 | Ga0307415_100035008 | Ga0307415_1000350081 | 288 |
| 737 | 3300037312 | Ga0395899_0073520 | Ga0395899_0073520_1130_2074 | 288 |
| 738 | 3300037418 | Ga0395900_0015527 | Ga0395900_0015527_5156_6100 | 288 |
| 739 | 3300037418 | Ga0395900_0053543 | Ga0395900_0053543_2130_3074 | 288 |
| 740 | 3300037466 | Ga0395898_0063855 | Ga0395898_0063855_203_1147 | 288 |
| 741 | 3300038443 | Ga0395901_0073476 | Ga0395901_0073476_993_1937 | 288 |
| 742 | 3300038443 | Ga0395901_0170079 | Ga0395901_0170079_1008_1952 | 288 |
| 743 | 3300041404 | Ga0439436_0006583 | Ga0439436_0006583_1795_2739 | 288 |
| 744 | 3300041411 | Ga0439466_0007754 | Ga0439466_0007754_2688_3632 | 288 |
| 745 | 3300041999 | Ga0439433_0000759 | Ga0439433_0000759_4238_5182 | 288 |
| 746 | 3300041999 | Ga0439433_0009460 | Ga0439433_0009460_702_1646 | 288 |
| 747 | 3300042002 | Ga0439442_000821 | Ga0439442_000821_2630_3574 | 288 |
| 748 | 3300042002 | Ga0439442_002321 | Ga0439442_002321_1603_2547 | 288 |
| 749 | 3300042002 | Ga0439442_030779 | Ga0439442_030779_123_1067 | 288 |
| 750 | 3300042007 | Ga0439449_0001548 | Ga0439449_0001548_1695_2639 | 288 |
| 751 | 3300042007 | Ga0439449_0006758 | Ga0439449_0006758_1953_2897 | 288 |
| 752 | 3300042014 | Ga0439457_004666 | Ga0439457_004666_719_1663 | 288 |
| 753 | 3300042015 | Ga0439462_0007302 | Ga0439462_0007302_1768_2712 | 288 |
| 754 | 3300042122 | Ga0450920_000660 | Ga0450920_000660_984_1928 | 288 |
| 755 | 3300042435 | Ga0439434_0072571 | Ga0439434_0072571_27_971 | 288 |
| 756 | 3300046492 | Ga0495585_0113760 | Ga0495585_0113760_433_1392 | 288 |
| 757 | 3300046615 | Ga0495656_0002387 | Ga0495656_0002387_5218_6162 | 288 |
| 758 | 3300046691 | Ga0495670_0000463 | Ga0495670_0000463_5795_6739 | 288 |
| 759 | 3300048906 | Ga0496103_0010753 | Ga0496103_0010753_3868_4821 | 288 |
| 760 | 3300048913 | Ga0496110_0499289 | Ga0496110_0499289_85_1038 | 288 |
| 761 | 3300048927 | Ga0496124_0047953 | Ga0496124_0047953_1643_2632 | 288 |
| 762 | 3300049569 | Ga0501032_0004795 | Ga0501032_0004795_7254_8198 | 288 |
| 763 | 3300049569 | Ga0501032_0006992 | Ga0501032_0006992_4825_5769 | 288 |
| 764 | 3300049571 | Ga0501034_0000042 | Ga0501034_0000042_223369_224313 | 288 |
| 765 | 3300049573 | Ga0501037_0014282 | Ga0501037_0014282_2466_3410 | 288 |
| 766 | 3300049573 | Ga0501037_0022295 | Ga0501037_0022295_1265_2209 | 288 |
| 767 | 3300049574 | Ga0501038_0090819 | Ga0501038_0090819_896_1840 | 288 |
| 768 | 3300049575 | Ga0501039_0095822 | Ga0501039_0095822_1283_2227 | 288 |
| 769 | 3300049575 | Ga0501039_0217070 | Ga0501039_0217070_246_1190 | 288 |
| 770 | 3300049579 | Ga0501043_0031651 | Ga0501043_0031651_1087_2031 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
129
356
0.82
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.6336 | 54 | 279 |
| 3rlf-assembly1.cif.gz_F | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.6305 | 54 | 272 |
| 2r6g-assembly1.cif.gz_F | the crystal structure of the e. coli maltose transporter | 0.6303 | 54 | 274 |
| 3pv0-assembly1.cif.gz_F | crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide | 0.6294 | 61 | 276 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.6054 | 25 | 276 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7318 | 62 | 285 | 1.10.3720.10 |
| af_P0DP70_1_121_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7277 | 154 | 281 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7271 | 62 | 281 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7015 | 62 | 281 | 1.10.3720.10 |
| af_P0AFR7_53_289_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.6937 | 62 | 281 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6YLF3-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9606 | 166 | 288 |
GO:0005886
GO:0055085 |
| AF-A0A059WS29-F1-model_v4 | Binding-protein-dependent transport system inner membrane component | 0.9571 | 128 | 287 |
GO:0005886
GO:0055085 |
| AF-A0A2W5HI08-F1-model_v4 | ABC transporter permease | 0.9425 | 188 | 288 |
GO:0005886
GO:0055085 |
| AF-A0A2S5VQ39-F1-model_v4 | ABC transporter permease | 0.9401 | 140 | 287 |
GO:0005886
GO:0055085 |
| AF-A0A4V1TA30-F1-model_v4 | deleted | 0.9398 | 166 | 288 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar