F480038

General Info

Members Datasets Scaffolds Average Seq Length
770 396 641 308

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10041971|Ga0209974_100419711
Length 362
Sequence VSHLGEGGSAPNIHHGKPVPNPFHGCYGTDRGTGFSPDPYREHSEVIDDMSVVTELRKTAKGAKAAPSRRGLRNGDGKAAAVFLLPWFLGLGLITIGPMIASGYLSFTDYNLLQPPQWTGLENYTRLFEDPRLLNSLRVTFTYVFTAVPLQLLAALALALILDRGLKGLPFYRSVLYLPSLLGGSVAVAILWRQVFGIDGLVNQFLALFGIQGKGWVSDPETALWTLVLLHIWTFGAPMIIFLAGLRQIPEMYYEAAAIDGAGVVRKFRSITLPLLTPIIFFNLVLQVIGAFQSFTQAFVVSGGTGGPADSTMFYTLYLYQKGFTAFDMGYASAMAWLLVLIVAVMTLINFFASKFWVFYDD

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2643221566 Microbacterium sp. Root166 Isolate Unclassified
4 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
5 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
6 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
7 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
8 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
9 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
10 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
11 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
12 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
13 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
14 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
15 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
16 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
17 2773857759 Microbacterium sp. 1294 Isolate Unclassified
18 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
19 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
20 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
21 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
22 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
23 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
24 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
25 2808606372 Agromyces sp. 23-23 Isolate Unclassified
26 2808606394 Promicromonospora sp. C35 Isolate Unclassified
27 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
28 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
29 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
30 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
31 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
32 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
33 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
34 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
35 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
36 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
37 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
38 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
39 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
40 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
41 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
42 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
43 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
44 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
45 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
46 2858882152 Micromonospora noduli MED15 Isolate Nodule
47 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
48 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
49 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
50 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
51 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
52 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
53 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
54 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
55 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
56 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
57 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
58 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
59 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
60 2891562705 Microbispora tritici MT50 Isolate Unclassified
61 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
62 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
63 2902582711 Micromonospora sp. AP08 Isolate Unclassified
64 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
65 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
66 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
67 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
68 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
69 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
70 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
71 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
72 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
73 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
74 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
75 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
76 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
77 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
78 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
79 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
80 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
81 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
82 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
83 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
84 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
85 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
86 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
87 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
88 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
89 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
90 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
91 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
92 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
93 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
94 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
95 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
96 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
97 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
98 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
99 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
100 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
102 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
103 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
104 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
105 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
109 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
110 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
111 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
112 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
115 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
116 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
117 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
122 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
123 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
124 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
128 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
129 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
130 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
131 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
132 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
133 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
134 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
135 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
136 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
137 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
138 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
139 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
140 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
141 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
142 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
145 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
147 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
148 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
149 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
150 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
151 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
152 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
153 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
154 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
155 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
156 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
157 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
159 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
161 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
164 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
168 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
169 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
170 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
171 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
172 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
173 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
174 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
175 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
214 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
215 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
239 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
247 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
248 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
251 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
254 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
255 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
256 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
257 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
275 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
276 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
310 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
318 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
352 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
353 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
354 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
355 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
356 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
357 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
361 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
364 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
365 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
366 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
367 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
368 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
385 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
386 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
387 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
388 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
389 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
390 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
391 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
392 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
393 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
394 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
395 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
396 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.48
Metatranscriptomes 3.77
Isolates 16.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.13
Bulb 0
Endosphere 2.47
Nodule 0.65
Rhizoplane 2.08
Rhizosphere 82.73
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10026220 3300001979 Bacteria 1955
2 JGI24739J22299_10016370 3300001989 Bacteria 2683
3 JGI24737J22298_10006891 3300001990 Bacteria 3856
4 JGI24735J21928_10048850 3300002067 Bacteria 1223
5 JGI25406J46586_10004063 3300003203 Bacteria 6841
6 JGI25406J46586_10009823 3300003203 Bacteria 4273
7 JGI25407J50210_10005774 3300003373 Bacteria 3056
8 Ga0007417J51691_1081063 3300003544 Bacteria 1270
9 Ga0007410J51695_1031054 3300003574 Bacteria 2430
10 Ga0007429J51699_1042823 3300003579 Bacteria 2151
11 Ga0007429J51699_1057706 3300003579 Bacteria 3141
12 Ga0032354_1048032 3300003693 Bacteria 1346
13 Ga0032354_1073790 3300003693 Bacteria 1484
14 Ga0006780_1026334 3300003735 Bacteria 2410
15 Ga0055531_10001269 3300003794 Bacteria 19111
16 Ga0055541_1004319 3300003841 Bacteria 2591
17 Ga0070658_10004384 3300005327 Bacteria 11511
18 Ga0070658_10083098 3300005327 Bacteria 2632
19 Ga0070683_100000882 3300005329 Bacteria 22251
20 Ga0070683_100077862 3300005329 Bacteria 3101
21 Ga0070683_100105705 3300005329 Bacteria 2654
22 Ga0070680_100096116 3300005336 Bacteria 2456
23 Ga0070680_100389063 3300005336 Bacteria 1188
24 Ga0070682_100061657 3300005337 Bacteria 2374
25 Ga0070682_100102394 3300005337 Bacteria 1893
26 Ga0070661_100018909 3300005344 Bacteria 4906
27 Ga0070668_100007262 3300005347 Bacteria 8215
28 Ga0070668_100089555 3300005347 Bacteria 2424
29 Ga0070674_100119227 3300005356 Unclassified 1951
30 Ga0070703_10000038 3300005406 Bacteria 65056
31 Ga0070709_10176209 3300005434 Bacteria 1498
32 Ga0070714_100227534 3300005435 Bacteria 1717
33 Ga0070713_100135816 3300005436 Bacteria 2173
34 Ga0070710_10011350 3300005437 Bacteria 4402
35 Ga0070705_100039424 3300005440 Bacteria 2680
36 Ga0070705_100091684 3300005440 Bacteria 1895
37 Ga0070694_100175413 3300005444 Bacteria 1582
38 Ga0070708_100001328 3300005445 Bacteria 18924
39 Ga0070708_100021086 3300005445 Bacteria 5503
40 Ga0070708_100370467 3300005445 Bacteria 1350
41 Ga0070663_100000278 3300005455 Bacteria 25887
42 Ga0070678_100063940 3300005456 Bacteria 2725
43 Ga0070681_10037212 3300005458 Bacteria 4885
44 Ga0070681_10039137 3300005458 Bacteria 4753
45 Ga0070706_100000237 3300005467 Bacteria 67422
46 Ga0070707_100001654 3300005468 Bacteria 21570
47 Ga0070707_100026614 3300005468 Bacteria 5494
48 Ga0070698_100005492 3300005471 Bacteria 13838
49 Ga0070698_100062896 3300005471 Bacteria 3744
50 Ga0070679_100032656 3300005530 Bacteria 5150
51 Ga0070679_100064633 3300005530 Bacteria 3647
52 Ga0070684_100098326 3300005535 Bacteria 2611
53 Ga0070684_100176787 3300005535 Bacteria 1940
54 Ga0068853_100019680 3300005539 Bacteria 5603
55 Ga0068853_100259231 3300005539 Bacteria 1598
56 Ga0070696_100024725 3300005546 Bacteria 4082
57 Ga0068855_100008798 3300005563 Bacteria 12204
58 Ga0068855_100515390 3300005563 Bacteria 1298
59 Ga0070664_100468728 3300005564 Bacteria 1158
60 Ga0068857_100023416 3300005577 Bacteria 5437
61 Ga0068856_100239503 3300005614 Bacteria 1830
62 Ga0068866_10094119 3300005718 Unclassified 1638
63 Ga0081455_10000737 3300005937 Bacteria 42512
64 Ga0081455_10012967 3300005937 Bacteria 8266
65 Ga0081455_10017573 3300005937 Bacteria 6849
66 Ga0081455_10026568 3300005937 Bacteria 5321
67 Ga0081455_10035417 3300005937 Bacteria 4461
68 Ga0081455_10040335 3300005937 Bacteria 4118
69 Ga0081455_10045232 3300005937 Bacteria 3831
70 Ga0081455_10068617 3300005937 Bacteria 2950
71 Ga0081455_10091337 3300005937 Bacteria 2466
72 Ga0081538_10000050 3300005981 Bacteria 110501
73 Ga0081539_10000057 3300005985 Bacteria 256264
74 Ga0081539_10002019 3300005985 Bacteria 30676
75 Ga0081539_10003375 3300005985 Bacteria 19774
76 Ga0081539_10004428 3300005985 Bacteria 15523
77 Ga0081539_10042400 3300005985 Bacteria 2651
78 Ga0075365_10000802 3300006038 Bacteria 12899
79 Ga0075364_10009781 3300006051 Bacteria 5765
80 Ga0075432_10000007 3300006058 Bacteria 41144
81 Ga0075432_10000222 3300006058 Bacteria 15141
82 Ga0075432_10007054 3300006058 Bacteria 3827
83 Ga0097621_100346750 3300006237 Bacteria 1320
84 Ga0075428_100046304 3300006844 Bacteria 4777
85 Ga0075428_100065149 3300006844 Bacteria 3990
86 Ga0075430_100002168 3300006846 Bacteria 16252
87 Ga0075430_100406290 3300006846 Bacteria 1124
88 Ga0075431_100018665 3300006847 Bacteria 7066
89 Ga0075431_100139831 3300006847 Bacteria 2496
90 Ga0075433_10000482 3300006852 Bacteria 26002
91 Ga0075433_10006291 3300006852 Bacteria 9376
92 Ga0075433_10291281 3300006852 Bacteria 1446
93 Ga0075434_100000163 3300006871 Bacteria 42178
94 Ga0075434_100025397 3300006871 Bacteria 5796
95 Ga0075434_100072255 3300006871 Bacteria 3442
96 Ga0068865_100072151 3300006881 Bacteria 2452
97 Ga0075436_100001036 3300006914 Bacteria 18743
98 Ga0099826_10116643 3300006948 Bacteria 1580
99 Ga0075435_100000274 3300007076 Bacteria 32020
100 Ga0075435_100001686 3300007076 Bacteria 14353
101 Ga0105244_10011771 3300009036 Bacteria 5218
102 Ga0105240_10026509 3300009093 Bacteria 7605
103 Ga0111539_10000078 3300009094 Bacteria 97928
104 Ga0111539_10031641 3300009094 Bacteria 6428
105 Ga0111539_10093908 3300009094 Bacteria 3524
106 Ga0105245_10025177 3300009098 Bacteria 5232
107 Ga0114129_10046748 3300009147 Bacteria 6083
108 Ga0114129_10075130 3300009147 Bacteria 4706
109 Ga0114129_10146256 3300009147 Bacteria 3238
110 Ga0114129_10222741 3300009147 Bacteria 2544
111 Ga0105243_10011986 3300009148 Bacteria 6555
112 Ga0105242_10003785 3300009176 Bacteria 11757
113 Ga0105242_10317164 3300009176 Bacteria 1428
114 Ga0105242_10337297 3300009176 Bacteria 1388
115 Ga0105242_10386668 3300009176 Bacteria 1302
116 Ga0105238_10063405 3300009551 Bacteria 3696
117 Ga0105238_10081928 3300009551 Bacteria 3217
118 Ga0123341_1000059 3300009765 Bacteria 46893
119 Ga0123342_1020203 3300009766 Bacteria 4915
120 Ga0105239_10225290 3300010375 Bacteria 2103
121 Ga0105246_10006494 3300011119 Bacteria 7143
122 Ga0105246_10006584 3300011119 Bacteria 7094
123 Ga0105246_10019358 3300011119 Bacteria 4348
124 Ga0157371_10079321 3300013102 Bacteria 2325
125 Ga0157369_10026207 3300013105 Bacteria 6469
126 Ga0157369_10103516 3300013105 Bacteria 3032
127 Ga0157369_10106278 3300013105 Bacteria 2987
128 Ga0157369_10402858 3300013105 Bacteria 1419
129 Ga0171462_1004 3300013250 Bacteria 678877
130 Ga0157374_10283643 3300013296 Bacteria 1635
131 Ga0157378_10040745 3300013297 Bacteria 4120
132 Ga0157372_10141724 3300013307 Bacteria 2770
133 Ga0157372_10236101 3300013307 Bacteria 2121
134 Ga0157372_10279135 3300013307 Bacteria 1942
135 Ga0157375_10269392 3300013308 Bacteria 1865
136 Ga0182008_10002078 3300014497 Bacteria 12808
137 Ga0182008_10092721 3300014497 Bacteria 1490
138 Ga0206353_11355273 3300020082 Unclassified 1911
139 Ga0209566_100696 3300025225 Bacteria 19459
140 Ga0209566_102919 3300025225 Bacteria 2867
141 Ga0209051_1001809 3300025303 Bacteria 16949
142 Ga0209257_1002324 3300025304 Bacteria 19185
143 Ga0207697_10004027 3300025315 Bacteria 7120
144 Ga0207655_1009481 3300025728 Bacteria 6037
145 Ga0207653_10000093 3300025885 Bacteria 65950
146 Ga0207692_10001908 3300025898 Bacteria 7931
147 Ga0207692_10026359 3300025898 Bacteria 2726
148 Ga0207642_10002328 3300025899 Bacteria 5928
149 Ga0207688_10051785 3300025901 Bacteria 2299
150 Ga0207647_10009069 3300025904 Bacteria 7083
151 Ga0207705_10034135 3300025909 Bacteria 3637
152 Ga0207684_10000683 3300025910 Bacteria 40239
153 Ga0207684_10022598 3300025910 Bacteria 5369
154 Ga0207684_10213382 3300025910 Bacteria 1665
155 Ga0207707_10043989 3300025912 Bacteria 3894
156 Ga0207695_10021186 3300025913 Bacteria 7423
157 Ga0207663_10283782 3300025916 Bacteria 1231
158 Ga0207660_10126010 3300025917 Bacteria 1945
159 Ga0207660_10349459 3300025917 Bacteria 1185
160 Ga0207657_10011659 3300025919 Bacteria 8713
161 Ga0207652_10019397 3300025921 Bacteria 5592
162 Ga0207652_10049243 3300025921 Bacteria 3606
163 Ga0207646_10023685 3300025922 Bacteria 5635
164 Ga0207646_10030748 3300025922 Bacteria 4865
165 Ga0207646_10061626 3300025922 Bacteria 3348
166 Ga0207646_10103475 3300025922 Bacteria 2553
167 Ga0207694_10032919 3300025924 Bacteria 3970
168 Ga0207700_10312034 3300025928 Bacteria 1361
169 Ga0207664_10190780 3300025929 Bacteria 1764
170 Ga0207690_10287722 3300025932 Bacteria 1282
171 Ga0207709_10008942 3300025935 Bacteria 5527
172 Ga0207669_10015911 3300025937 Bacteria 3807
173 Ga0207661_10007847 3300025944 Bacteria 7602
174 Ga0207661_10247902 3300025944 Bacteria 1582
175 Ga0207679_10386208 3300025945 Bacteria 1228
176 Ga0207667_10042345 3300025949 Bacteria 4841
177 Ga0207712_10423300 3300025961 Bacteria 1124
178 Ga0207668_10164995 3300025972 Bacteria 1730
179 Ga0207658_10133646 3300025986 Bacteria 1997
180 Ga0207639_10076301 3300026041 Bacteria 2639
181 Ga0207639_10190915 3300026041 Bacteria 1750
182 Ga0207678_10000166 3300026067 Bacteria 55793
183 Ga0207678_10126680 3300026067 Bacteria 2178
184 Ga0207674_10049585 3300026116 Bacteria 4294
185 Ga0207675_100161684 3300026118 Bacteria 2136
186 Ga0209974_10041971 3300027876 Bacteria 1523
187 Ga0207428_10000662 3300027907 Bacteria 40307
188 Ga0207428_10006298 3300027907 Bacteria 10973
189 Ga0207428_10032916 3300027907 Bacteria 4262
190 Ga0207428_10045197 3300027907 Bacteria 3549
191 Ga0207428_10088416 3300027907 Bacteria 2410
192 Ga0207428_10110571 3300027907 Bacteria 2116
193 Ga0307512_10005080 3300030522 Bacteria 13975
194 Ga0316176_1172987 3300030732 Bacteria 5914
195 Ga0316176_1189152 3300030732 Bacteria 2520
196 Ga0314311_1040023 3300030733 Bacteria 7981
197 Ga0314311_1073438 3300030733 Bacteria 2608
198 Ga0307513_10020769 3300031456 Bacteria 7774
199 Ga0307513_10114752 3300031456 Bacteria 2678
200 Ga0307408_100001012 3300031548 Bacteria 21616
201 Ga0307408_100002815 3300031548 Bacteria 12077
202 Ga0307408_100020440 3300031548 Bacteria 4469
203 Ga0307408_100020696 3300031548 Bacteria 4444
204 Ga0307408_100043234 3300031548 Bacteria 3205
205 Ga0307408_100047284 3300031548 Bacteria 3080
206 Ga0307408_100080760 3300031548 Bacteria 2429
207 Ga0307408_100087272 3300031548 Bacteria 2346
208 Ga0307408_100125168 3300031548 Bacteria 1997
209 Ga0307408_100396952 3300031548 Bacteria 1183
210 Ga0307405_10013188 3300031731 Bacteria 4403
211 Ga0307405_10016478 3300031731 Bacteria 4031
212 Ga0307405_10019311 3300031731 Bacteria 3783
213 Ga0307405_10020274 3300031731 Bacteria 3712
214 Ga0307405_10045587 3300031731 Bacteria 2688
215 Ga0307405_10066943 3300031731 Bacteria 2292
216 Ga0307405_10107100 3300031731 Bacteria 1886
217 Ga0307405_10108904 3300031731 Bacteria 1873
218 Ga0307405_10217141 3300031731 Bacteria 1400
219 Ga0307405_10274589 3300031731 Bacteria 1265
220 Ga0307413_10004079 3300031824 Bacteria 6282
221 Ga0307413_10017992 3300031824 Bacteria 3695
222 Ga0307413_10018500 3300031824 Bacteria 3658
223 Ga0307413_10019858 3300031824 Bacteria 3560
224 Ga0307413_10033541 3300031824 Bacteria 2925
225 Ga0307413_10059226 3300031824 Bacteria 2352
226 Ga0307413_10098148 3300031824 Bacteria 1928
227 Ga0307413_10141722 3300031824 Bacteria 1662
228 Ga0307413_10156560 3300031824 Bacteria 1595
229 Ga0307413_10166355 3300031824 Bacteria 1556
230 Ga0307410_10001236 3300031852 Bacteria 11352
231 Ga0307410_10003812 3300031852 Bacteria 7658
232 Ga0307410_10008801 3300031852 Bacteria 5623
233 Ga0307410_10022119 3300031852 Bacteria 3924
234 Ga0307410_10027075 3300031852 Bacteria 3619
235 Ga0307410_10035602 3300031852 Bacteria 3234
236 Ga0307410_10067432 3300031852 Bacteria 2468
237 Ga0307410_10084852 3300031852 Bacteria 2233
238 Ga0307410_10088514 3300031852 Bacteria 2192
239 Ga0307410_10106889 3300031852 Bacteria 2017
240 Ga0307410_10108360 3300031852 Bacteria 2005
241 Ga0307410_10250108 3300031852 Bacteria 1378
242 Ga0326468_10000014 3300031889 Bacteria 12922
243 Ga0307406_10000019 3300031901 Bacteria 98555
244 Ga0307406_10022526 3300031901 Bacteria 3738
245 Ga0307406_10073391 3300031901 Bacteria 2250
246 Ga0307406_10083097 3300031901 Bacteria 2135
247 Ga0307406_10140767 3300031901 Bacteria 1707
248 Ga0307406_10167552 3300031901 Bacteria 1586
249 Ga0307406_10231643 3300031901 Bacteria 1380
250 Ga0307407_10001070 3300031903 Bacteria 9497
251 Ga0307407_10001475 3300031903 Bacteria 8553
252 Ga0307407_10010268 3300031903 Bacteria 4409
253 Ga0307407_10011039 3300031903 Bacteria 4283
254 Ga0307407_10033918 3300031903 Bacteria 2789
255 Ga0307407_10039140 3300031903 Bacteria 2634
256 Ga0307407_10044386 3300031903 Bacteria 2505
257 Ga0307407_10236808 3300031903 Bacteria 1243
258 Ga0307412_10001015 3300031911 Bacteria 16083
259 Ga0307412_10021870 3300031911 Bacteria 3912
260 Ga0307412_10026992 3300031911 Bacteria 3575
261 Ga0307412_10036484 3300031911 Bacteria 3150
262 Ga0307412_10041593 3300031911 Bacteria 2980
263 Ga0307412_10101953 3300031911 Bacteria 2031
264 Ga0307412_10108712 3300031911 Bacteria 1976
265 Ga0307412_10136452 3300031911 Bacteria 1790
266 Ga0307412_10148849 3300031911 Bacteria 1725
267 Ga0307412_10223628 3300031911 Bacteria 1444
268 Ga0307412_10230707 3300031911 Bacteria 1425
269 Ga0307412_10236276 3300031911 Bacteria 1411
270 Ga0307412_10252403 3300031911 Bacteria 1370
271 Ga0307412_10308910 3300031911 Bacteria 1253
272 Ga0307412_10430297 3300031911 Bacteria 1082
273 Ga0307409_100000024 3300031995 Bacteria 51734
274 Ga0307409_100011584 3300031995 Bacteria 5572
275 Ga0307409_100020099 3300031995 Bacteria 4542
276 Ga0307409_100037824 3300031995 Bacteria 3561
277 Ga0307409_100082241 3300031995 Bacteria 2606
278 Ga0307409_100137952 3300031995 Bacteria 2096
279 Ga0307409_100159704 3300031995 Bacteria 1969
280 Ga0307409_100187481 3300031995 Bacteria 1838
281 Ga0307409_100305770 3300031995 Bacteria 1481
282 Ga0307416_100000040 3300032002 Bacteria 132572
283 Ga0307416_100004959 3300032002 Bacteria 8113
284 Ga0307416_100008345 3300032002 Bacteria 6674
285 Ga0307416_100020331 3300032002 Bacteria 4734
286 Ga0307416_100022408 3300032002 Bacteria 4559
287 Ga0307416_100048054 3300032002 Bacteria 3382
288 Ga0307416_100051376 3300032002 Bacteria 3292
289 Ga0307416_100073802 3300032002 Bacteria 2847
290 Ga0307416_100085684 3300032002 Bacteria 2682
291 Ga0307416_100128287 3300032002 Bacteria 2277
292 Ga0307416_100163213 3300032002 Bacteria 2063
293 Ga0307416_100223997 3300032002 Bacteria 1806
294 Ga0307416_100268381 3300032002 Bacteria 1673
295 Ga0307414_10042056 3300032004 Bacteria 3102
296 Ga0307411_10008197 3300032005 Bacteria 5393
297 Ga0307411_10008677 3300032005 Bacteria 5284
298 Ga0307411_10055609 3300032005 Bacteria 2604
299 Ga0307411_10059469 3300032005 Bacteria 2534
300 Ga0307411_10093907 3300032005 Bacteria 2102
301 Ga0307411_10108517 3300032005 Bacteria 1980
302 Ga0307411_10186726 3300032005 Bacteria 1578
303 Ga0307411_10252513 3300032005 Bacteria 1387
304 Ga0307411_10268687 3300032005 Bacteria 1351
305 Ga0307411_10319289 3300032005 Bacteria 1253
306 Ga0307415_100004657 3300032126 Bacteria 7169
307 Ga0307415_100006009 3300032126 Bacteria 6502
308 Ga0307415_100011198 3300032126 Bacteria 5119
309 Ga0307415_100021129 3300032126 Bacteria 3993
310 Ga0307415_100022429 3300032126 Bacteria 3896
311 Ga0307415_100035008 3300032126 Bacteria 3276
312 Ga0307415_100066323 3300032126 Bacteria 2518
313 Ga0373936_0062404 3300035113 Bacteria 1524
314 Ga0373947_0008987 3300035725 Bacteria 5744
315 Ga0373925_0184755 3300037068 Bacteria 1652
316 Ga0395899_0022179 3300037312 Bacteria 4815
317 Ga0395899_0026239 3300037312 Bacteria 4396
318 Ga0395899_0027135 3300037312 Bacteria 4320
319 Ga0395899_0034783 3300037312 Bacteria 3784
320 Ga0395899_0050999 3300037312 Bacteria 3072
321 Ga0395899_0073520 3300037312 Bacteria 2499
322 Ga0395900_0008527 3300037418 Bacteria 10535
323 Ga0395900_0015527 3300037418 Bacteria 7762
324 Ga0395900_0024493 3300037418 Bacteria 6181
325 Ga0395900_0053543 3300037418 Bacteria 4154
326 Ga0395900_0080579 3300037418 Bacteria 3345
327 Ga0395900_0196649 3300037418 Bacteria 2042
328 Ga0395900_0213790 3300037418 Bacteria 1946
329 Ga0395900_0241201 3300037418 Bacteria 1813
330 Ga0395898_0026693 3300037466 Bacteria 5806
331 Ga0395898_0035644 3300037466 Bacteria 4945
332 Ga0395898_0048677 3300037466 Bacteria 4155
333 Ga0395898_0063855 3300037466 Bacteria 3573
334 Ga0395898_0080224 3300037466 Bacteria 3147
335 Ga0395905_0061834 3300037471 Bacteria 3503
336 Ga0395901_0007234 3300038443 Bacteria 11196
337 Ga0395901_0017791 3300038443 Bacteria 7254
338 Ga0395901_0060065 3300038443 Bacteria 3955
339 Ga0395901_0073476 3300038443 Bacteria 3566
340 Ga0395901_0074737 3300038443 Bacteria 3535
341 Ga0395901_0170079 3300038443 Bacteria 2286
342 Ga0395901_0193977 3300038443 Bacteria 2130
343 Ga0395901_0645952 3300038443 Bacteria 1062
344 Ga0400483_091492 3300039062 Bacteria 1313
345 Ga0400489_88148 3300039093 Bacteria 10154
346 Ga0439436_0000683 3300041404 Bacteria 9113
347 Ga0439436_0006583 3300041404 Bacteria 3569
348 Ga0439436_0010657 3300041404 Bacteria 2801
349 Ga0439439_0001501 3300041406 Bacteria 4670
350 Ga0439466_0007754 3300041411 Bacteria 4055
351 Ga0439465_0043928 3300041413 Bacteria 1451
352 Ga0451800_0408773 3300041459 Bacteria 1060
353 Ga0451853_2589370 3300041512 Bacteria 1397
354 Ga0439431_0030026 3300041997 Bacteria 1345
355 Ga0439433_0000729 3300041999 Bacteria 6425
356 Ga0439433_0000759 3300041999 Bacteria 6347
357 Ga0439433_0001416 3300041999 Bacteria 4942
358 Ga0439433_0009460 3300041999 Bacteria 2123
359 Ga0439442_000821 3300042002 Bacteria 6429
360 Ga0439442_002321 3300042002 Bacteria 3736
361 Ga0439442_007444 3300042002 Bacteria 2200
362 Ga0439442_030779 3300042002 Bacteria 1121
363 Ga0439449_0001548 3300042007 Bacteria 9005
364 Ga0439449_0006758 3300042007 Bacteria 4377
365 Ga0439449_0008433 3300042007 Bacteria 3916
366 Ga0439449_0008676 3300042007 Bacteria 3857
367 Ga0439449_0128658 3300042007 Bacteria 941
368 Ga0439451_006354 3300042009 Bacteria 2417
369 Ga0439457_003241 3300042014 Bacteria 4471
370 Ga0439457_004666 3300042014 Bacteria 3544
371 Ga0439457_028029 3300042014 Bacteria 1246
372 Ga0439462_0002117 3300042015 Bacteria 4559
373 Ga0439462_0007302 3300042015 Bacteria 2762
374 Ga0439463_003841 3300042016 Bacteria 3789
375 Ga0450920_000660 3300042122 Bacteria 5495
376 Ga0439446_0019718 3300042156 Bacteria 1896
377 Ga0439434_0002507 3300042435 Bacteria 5346
378 Ga0439434_0072571 3300042435 Bacteria 1085
379 Ga0439444_0004741 3300042437 Bacteria 1989
380 Ga0466972_0001921 3300044658 Bacteria 10193
381 Ga0466972_0002862 3300044658 Bacteria 8540
382 Ga0466972_0046832 3300044658 Bacteria 2092
383 Ga0466965_0000019 3300044683 Bacteria 63668
384 Ga0466965_0002706 3300044683 Bacteria 7594
385 Ga0466965_0002969 3300044683 Bacteria 7348
386 Ga0466965_0003150 3300044683 Bacteria 7197
387 Ga0466965_0005823 3300044683 Bacteria 5562
388 Ga0466966_0018721 3300044684 Bacteria 4562
389 Ga0466966_0080996 3300044684 Bacteria 2022
390 Ga0466961_0030055 3300044693 Bacteria 3491
391 Ga0466963_0004047 3300044694 Bacteria 8483
392 Ga0466963_0035136 3300044694 Bacteria 3264
393 Ga0466963_0187118 3300044694 Bacteria 1446
394 Ga0466968_0018202 3300044735 Bacteria 2816
395 Ga0466970_0007827 3300044765 Bacteria 5365
396 Ga0466970_0056039 3300044765 Bacteria 2106
397 Ga0466970_0089980 3300044765 Bacteria 1665
398 Ga0466957_0047267 3300044842 Bacteria 2615
399 Ga0466960_0020911 3300044901 Bacteria 2906
400 Ga0466959_0011880 3300045049 Bacteria 6272
401 Ga0466958_0009923 3300045836 Bacteria 5318
402 Ga0466967_0010710 3300045976 Bacteria 6893
403 Ga0466967_0045955 3300045976 Bacteria 3798
404 Ga0466967_0071530 3300045976 Bacteria 3106
405 Ga0466967_0126537 3300045976 Bacteria 2367
406 Ga0466967_0483565 3300045976 Bacteria 1213
407 Ga0495627_034204 3300046453 Bacteria 1589
408 Ga0495603_0003372 3300046455 Bacteria 9509
409 Ga0495651_0010267 3300046462 Bacteria 7190
410 Ga0495653_0010508 3300046463 Bacteria 7577
411 Ga0495653_0017174 3300046463 Bacteria 5885
412 Ga0495662_0000888 3300046476 Bacteria 14627
413 Ga0495664_0007517 3300046477 Bacteria 6058
414 Ga0495585_0039341 3300046492 Bacteria 2659
415 Ga0495585_0113760 3300046492 Bacteria 1437
416 Ga0495608_0007841 3300046511 Bacteria 7507
417 Ga0495628_0005634 3300046516 Bacteria 10961
418 Ga0495630_0064890 3300046517 Bacteria 2743
419 Ga0495666_0005974 3300046526 Bacteria 6135
420 Ga0495652_0017084 3300046529 Bacteria 6479
421 Ga0495665_0001299 3300046531 Bacteria 13324
422 Ga0495640_0001598 3300046533 Bacteria 17890
423 Ga0495586_0042887 3300046535 Bacteria 2436
424 Ga0495597_0049274 3300046542 Bacteria 1862
425 Ga0495667_0006995 3300046559 Bacteria 7653
426 Ga0495656_0002387 3300046615 Bacteria 6224
427 Ga0495611_0148875 3300046648 Bacteria 1093
428 Ga0495635_0032471 3300046663 Bacteria 3621
429 Ga0495657_0000779 3300046675 Bacteria 28366
430 Ga0495599_0008391 3300046678 Bacteria 6280
431 Ga0495646_0107077 3300046680 Bacteria 1595
432 Ga0495613_0001340 3300046689 Bacteria 18759
433 Ga0495624_0079514 3300046690 Bacteria 2033
434 Ga0495670_0000463 3300046691 Bacteria 19403
435 Ga0495600_0009498 3300046809 Bacteria 6011
436 Ga0495604_0000995 3300047317 Bacteria 23556
437 Ga0495672_0037147 3300047320 Bacteria 2984
438 Ga0495676_0031060 3300047321 Bacteria 4524
439 Ga0495675_0004875 3300047444 Bacteria 8169
440 Ga0495684_0039034 3300047471 Bacteria 3640
441 Ga0495602_0025227 3300048088 Bacteria 5754
442 Ga0496101_0083830 3300048904 Bacteria 2360
443 Ga0496102_0721474 3300048905 Bacteria 920
444 Ga0496103_0010753 3300048906 Bacteria 5414
445 Ga0496107_0007873 3300048910 Bacteria 7356
446 Ga0496108_0020549 3300048911 Bacteria 5427
447 Ga0496110_0438368 3300048913 Bacteria 1191
448 Ga0496110_0499289 3300048913 Bacteria 1108
449 Ga0496112_0104518 3300048915 Bacteria 2802
450 Ga0496112_0184459 3300048915 Bacteria 2050
451 Ga0496113_0440471 3300048916 Bacteria 1047
452 Ga0496114_0012605 3300048917 Bacteria 6772
453 Ga0496114_0040127 3300048917 Bacteria 3874
454 Ga0496114_0588262 3300048917 Bacteria 982
455 Ga0496115_0000823 3300048918 Bacteria 22727
456 Ga0496115_0034821 3300048918 Bacteria 3980
457 Ga0496118_0156851 3300048921 Bacteria 1414
458 Ga0496119_0000533 3300048922 Bacteria 51798
459 Ga0496119_0002468 3300048922 Bacteria 20289
460 Ga0496120_0011887 3300048923 Bacteria 5956
461 Ga0496120_0031436 3300048923 Bacteria 3214
462 Ga0496121_0000015 3300048924 Bacteria 571958
463 Ga0496122_0160474 3300048925 Bacteria 1372
464 Ga0496122_0161786 3300048925 Bacteria 1364
465 Ga0496123_0088922 3300048926 Bacteria 1842
466 Ga0496124_0019651 3300048927 Bacteria 6276
467 Ga0496124_0047953 3300048927 Bacteria 3652
468 Ga0501031_0000112 3300049568 Bacteria 43234
469 Ga0501032_0004795 3300049569 Bacteria 10137
470 Ga0501032_0006992 3300049569 Bacteria 8273
471 Ga0501032_0014569 3300049569 Bacteria 5568
472 Ga0501032_0027505 3300049569 Bacteria 3907
473 Ga0501032_0046041 3300049569 Bacteria 2948
474 Ga0501032_0102303 3300049569 Bacteria 1898
475 Ga0501033_0002294 3300049570 Bacteria 16338
476 Ga0501033_0027059 3300049570 Bacteria 4315
477 Ga0501033_0027543 3300049570 Bacteria 4273
478 Ga0501033_0034953 3300049570 Bacteria 3767
479 Ga0501033_0036631 3300049570 Bacteria 3675
480 Ga0501033_0065927 3300049570 Bacteria 2663
481 Ga0501033_0066468 3300049570 Bacteria 2651
482 Ga0501034_0000042 3300049571 Bacteria 229124
483 Ga0501034_0004214 3300049571 Bacteria 16056
484 Ga0501034_0005763 3300049571 Bacteria 13469
485 Ga0501034_0010113 3300049571 Bacteria 9843
486 Ga0501034_0037972 3300049571 Bacteria 4877
487 Ga0501034_0038852 3300049571 Bacteria 4821
488 Ga0501034_0080887 3300049571 Bacteria 3252
489 Ga0501034_0122003 3300049571 Bacteria 2592
490 Ga0501034_0224328 3300049571 Bacteria 1830
491 Ga0501036_0001867 3300049572 Bacteria 16331
492 Ga0501036_0002582 3300049572 Bacteria 14247
493 Ga0501036_0155354 3300049572 Bacteria 1930
494 Ga0501037_0007023 3300049573 Bacteria 8222
495 Ga0501037_0011660 3300049573 Bacteria 6471
496 Ga0501037_0012729 3300049573 Bacteria 6197
497 Ga0501037_0014282 3300049573 Bacteria 5853
498 Ga0501037_0014339 3300049573 Bacteria 5839
499 Ga0501037_0022295 3300049573 Bacteria 4685
500 Ga0501037_0030276 3300049573 Bacteria 4000
501 Ga0501037_0064035 3300049573 Bacteria 2680
502 Ga0501037_0371114 3300049573 Bacteria 984
503 Ga0501038_0002639 3300049574 Bacteria 16772
504 Ga0501038_0007160 3300049574 Bacteria 10310
505 Ga0501038_0024834 3300049574 Bacteria 5342
506 Ga0501038_0090819 3300049574 Bacteria 2559
507 Ga0501038_0101199 3300049574 Bacteria 2399
508 Ga0501038_0124605 3300049574 Bacteria 2121
509 Ga0501038_0220437 3300049574 Bacteria 1513
510 Ga0501039_0000369 3300049575 Bacteria 32246
511 Ga0501039_0027635 3300049575 Bacteria 4363
512 Ga0501039_0052534 3300049575 Bacteria 3153
513 Ga0501039_0064929 3300049575 Bacteria 2830
514 Ga0501039_0095822 3300049575 Bacteria 2313
515 Ga0501039_0217070 3300049575 Bacteria 1504
516 Ga0501040_0030288 3300049576 Bacteria 3656
517 Ga0501042_0005141 3300049578 Bacteria 8398
518 Ga0501042_0124193 3300049578 Bacteria 1858
519 Ga0501042_0173918 3300049578 Bacteria 1553
520 Ga0501043_0000679 3300049579 Bacteria 29946
521 Ga0501043_0003795 3300049579 Bacteria 12422
522 Ga0501043_0031651 3300049579 Bacteria 4158
523 Ga0501043_0058798 3300049579 Bacteria 3017
524 Ga0501043_0061837 3300049579 Bacteria 2940
525 Ga0501043_0092421 3300049579 Bacteria 2379
526 Ga0501043_0119822 3300049579 Bacteria 2064
527 Ga0501043_0293199 3300049579 Bacteria 1245
528 Ga0501046_0000230 3300049580 Bacteria 57666
529 Ga0501046_0011051 3300049580 Bacteria 7734
530 Ga0501046_0035615 3300049580 Bacteria 4010
531 Ga0501047_0002902 3300049581 Bacteria 16263
532 Ga0501047_0007924 3300049581 Bacteria 10015
533 Ga0501047_0023386 3300049581 Bacteria 5933
534 Ga0501047_0114553 3300049581 Bacteria 2578
535 Ga0501047_0137918 3300049581 Bacteria 2319
536 Ga0501047_0344354 3300049581 Bacteria 1328
537 Ga0501047_0369025 3300049581 Bacteria 1270
538 Ga0501048_0000713 3300049582 Bacteria 24290
539 Ga0501048_0003800 3300049582 Bacteria 11528
540 Ga0501048_0010942 3300049582 Bacteria 6768
541 Ga0501067_0009741 3300049583 Bacteria 5318
542 Ga0501067_0023660 3300049583 Bacteria 3405
543 Ga0501067_0025109 3300049583 Bacteria 3304
544 Ga0501067_0184274 3300049583 Bacteria 1163
545 Ga0501069_0001968 3300049585 Bacteria 10265
546 Ga0501069_0091185 3300049585 Bacteria 1723
547 Ga0501070_0000838 3300049586 Bacteria 27930
548 Ga0501070_0008293 3300049586 Bacteria 8780
549 Ga0501070_0027789 3300049586 Bacteria 4745
550 Ga0501070_0162154 3300049586 Bacteria 1843
551 Ga0501070_0253599 3300049586 Bacteria 1439
552 Ga0501071_0208364 3300049587 Bacteria 1470
553 Ga0501071_0236294 3300049587 Bacteria 1377
554 Ga0501072_0007590 3300049588 Bacteria 8228
555 Ga0501072_0198727 3300049588 Bacteria 1599
556 Ga0501073_0002405 3300049589 Bacteria 14007
557 Ga0501073_0006475 3300049589 Bacteria 8712
558 Ga0501073_0025766 3300049589 Bacteria 4213
559 Ga0501073_0180741 3300049589 Bacteria 1460
560 Ga0501074_0001383 3300049590 Bacteria 16099
561 Ga0501074_0008483 3300049590 Bacteria 7447
562 Ga0501074_0049266 3300049590 Bacteria 3041
563 Ga0501074_0070939 3300049590 Bacteria 2504
564 Ga0501243_001947 3300049675 Bacteria 3003
565 Ga0501080_0000870 3300049742 Bacteria 24737
566 Ga0501080_0005330 3300049742 Bacteria 11460
567 Ga0501080_0195571 3300049742 Bacteria 1857
568 Ga0501083_0000019 3300049744 Bacteria 147154
569 Ga0501083_0000558 3300049744 Bacteria 23877
570 Ga0501083_0012760 3300049744 Bacteria 5876
571 Ga0501083_0076248 3300049744 Bacteria 2225
572 Ga0501265_022947 3300049762 Bacteria 856
573 Ga0501035_0005907 3300049822 Bacteria 11524
574 Ga0501035_0010851 3300049822 Bacteria 8438
575 Ga0501035_0066759 3300049822 Bacteria 3192
576 Ga0501035_0244145 3300049822 Bacteria 1527
577 Ga0501044_0024180 3300049823 Bacteria 6454
578 Ga0501044_0030914 3300049823 Bacteria 5639
579 Ga0501044_0031624 3300049823 Bacteria 5569
580 Ga0501044_0051092 3300049823 Bacteria 4264
581 Ga0501044_0051674 3300049823 Bacteria 4237
582 Ga0501044_0075853 3300049823 Bacteria 3414
583 Ga0501044_0319860 3300049823 Bacteria 1476
584 Ga0501045_0036568 3300049824 Bacteria 3566
585 Ga0501212_003302 3300049851 Bacteria 2015
586 nmdc:mga00v17_5185_c1 3300050491 Bacteria 6855
587 nmdc:mga00v17_93544_c1 3300050491 Bacteria 1890
588 nmdc:mga0yw44_6554_c1 3300050492 Bacteria 5292
589 nmdc:mga05p37_177898_c1 3300050507 Bacteria 2591
590 nmdc:mga05p37_35924_c1 3300050507 Bacteria 6080
591 nmdc:mga0qj67_358556_c1 3300050509 Bacteria 1178
592 nmdc:mga0qj67_966_c1 3300050509 Bacteria 19788
593 nmdc:mga06r32_47408_c1 3300050510 Bacteria 4104
594 nmdc:mga08y16_22896_c1 3300050511 Bacteria 6594
595 nmdc:mga08y16_73623_c1 3300050511 Bacteria 3560
596 nmdc:mga08y16_80833_c1 3300050511 Bacteria 3389
597 nmdc:mga0n895_187954_c1 3300050512 Bacteria 2097
598 nmdc:mga0n895_200_c1 3300050512 Bacteria 37296
599 nmdc:mga0n895_66676_c1 3300050512 Bacteria 3564
600 nmdc:mga0n895_78222_c1 3300050512 Bacteria 3292
601 nmdc:mga0n895_987_c1 3300050512 Bacteria 20606
602 nmdc:mga0rr50_842_c1 3300050513 Bacteria 16524
603 nmdc:mga08x19_1049_c1 3300050514 Bacteria 17282
604 nmdc:mga0a205_109336_c1 3300050515 Bacteria 2663
605 nmdc:mga0a205_116_c3 3300050515 Bacteria 9931
606 nmdc:mga0a205_14642_c1 3300050515 Bacteria 7320
607 nmdc:mga0a205_93973_c2 3300050515 Bacteria 2267
608 Ga0495619_0013668 3300053085 Bacteria 5118
609 Ga0500562_000853 3300053108 Bacteria 7384
610 Ga0500642_0011785 3300053130 Bacteria 3143
611 Ga0500568_0000742 3300053139 Bacteria 23269
612 Ga0500588_0001406 3300053146 Bacteria 4570
613 Ga0500604_0010602 3300053151 Bacteria 2468
614 Ga0500616_0000384 3300053153 Bacteria 61859
615 Ga0500616_0003567 3300053153 Bacteria 11784
616 Ga0500636_0009533 3300053177 Bacteria 5648
617 Ga0501084_0007981 3300054114 Bacteria 8714
618 Ga0501084_0396219 3300054114 Bacteria 1167
619 Ga0587066_008637 3300059490 Bacteria 1420
620 Ga0587070_007899 3300059491 Bacteria 1491
621 Ga0587070_010517 3300059491 Bacteria 1365
622 Ga0587070_014117 3300059491 Bacteria 1243
623 Ga0587073_0002528 3300059492 Bacteria 2362
624 Ga0587073_0002778 3300059492 Bacteria 2301
625 Ga0587077_003123 3300059493 Bacteria 2053
626 Ga0587077_005203 3300059493 Bacteria 1766
627 Ga0587082_000911 3300059504 Bacteria 2801
628 Ga0587083_0002276 3300059505 Bacteria 2360
629 Ga0587083_0002815 3300059505 Bacteria 2222
630 Ga0587091_001408 3300059511 Bacteria 2589
631 Ga0587092_001200 3300059512 Bacteria 2452
632 Ga0587092_003139 3300059512 Bacteria 1847
633 Ga0587101_000801 3300059623 Bacteria 2443
634 Ga0587117_011500 3300059627 Bacteria 1100
635 Ga0587067_002917 3300059640 Bacteria 2086
636 Ga0587075_001649 3300059644 Bacteria 2211
637 Ga0587075_003232 3300059644 Bacteria 1796
638 Ga0587079_005537 3300059647 Bacteria 1793
639 Ga0587107_002398 3300059652 Bacteria 1689
640 Ga0501082_0094460 3300060353 Bacteria 2584
641 Ga0466962_0164657 3300061719 Bacteria 1078

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031824 Ga0307413_10156560 Ga0307413_101565601 227
2 3300005356 Ga0070674_100119227 Ga0070674_1001192272 231
3 3300005440 Ga0070705_100039424 Ga0070705_1000394242 231
4 3300005444 Ga0070694_100175413 Ga0070694_1001754132 231
5 3300005546 Ga0070696_100024725 Ga0070696_1000247253 231
6 3300005718 Ga0068866_10094119 Ga0068866_100941192 231
7 3300006881 Ga0068865_100072151 Ga0068865_1000721511 231
8 3300025899 Ga0207642_10002328 Ga0207642_100023284 231
9 3300025935 Ga0207709_10008942 Ga0207709_100089425 231
10 3300025937 Ga0207669_10015911 Ga0207669_100159112 231
11 3300026118 Ga0207675_100161684 Ga0207675_1001616843 231
12 3300005471 Ga0070698_100005492 Ga0070698_1000054927 233
13 3300025922 Ga0207646_10023685 Ga0207646_100236853 233
14 3300006852 Ga0075433_10291281 Ga0075433_102912812 234
15 3300050512 nmdc:mga0n895_187954_c1 nmdc:mga0n895_187954_c1_1153_2040 234
16 3300048917 Ga0496114_0588262 Ga0496114_0588262_135_968 243
17 3300042007 Ga0439449_0128658 Ga0439449_0128658_11_823 244
18 3300005445 Ga0070708_100021086 Ga0070708_1000210862 246
19 3300025910 Ga0207684_10213382 Ga0207684_102133822 246
20 3300025922 Ga0207646_10103475 Ga0207646_101034752 246
21 3300005406 Ga0070703_10000038 Ga0070703_1000003829 249
22 3300005440 Ga0070705_100091684 Ga0070705_1000916842 249
23 3300005445 Ga0070708_100001328 Ga0070708_1000013283 249
24 3300005467 Ga0070706_100000237 Ga0070706_10000023751 249
25 3300005468 Ga0070707_100001654 Ga0070707_10000165417 249
26 3300025885 Ga0207653_10000093 Ga0207653_1000009324 249
27 3300025910 Ga0207684_10000683 Ga0207684_1000068348 249
28 3300049762 Ga0501265_022947 Ga0501265_022947_37_846 249
29 3300006852 Ga0075433_10000482 Ga0075433_100004823 250
30 3300006871 Ga0075434_100025397 Ga0075434_1000253973 250
31 3300007076 Ga0075435_100000274 Ga0075435_10000027431 250
32 3300048905 Ga0496102_0721474 Ga0496102_0721474_33_857 252
33 3300009098 Ga0105245_10025177 Ga0105245_100251773 254
34 3300009148 Ga0105243_10011986 Ga0105243_100119862 254
35 3300009176 Ga0105242_10003785 Ga0105242_1000378511 254
36 3300013297 Ga0157378_10040745 Ga0157378_100407453 254
37 3300048910 Ga0496107_0007873 Ga0496107_0007873_686_1669 256
38 3300049823 Ga0501044_0319860 Ga0501044_0319860_497_1450 256
39 3300039093 Ga0400489_88148 Ga0400489_88148_6398_7372 258
40 3300049573 Ga0501037_0012729 Ga0501037_0012729_611_1564 259
41 3300049574 Ga0501038_0024834 Ga0501038_0024834_4138_5091 259
42 3300049586 Ga0501070_0027789 Ga0501070_0027789_2326_3279 259
43 3300005937 Ga0081455_10012967 Ga0081455_100129678 264
44 3300005437 Ga0070710_10011350 Ga0070710_100113502 265
45 3300025898 Ga0207692_10026359 Ga0207692_100263592 265
46 3300044694 Ga0466963_0035136 Ga0466963_0035136_2038_3018 266
47 3300050509 nmdc:mga0qj67_966_c1 nmdc:mga0qj67_966_c1_2270_3175 266
48 3300031731 Ga0307405_10019311 Ga0307405_100193113 267
49 3300031824 Ga0307413_10098148 Ga0307413_100981482 267
50 3300031852 Ga0307410_10003812 Ga0307410_100038126 267
51 3300031903 Ga0307407_10010268 Ga0307407_100102682 267
52 3300031995 Ga0307409_100020099 Ga0307409_1000200996 267
53 3300032002 Ga0307416_100008345 Ga0307416_1000083454 267
54 3300032005 Ga0307411_10059469 Ga0307411_100594692 267
55 3300041999 Ga0439433_0001416 Ga0439433_0001416_3799_4716 267
56 iso_pu_bacteria 2821111986 2821112438 267
57 iso_pu_bacteria 2856741275 2856744713 267
58 iso_pu_bacteria 2891562705 2891566520 267
59 3300005327 Ga0070658_10004384 Ga0070658_100043848 268
60 3300005336 Ga0070680_100389063 Ga0070680_1003890632 268
61 3300005344 Ga0070661_100018909 Ga0070661_1000189092 268
62 3300005458 Ga0070681_10037212 Ga0070681_100372124 268
63 3300005563 Ga0068855_100008798 Ga0068855_1000087988 268
64 3300009093 Ga0105240_10026509 Ga0105240_100265095 268
65 3300009551 Ga0105238_10081928 Ga0105238_100819282 268
66 3300025909 Ga0207705_10034135 Ga0207705_100341353 268
67 3300025913 Ga0207695_10021186 Ga0207695_100211864 268
68 3300025919 Ga0207657_10011659 Ga0207657_100116596 268
69 3300025949 Ga0207667_10042345 Ga0207667_100423452 268
70 3300031911 Ga0307412_10148849 Ga0307412_101488492 268
71 3300032002 Ga0307416_100073802 Ga0307416_1000738021 268
72 3300032126 Ga0307415_100004657 Ga0307415_1000046575 268
73 3300045976 Ga0466967_0010710 Ga0466967_0010710_3416_4369 268
74 3300048913 Ga0496110_0438368 Ga0496110_0438368_62_976 268
75 3300049569 Ga0501032_0046041 Ga0501032_0046041_297_1220 268
76 3300049571 Ga0501034_0122003 Ga0501034_0122003_1033_1956 268
77 3300049573 Ga0501037_0371114 Ga0501037_0371114_39_962 268
78 3300049575 Ga0501039_0064929 Ga0501039_0064929_998_1921 268
79 3300049578 Ga0501042_0124193 Ga0501042_0124193_856_1779 268
80 3300049580 Ga0501046_0035615 Ga0501046_0035615_2863_3786 268
81 3300049581 Ga0501047_0007924 Ga0501047_0007924_6062_6985 268
82 3300049582 Ga0501048_0010942 Ga0501048_0010942_1428_2351 268
83 3300049823 Ga0501044_0051674 Ga0501044_0051674_1693_2709 268
84 3300049824 Ga0501045_0036568 Ga0501045_0036568_2514_3437 268
85 3300025225 Ga0209566_102919 Ga0209566_1029192 269
86 3300048925 Ga0496122_0161786 Ga0496122_0161786_252_1145 269
87 3300048926 Ga0496123_0088922 Ga0496123_0088922_605_1498 269
88 3300005937 Ga0081455_10068617 Ga0081455_100686172 270
89 3300031731 Ga0307405_10108904 Ga0307405_101089042 270
90 3300031852 Ga0307410_10250108 Ga0307410_102501082 270
91 3300032005 Ga0307411_10268687 Ga0307411_102686871 270
92 3300044684 Ga0466966_0018721 Ga0466966_0018721_3096_4052 270
93 3300046453 Ga0495627_034204 Ga0495627_034204_534_1430 270
94 3300046492 Ga0495585_0039341 Ga0495585_0039341_348_1244 270
95 3300046648 Ga0495611_0148875 Ga0495611_0148875_182_1066 270
96 3300054114 Ga0501084_0396219 Ga0501084_0396219_38_943 270
97 iso_pu_bacteria 2816332119 2816424716 270
98 iso_pu_bacteria 2837268691 2837270789 270
99 iso_pu_bacteria 2884693830 2884698386 270
100 iso_pu_bacteria 2895442618 2895450981 270
101 iso_pu_bacteria 2904755435 2904758075 270
102 iso_pu_bacteria 2919425241 2919428016 270
103 iso_pu_bacteria 3006988479 3006991527 270
104 3300005445 Ga0070708_100370467 Ga0070708_1003704672 271
105 3300005468 Ga0070707_100026614 Ga0070707_1000266143 271
106 3300005471 Ga0070698_100062896 Ga0070698_1000628962 271
107 3300005937 Ga0081455_10091337 Ga0081455_100913372 271
108 3300025910 Ga0207684_10022598 Ga0207684_100225982 271
109 3300025922 Ga0207646_10030748 Ga0207646_100307484 271
110 3300025922 Ga0207646_10061626 Ga0207646_100616262 271
111 3300037312 Ga0395899_0050999 Ga0395899_0050999_1516_2463 271
112 3300050515 nmdc:mga0a205_93973_c2 nmdc:mga0a205_93973_c2_348_1274 271
113 3300003841 Ga0055541_1004319 Ga0055541_10043192 272
114 3300013105 Ga0157369_10106278 Ga0157369_101062782 272
115 3300013307 Ga0157372_10141724 Ga0157372_101417242 272
116 3300025225 Ga0209566_100696 Ga0209566_1006965 272
117 iso_pu_bacteria 2839986021 2839988654 272
118 iso_pu_bacteria 2919171160 2919173784 272
119 3300005539 Ga0068853_100019680 Ga0068853_1000196803 273
120 3300005563 Ga0068855_100515390 Ga0068855_1005153902 273
121 3300009551 Ga0105238_10063405 Ga0105238_100634054 273
122 3300025924 Ga0207694_10032919 Ga0207694_100329194 273
123 3300025944 Ga0207661_10247902 Ga0207661_102479022 273
124 3300026041 Ga0207639_10076301 Ga0207639_100763013 273
125 3300038443 Ga0395901_0007234 Ga0395901_0007234_7623_8627 273
126 3300044658 Ga0466972_0002862 Ga0466972_0002862_3892_4869 273
127 3300044765 Ga0466970_0089980 Ga0466970_0089980_198_1175 273
128 3300048918 Ga0496115_0000823 Ga0496115_0000823_7366_8295 273
129 iso_pu_bacteria 2816332139 2816506753 273
130 3300003579 Ga0007429J51699_1042823 Ga0007429J51699_10428232 274
131 3300003693 Ga0032354_1048032 Ga0032354_10480322 274
132 3300003794 Ga0055531_10001269 Ga0055531_100012691 274
133 3300006846 Ga0075430_100002168 Ga0075430_1000021684 274
134 3300009147 Ga0114129_10146256 Ga0114129_101462562 274
135 3300025304 Ga0209257_1002324 Ga0209257_10023242 274
136 3300046455 Ga0495603_0003372 Ga0495603_0003372_2302_3285 274
137 iso_pu_bacteria 2747842429 2747952171 274
138 iso_pu_bacteria 2816332119 2816424286 274
139 iso_pu_bacteria 2862705112 2862711118 274
140 iso_pu_bacteria 2919446982 2919450165 274
141 iso_pu_bacteria 8008485437 8008490663 274
142 iso_pu_bacteria 8025524527 8025525751 274
143 3300032005 Ga0307411_10008197 Ga0307411_100081972 275
144 3300037418 Ga0395900_0024493 Ga0395900_0024493_2905_3828 275
145 3300037418 Ga0395900_0080579 Ga0395900_0080579_578_1558 275
146 3300037466 Ga0395898_0080224 Ga0395898_0080224_744_1724 275
147 3300038443 Ga0395901_0060065 Ga0395901_0060065_682_1662 275
148 3300038443 Ga0395901_0193977 Ga0395901_0193977_475_1398 275
149 3300049581 Ga0501047_0114553 Ga0501047_0114553_717_1673 275
150 3300049588 Ga0501072_0198727 Ga0501072_0198727_205_1161 275
151 3300049823 Ga0501044_0051092 Ga0501044_0051092_219_1175 275
152 iso_pu_bacteria 2808606366 2808877737 275
153 iso_pu_bacteria 2808606370 2808892650 275
154 iso_pu_bacteria 2855670206 2855676422 275
155 iso_pu_bacteria 2855676851 2855678656 275
156 iso_pu_bacteria 2857288857 2857289313 275
157 iso_pu_bacteria 2858848962 2858855175 275
158 iso_pu_bacteria 2858882152 2858888740 275
159 iso_pu_bacteria 2858888857 2858888993 275
160 iso_pu_bacteria 2858895516 2858897413 275
161 iso_pu_bacteria 2869048445 2869050900 275
162 iso_pu_bacteria 2869061728 2869062664 275
163 iso_pu_bacteria 2869068681 2869074521 275
164 iso_pu_bacteria 2887443736 2887447790 275
165 iso_pu_bacteria 2902582711 2902583311 275
166 iso_pu_bacteria 2929219909 2929224706 275
167 iso_pu_bacteria 8003314358 8003317981 275
168 iso_pu_bacteria 8003830390 8003834305 275
169 iso_pu_bacteria 8003870546 8003877938 275
170 3300005329 Ga0070683_100077862 Ga0070683_1000778622 276
171 3300005535 Ga0070684_100098326 Ga0070684_1000983262 276
172 3300005564 Ga0070664_100468728 Ga0070664_1004687281 276
173 3300005985 Ga0081539_10004428 Ga0081539_100044285 276
174 3300025945 Ga0207679_10386208 Ga0207679_103862081 276
175 3300031456 Ga0307513_10020769 Ga0307513_100207692 276
176 3300035113 Ga0373936_0062404 Ga0373936_0062404_388_1356 276
177 3300035725 Ga0373947_0008987 Ga0373947_0008987_986_1954 276
178 3300046690 Ga0495624_0079514 Ga0495624_0079514_49_1017 276
179 3300047321 Ga0495676_0031060 Ga0495676_0031060_2384_3352 276
180 3300048915 Ga0496112_0184459 Ga0496112_0184459_754_1722 276
181 iso_pu_bacteria 2738541272 2738694018 276
182 iso_pu_bacteria 2738543027 2739327397 276
183 iso_pu_bacteria 2739367654 2739607176 276
184 iso_pu_bacteria 2808606394 2809026049 276
185 iso_pu_bacteria 2816332139 2816508800 276
186 iso_pu_bacteria 2867346516 2867352317 276
187 iso_pu_bacteria 2996221748 2996222274 276
188 iso_pu_bacteria 8047710418 8047717163 276
189 iso_pu_bacteria 8056579771 8056579845 276
190 3300005455 Ga0070663_100000278 Ga0070663_1000002788 277
191 3300009176 Ga0105242_10317164 Ga0105242_103171642 277
192 3300026067 Ga0207678_10000166 Ga0207678_1000016611 277
193 3300045049 Ga0466959_0011880 Ga0466959_0011880_207_1169 277
194 3300049571 Ga0501034_0004214 Ga0501034_0004214_376_1323 277
195 3300049572 Ga0501036_0002582 Ga0501036_0002582_10745_11692 277
196 3300049573 Ga0501037_0007023 Ga0501037_0007023_2197_3144 277
197 3300049574 Ga0501038_0002639 Ga0501038_0002639_2503_3450 277
198 3300049575 Ga0501039_0027635 Ga0501039_0027635_241_1188 277
199 3300049578 Ga0501042_0005141 Ga0501042_0005141_5980_6927 277
200 3300049579 Ga0501043_0003795 Ga0501043_0003795_9964_10911 277
201 3300049582 Ga0501048_0003800 Ga0501048_0003800_3325_4272 277
202 3300049589 Ga0501073_0002405 Ga0501073_0002405_1766_2713 277
203 3300049590 Ga0501074_0001383 Ga0501074_0001383_2893_3840 277
204 iso_pu_bacteria 2643221566 2643848853 277
205 iso_pu_bacteria 2721755702 2723640723 277
206 iso_pu_bacteria 2867302475 2867303526 277
207 iso_pu_bacteria 2919443155 2919444073 277
208 iso_pu_bacteria 2935409751 2935410198 277
209 iso_pu_bacteria 8003856774 8003857892 277
210 iso_pu_bacteria 8045830549 8045834179 277
211 3300005435 Ga0070714_100227534 Ga0070714_1002275341 278
212 3300005456 Ga0070678_100063940 Ga0070678_1000639402 278
213 3300005937 Ga0081455_10045232 Ga0081455_100452323 278
214 3300009147 Ga0114129_10046748 Ga0114129_100467484 278
215 3300009765 Ga0123341_1000059 Ga0123341_100005916 278
216 3300009766 Ga0123342_1020203 Ga0123342_10202032 278
217 3300025917 Ga0207660_10349459 Ga0207660_103494592 278
218 3300025929 Ga0207664_10190780 Ga0207664_101907802 278
219 3300031548 Ga0307408_100020696 Ga0307408_1000206963 278
220 3300031731 Ga0307405_10013188 Ga0307405_100131883 278
221 3300031824 Ga0307413_10017992 Ga0307413_100179922 278
222 3300031852 Ga0307410_10001236 Ga0307410_100012367 278
223 3300031901 Ga0307406_10022526 Ga0307406_100225263 278
224 3300031903 Ga0307407_10001070 Ga0307407_100010705 278
225 3300031903 Ga0307407_10039140 Ga0307407_100391402 278
226 3300031995 Ga0307409_100082241 Ga0307409_1000822413 278
227 3300032002 Ga0307416_100004959 Ga0307416_1000049597 278
228 3300032002 Ga0307416_100051376 Ga0307416_1000513762 278
229 3300032002 Ga0307416_100085684 Ga0307416_1000856842 278
230 3300032126 Ga0307415_100021129 Ga0307415_1000211293 278
231 3300032126 Ga0307415_100022429 Ga0307415_1000224292 278
232 3300037418 Ga0395900_0241201 Ga0395900_0241201_525_1499 278
233 3300044683 Ga0466965_0005823 Ga0466965_0005823_1915_2862 278
234 3300050507 nmdc:mga05p37_35924_c1 nmdc:mga05p37_35924_c1_3000_3992 278
235 3300050512 nmdc:mga0n895_987_c1 nmdc:mga0n895_987_c1_16739_17731 278
236 3300050515 nmdc:mga0a205_14642_c1 nmdc:mga0a205_14642_c1_4454_5446 278
237 3300053139 Ga0500568_0000742 Ga0500568_0000742_6702_7622 278
238 iso_pu_bacteria 2751185734 2753071720 278
239 iso_pu_bacteria 2808606365 2808874950 278
240 iso_pu_bacteria 2808606447 2809228567 278
241 iso_pu_bacteria 2868088558 2868094236 278
242 iso_pu_bacteria 2870721527 2870722840 278
243 iso_pu_bacteria 8056054917 8056057600 278
244 iso_pu_bacteria 8056054917 8056058402 278
245 3300005329 Ga0070683_100000882 Ga0070683_1000008827 279
246 3300005329 Ga0070683_100105705 Ga0070683_1001057052 279
247 3300005336 Ga0070680_100096116 Ga0070680_1000961162 279
248 3300005434 Ga0070709_10176209 Ga0070709_101762091 279
249 3300005436 Ga0070713_100135816 Ga0070713_1001358162 279
250 3300005458 Ga0070681_10039137 Ga0070681_100391373 279
251 3300005530 Ga0070679_100032656 Ga0070679_1000326564 279
252 3300005530 Ga0070679_100064633 Ga0070679_1000646332 279
253 3300005535 Ga0070684_100176787 Ga0070684_1001767872 279
254 3300005614 Ga0068856_100239503 Ga0068856_1002395032 279
255 3300013102 Ga0157371_10079321 Ga0157371_100793212 279
256 3300013296 Ga0157374_10283643 Ga0157374_102836432 279
257 3300013307 Ga0157372_10236101 Ga0157372_102361012 279
258 3300014497 Ga0182008_10002078 Ga0182008_100020787 279
259 3300020082 Ga0206353_11355273 Ga0206353_113552732 279
260 3300025912 Ga0207707_10043989 Ga0207707_100439893 279
261 3300025917 Ga0207660_10126010 Ga0207660_101260102 279
262 3300025921 Ga0207652_10019397 Ga0207652_100193975 279
263 3300025921 Ga0207652_10049243 Ga0207652_100492432 279
264 3300025928 Ga0207700_10312034 Ga0207700_103120342 279
265 3300025944 Ga0207661_10007847 Ga0207661_100078473 279
266 3300030732 Ga0316176_1172987 Ga0316176_11729873 279
267 3300030732 Ga0316176_1189152 Ga0316176_11891522 279
268 3300030733 Ga0314311_1040023 Ga0314311_10400233 279
269 3300030733 Ga0314311_1073438 Ga0314311_10734382 279
270 3300031548 Ga0307408_100047284 Ga0307408_1000472843 279
271 3300031824 Ga0307413_10004079 Ga0307413_100040793 279
272 3300031824 Ga0307413_10059226 Ga0307413_100592262 279
273 3300031852 Ga0307410_10008801 Ga0307410_100088012 279
274 3300031852 Ga0307410_10022119 Ga0307410_100221193 279
275 3300031911 Ga0307412_10101953 Ga0307412_101019532 279
276 3300031995 Ga0307409_100011584 Ga0307409_1000115844 279
277 3300031995 Ga0307409_100187481 Ga0307409_1001874812 279
278 3300031995 Ga0307409_100305770 Ga0307409_1003057702 279
279 3300032002 Ga0307416_100223997 Ga0307416_1002239972 279
280 3300032005 Ga0307411_10186726 Ga0307411_101867262 279
281 3300032005 Ga0307411_10319289 Ga0307411_103192892 279
282 3300037068 Ga0373925_0184755 Ga0373925_0184755_93_1043 279
283 3300037312 Ga0395899_0026239 Ga0395899_0026239_1589_2542 279
284 3300037418 Ga0395900_0196649 Ga0395900_0196649_726_1679 279
285 3300041406 Ga0439439_0001501 Ga0439439_0001501_3394_4377 279
286 3300041997 Ga0439431_0030026 Ga0439431_0030026_272_1255 279
287 3300042009 Ga0439451_006354 Ga0439451_006354_143_1120 279
288 3300042015 Ga0439462_0002117 Ga0439462_0002117_3518_4501 279
289 3300042156 Ga0439446_0019718 Ga0439446_0019718_503_1486 279
290 3300042435 Ga0439434_0002507 Ga0439434_0002507_907_1890 279
291 3300044658 Ga0466972_0001921 Ga0466972_0001921_1607_2560 279
292 3300044683 Ga0466965_0002969 Ga0466965_0002969_5145_6098 279
293 3300044694 Ga0466963_0004047 Ga0466963_0004047_1789_2769 279
294 3300044694 Ga0466963_0187118 Ga0466963_0187118_194_1174 279
295 3300044842 Ga0466957_0047267 Ga0466957_0047267_714_1694 279
296 3300044901 Ga0466960_0020911 Ga0466960_0020911_1427_2380 279
297 3300045836 Ga0466958_0009923 Ga0466958_0009923_2446_3426 279
298 3300045976 Ga0466967_0045955 Ga0466967_0045955_823_1800 279
299 3300045976 Ga0466967_0071530 Ga0466967_0071530_484_1470 279
300 3300045976 Ga0466967_0126537 Ga0466967_0126537_886_1866 279
301 3300048911 Ga0496108_0020549 Ga0496108_0020549_1233_2213 279
302 3300048915 Ga0496112_0104518 Ga0496112_0104518_771_1751 279
303 3300048916 Ga0496113_0440471 Ga0496113_0440471_11_988 279
304 3300048923 Ga0496120_0031436 Ga0496120_0031436_1201_2262 279
305 3300049571 Ga0501034_0005763 Ga0501034_0005763_2400_3380 279
306 3300049573 Ga0501037_0011660 Ga0501037_0011660_3363_4316 279
307 3300049574 Ga0501038_0220437 Ga0501038_0220437_544_1497 279
308 3300049579 Ga0501043_0119822 Ga0501043_0119822_611_1549 279
309 3300049583 Ga0501067_0009741 Ga0501067_0009741_1825_2802 279
310 3300049583 Ga0501067_0023660 Ga0501067_0023660_1724_2704 279
311 3300049585 Ga0501069_0091185 Ga0501069_0091185_665_1642 279
312 3300049586 Ga0501070_0162154 Ga0501070_0162154_476_1429 279
313 3300049589 Ga0501073_0006475 Ga0501073_0006475_6335_7315 279
314 3300049590 Ga0501074_0008483 Ga0501074_0008483_2201_3181 279
315 3300049742 Ga0501080_0005330 Ga0501080_0005330_886_1866 279
316 3300049823 Ga0501044_0075853 Ga0501044_0075853_953_1906 279
317 3300053130 Ga0500642_0011785 Ga0500642_0011785_1692_2633 279
318 3300053146 Ga0500588_0001406 Ga0500588_0001406_1298_2263 279
319 3300061719 Ga0466962_0164657 Ga0466962_0164657_41_1018 279
320 iso_pu_bacteria 2558860280 2559425395 279
321 iso_pu_bacteria 2811994872 2812325464 279
322 iso_pu_bacteria 2857720070 2857721434 279
323 iso_pu_bacteria 2857729791 2857732880 279
324 iso_pu_bacteria 2862705112 2862710556 279
325 iso_pu_bacteria 2867346516 2867348464 279
326 iso_pu_bacteria 2906799679 2906800012 279
327 iso_pu_bacteria 2928121344 2928123958 279
328 iso_pu_bacteria 2984580707 2984583512 279
329 iso_pu_bacteria 8008485437 8008490626 279
330 iso_pu_bacteria 8025524527 8025525714 279
331 3300005327 Ga0070658_10083098 Ga0070658_100830982 280
332 3300005347 Ga0070668_100007262 Ga0070668_1000072623 280
333 3300006058 Ga0075432_10000222 Ga0075432_100002226 280
334 3300025972 Ga0207668_10164995 Ga0207668_101649952 280
335 3300027907 Ga0207428_10032916 Ga0207428_100329164 280
336 3300039062 Ga0400483_091492 Ga0400483_091492_88_1065 280
337 3300047320 Ga0495672_0037147 Ga0495672_0037147_1681_2604 280
338 3300048921 Ga0496118_0156851 Ga0496118_0156851_299_1228 280
339 3300049570 Ga0501033_0027543 Ga0501033_0027543_1838_2779 280
340 3300049570 Ga0501033_0036631 Ga0501033_0036631_2004_2927 280
341 3300049572 Ga0501036_0155354 Ga0501036_0155354_865_1788 280
342 3300049573 Ga0501037_0064035 Ga0501037_0064035_941_1915 280
343 3300049579 Ga0501043_0293199 Ga0501043_0293199_221_1183 280
344 3300049744 Ga0501083_0000019 Ga0501083_0000019_17022_17954 280
345 3300049823 Ga0501044_0024180 Ga0501044_0024180_913_1887 280
346 3300053177 Ga0500636_0009533 Ga0500636_0009533_1605_2525 280
347 iso_pu_bacteria 2515154155 2515856070 280
348 iso_pu_bacteria 2758568522 2760304915 280
349 iso_pu_bacteria 2758568621 2760621252 280
350 iso_pu_bacteria 2758568621 2760623481 280
351 iso_pu_bacteria 2773857759 2774382157 280
352 iso_pu_bacteria 2837268691 2837270891 280
353 iso_pu_bacteria 2837268691 2837272475 280
354 iso_pu_bacteria 2848551377 2848553896 280
355 3300013250 Ga0171462_1004 Ga0171462_1004589 281
356 3300013308 Ga0157375_10269392 Ga0157375_102693922 281
357 3300030522 Ga0307512_10005080 Ga0307512_100050801 281
358 3300031901 Ga0307406_10073391 Ga0307406_100733912 281
359 3300031901 Ga0307406_10167552 Ga0307406_101675521 281
360 3300031903 Ga0307407_10236808 Ga0307407_102368082 281
361 3300041404 Ga0439436_0000683 Ga0439436_0000683_858_1811 281
362 3300041413 Ga0439465_0043928 Ga0439465_0043928_470_1423 281
363 3300041999 Ga0439433_0000729 Ga0439433_0000729_4637_5590 281
364 3300042007 Ga0439449_0008433 Ga0439449_0008433_1514_2467 281
365 3300042014 Ga0439457_028029 Ga0439457_028029_112_1065 281
366 3300048922 Ga0496119_0002468 Ga0496119_0002468_1457_2383 281
367 3300049570 Ga0501033_0066468 Ga0501033_0066468_533_1474 281
368 3300049571 Ga0501034_0010113 Ga0501034_0010113_4514_5455 281
369 3300049579 Ga0501043_0058798 Ga0501043_0058798_1661_2602 281
370 3300049586 Ga0501070_0008293 Ga0501070_0008293_7386_8372 281
371 3300049586 Ga0501070_0253599 Ga0501070_0253599_438_1379 281
372 3300049588 Ga0501072_0007590 Ga0501072_0007590_4835_5821 281
373 3300049590 Ga0501074_0049266 Ga0501074_0049266_1150_2136 281
374 3300049742 Ga0501080_0195571 Ga0501080_0195571_501_1487 281
375 3300049744 Ga0501083_0000558 Ga0501083_0000558_2405_3391 281
376 3300049822 Ga0501035_0066759 Ga0501035_0066759_1197_2138 281
377 3300049823 Ga0501044_0030914 Ga0501044_0030914_3018_3959 281
378 3300060353 Ga0501082_0094460 Ga0501082_0094460_383_1369 281
379 iso_pu_bacteria 2811994880 2812363879 281
380 iso_pu_bacteria 2837268691 2837274862 281
381 iso_pu_bacteria 2884994152 2884996978 281
382 iso_pu_bacteria 2990088156 2990094486 281
383 3300006038 Ga0075365_10000802 Ga0075365_100008024 282
384 3300006051 Ga0075364_10009781 Ga0075364_100097815 282
385 3300006948 Ga0099826_10116643 Ga0099826_101166432 282
386 3300025898 Ga0207692_10001908 Ga0207692_100019084 282
387 3300041459 Ga0451800_0408773 Ga0451800_0408773_58_1011 282
388 3300044658 Ga0466972_0046832 Ga0466972_0046832_347_1300 282
389 3300044683 Ga0466965_0002706 Ga0466965_0002706_5142_6095 282
390 3300044683 Ga0466965_0003150 Ga0466965_0003150_1591_2544 282
391 3300044693 Ga0466961_0030055 Ga0466961_0030055_2456_3418 282
392 3300044765 Ga0466970_0007827 Ga0466970_0007827_3035_3997 282
393 3300046462 Ga0495651_0010267 Ga0495651_0010267_2578_3582 282
394 3300046463 Ga0495653_0010508 Ga0495653_0010508_2384_3388 282
395 3300046476 Ga0495662_0000888 Ga0495662_0000888_12869_13873 282
396 3300046477 Ga0495664_0007517 Ga0495664_0007517_3602_4606 282
397 3300046511 Ga0495608_0007841 Ga0495608_0007841_2314_3318 282
398 3300046516 Ga0495628_0005634 Ga0495628_0005634_8075_9079 282
399 3300046517 Ga0495630_0064890 Ga0495630_0064890_323_1327 282
400 3300046526 Ga0495666_0005974 Ga0495666_0005974_4692_5696 282
401 3300046529 Ga0495652_0017084 Ga0495652_0017084_1883_2887 282
402 3300046531 Ga0495665_0001299 Ga0495665_0001299_11843_12847 282
403 3300046533 Ga0495640_0001598 Ga0495640_0001598_16447_17451 282
404 3300046535 Ga0495586_0042887 Ga0495586_0042887_747_1751 282
405 3300046559 Ga0495667_0006995 Ga0495667_0006995_4134_5138 282
406 3300046663 Ga0495635_0032471 Ga0495635_0032471_282_1286 282
407 3300046675 Ga0495657_0000779 Ga0495657_0000779_2328_3332 282
408 3300046678 Ga0495599_0008391 Ga0495599_0008391_1417_2421 282
409 3300046680 Ga0495646_0107077 Ga0495646_0107077_24_1028 282
410 3300046689 Ga0495613_0001340 Ga0495613_0001340_15428_16432 282
411 3300046809 Ga0495600_0009498 Ga0495600_0009498_1417_2421 282
412 3300047317 Ga0495604_0000995 Ga0495604_0000995_2335_3339 282
413 3300047444 Ga0495675_0004875 Ga0495675_0004875_2339_3343 282
414 3300047471 Ga0495684_0039034 Ga0495684_0039034_2314_3318 282
415 3300048088 Ga0495602_0025227 Ga0495602_0025227_2388_3392 282
416 3300048922 Ga0496119_0000533 Ga0496119_0000533_5086_6030 282
417 3300048923 Ga0496120_0011887 Ga0496120_0011887_4997_5941 282
418 3300048924 Ga0496121_0000015 Ga0496121_0000015_448587_449531 282
419 3300049587 Ga0501071_0208364 Ga0501071_0208364_168_1121 282
420 3300050491 nmdc:mga00v17_5185_c1 nmdc:mga00v17_5185_c1_3551_4504 282
421 3300050491 nmdc:mga00v17_93544_c1 nmdc:mga00v17_93544_c1_260_1321 282
422 3300050492 nmdc:mga0yw44_6554_c1 nmdc:mga0yw44_6554_c1_900_1853 282
423 3300053085 Ga0495619_0013668 Ga0495619_0013668_514_1518 282
424 3300053108 Ga0500562_000853 Ga0500562_000853_1931_2884 282
425 iso_pu_bacteria 2643221690 2644505429 282
426 iso_pu_bacteria 2643221694 2644524770 282
427 iso_pu_bacteria 2643221722 2644668858 282
428 iso_pu_bacteria 2758568522 2760306156 282
429 iso_pu_bacteria 2895660088 2895662621 282
430 3300014497 Ga0182008_10092721 Ga0182008_100927212 283
431 3300025916 Ga0207663_10283782 Ga0207663_102837822 283
432 3300048925 Ga0496122_0160474 Ga0496122_0160474_426_1358 283
433 3300048927 Ga0496124_0019651 Ga0496124_0019651_3395_4327 283
434 3300053153 Ga0500616_0000384 Ga0500616_0000384_12907_13833 283
435 3300059491 Ga0587070_014117 Ga0587070_014117_20_976 283
436 3300059492 Ga0587073_0002778 Ga0587073_0002778_21_977 283
437 3300059493 Ga0587077_003123 Ga0587077_003123_334_1290 283
438 3300059505 Ga0587083_0002276 Ga0587083_0002276_47_1003 283
439 3300059512 Ga0587092_003139 Ga0587092_003139_825_1781 283
440 3300059623 Ga0587101_000801 Ga0587101_000801_1310_2266 283
441 3300059640 Ga0587067_002917 Ga0587067_002917_1009_1965 283
442 iso_pu_bacteria 2808606372 2808899586 283
443 iso_pu_bacteria 2816332119 2816427604 283
444 iso_pu_bacteria 2945968032 2945970989 283
445 iso_pu_bacteria 8046352972 8046355198 283
446 3300003544 Ga0007417J51691_1081063 Ga0007417J51691_10810631 284
447 3300003574 Ga0007410J51695_1031054 Ga0007410J51695_10310542 284
448 3300003579 Ga0007429J51699_1057706 Ga0007429J51699_10577062 284
449 3300003693 Ga0032354_1073790 Ga0032354_10737902 284
450 3300003735 Ga0006780_1026334 Ga0006780_10263342 284
451 3300005985 Ga0081539_10002019 Ga0081539_1000201918 284
452 3300006847 Ga0075431_100018665 Ga0075431_1000186654 284
453 3300031889 Ga0326468_10000014 Ga0326468_100000145 284
454 3300037312 Ga0395899_0034783 Ga0395899_0034783_1771_2715 284
455 3300037418 Ga0395900_0213790 Ga0395900_0213790_983_1927 284
456 3300037466 Ga0395898_0026693 Ga0395898_0026693_1273_2217 284
457 3300038443 Ga0395901_0017791 Ga0395901_0017791_5324_6268 284
458 3300038443 Ga0395901_0645952 Ga0395901_0645952_101_1045 284
459 3300041512 Ga0451853_2589370 Ga0451853_2589370_374_1318 284
460 3300044735 Ga0466968_0018202 Ga0466968_0018202_1610_2644 284
461 3300046463 Ga0495653_0017174 Ga0495653_0017174_3748_4704 284
462 3300049568 Ga0501031_0000112 Ga0501031_0000112_8529_9485 284
463 3300049569 Ga0501032_0014569 Ga0501032_0014569_2878_3834 284
464 3300049570 Ga0501033_0002294 Ga0501033_0002294_502_1458 284
465 3300049571 Ga0501034_0037972 Ga0501034_0037972_2496_3452 284
466 3300049572 Ga0501036_0001867 Ga0501036_0001867_2426_3382 284
467 3300049573 Ga0501037_0030276 Ga0501037_0030276_1554_2510 284
468 3300049574 Ga0501038_0007160 Ga0501038_0007160_6476_7432 284
469 3300049575 Ga0501039_0000369 Ga0501039_0000369_30582_31538 284
470 3300049576 Ga0501040_0030288 Ga0501040_0030288_916_1872 284
471 3300049578 Ga0501042_0173918 Ga0501042_0173918_17_973 284
472 3300049579 Ga0501043_0000679 Ga0501043_0000679_9208_10164 284
473 3300049580 Ga0501046_0000230 Ga0501046_0000230_53832_54788 284
474 3300049581 Ga0501047_0002902 Ga0501047_0002902_2548_3504 284
475 3300049582 Ga0501048_0000713 Ga0501048_0000713_9104_10060 284
476 3300049583 Ga0501067_0025109 Ga0501067_0025109_745_1701 284
477 3300049585 Ga0501069_0001968 Ga0501069_0001968_2306_3262 284
478 3300049586 Ga0501070_0000838 Ga0501070_0000838_11953_12909 284
479 3300049587 Ga0501071_0236294 Ga0501071_0236294_314_1270 284
480 3300049589 Ga0501073_0025766 Ga0501073_0025766_1734_2690 284
481 3300049590 Ga0501074_0070939 Ga0501074_0070939_1491_2447 284
482 3300049742 Ga0501080_0000870 Ga0501080_0000870_12622_13578 284
483 3300049744 Ga0501083_0076248 Ga0501083_0076248_756_1712 284
484 3300049822 Ga0501035_0010851 Ga0501035_0010851_1607_2563 284
485 3300049822 Ga0501035_0244145 Ga0501035_0244145_67_1041 284
486 3300049823 Ga0501044_0031624 Ga0501044_0031624_2879_3835 284
487 3300050510 nmdc:mga06r32_47408_c1 nmdc:mga06r32_47408_c1_2965_3954 284
488 3300054114 Ga0501084_0007981 Ga0501084_0007981_5263_6219 284
489 3300059491 Ga0587070_010517 Ga0587070_010517_390_1346 284
490 3300059492 Ga0587073_0002528 Ga0587073_0002528_1365_2321 284
491 3300059504 Ga0587082_000911 Ga0587082_000911_641_1597 284
492 3300059505 Ga0587083_0002815 Ga0587083_0002815_43_999 284
493 3300059511 Ga0587091_001408 Ga0587091_001408_1314_2270 284
494 3300059512 Ga0587092_001200 Ga0587092_001200_272_1228 284
495 3300059627 Ga0587117_011500 Ga0587117_011500_87_1043 284
496 3300059644 Ga0587075_001649 Ga0587075_001649_1216_2172 284
497 3300059652 Ga0587107_002398 Ga0587107_002398_21_977 284
498 iso_pu_bacteria 2690315906 2691515253 284
499 iso_pu_bacteria 2728369276 2729907432 284
500 iso_pu_bacteria 2775506735 2775655702 284
501 iso_pu_bacteria 2808606357 2808828435 284
502 iso_pu_bacteria 2808606360 2808849675 284
503 iso_pu_bacteria 2808606366 2808877728 284
504 iso_pu_bacteria 2808606370 2808892656 284
505 iso_pu_bacteria 2808606371 2808899181 284
506 iso_pu_bacteria 2811994871 2812319854 284
507 iso_pu_bacteria 2833709550 2833712784 284
508 iso_pu_bacteria 2857729791 2857732069 284
509 iso_pu_bacteria 2857740372 2857742287 284
510 iso_pu_bacteria 2904497146 2904500545 284
511 iso_pu_bacteria 2904776348 2904777207 284
512 iso_pu_bacteria 2910809715 2910814348 284
513 iso_pu_bacteria 2919034639 2919038274 284
514 iso_pu_bacteria 2919059106 2919059182 284
515 iso_pu_bacteria 2919538618 2919541212 284
516 iso_pu_bacteria 2928121344 2928124068 284
517 iso_pu_bacteria 2932426870 2932427364 284
518 iso_pu_bacteria 2933418574 2933420880 284
519 iso_pu_bacteria 2939598168 2939602437 284
520 iso_pu_bacteria 2939647034 2939650420 284
521 iso_pu_bacteria 2939674588 2939676781 284
522 iso_pu_bacteria 2945916053 2945917597 284
523 iso_pu_bacteria 2945920336 2945922116 284
524 iso_pu_bacteria 2945941187 2945941728 284
525 iso_pu_bacteria 2946037020 2946037632 284
526 iso_pu_bacteria 2946059875 2946061425 284
527 iso_pu_bacteria 2953998280 2953998905 284
528 iso_pu_bacteria 2974302888 2974305659 284
529 iso_pu_bacteria 8054107350 8054109681 284
530 iso_pu_bacteria 8056579771 8056583733 284
531 3300003203 JGI25406J46586_10004063 JGI25406J46586_100040636 285
532 3300003373 JGI25407J50210_10005774 JGI25407J50210_100057743 285
533 3300005981 Ga0081538_10000050 Ga0081538_1000005042 285
534 3300005985 Ga0081539_10003375 Ga0081539_100033759 285
535 3300031824 Ga0307413_10166355 Ga0307413_101663552 285
536 3300032002 Ga0307416_100163213 Ga0307416_1001632132 285
537 3300041404 Ga0439436_0010657 Ga0439436_0010657_594_1517 285
538 3300042002 Ga0439442_007444 Ga0439442_007444_542_1465 285
539 3300042007 Ga0439449_0008676 Ga0439449_0008676_652_1575 285
540 3300042014 Ga0439457_003241 Ga0439457_003241_3262_4185 285
541 3300044684 Ga0466966_0080996 Ga0466966_0080996_806_1789 285
542 3300044765 Ga0466970_0056039 Ga0466970_0056039_559_1524 285
543 3300045976 Ga0466967_0483565 Ga0466967_0483565_209_1174 285
544 3300048904 Ga0496101_0083830 Ga0496101_0083830_785_1762 285
545 3300048917 Ga0496114_0040127 Ga0496114_0040127_2654_3631 285
546 3300049570 Ga0501033_0027059 Ga0501033_0027059_1674_2615 285
547 3300049581 Ga0501047_0344354 Ga0501047_0344354_232_1173 285
548 3300049744 Ga0501083_0012760 Ga0501083_0012760_2069_3010 285
549 3300053151 Ga0500604_0010602 Ga0500604_0010602_934_1869 285
550 3300053153 Ga0500616_0003567 Ga0500616_0003567_6228_7163 285
551 iso_pu_bacteria 2739367654 2739608761 285
552 iso_pu_bacteria 2808606394 2809030256 285
553 iso_pu_bacteria 2816332119 2816421413 285
554 iso_pu_bacteria 8056060235 8056064585 285
555 3300003203 JGI25406J46586_10009823 JGI25406J46586_100098233 286
556 3300005985 Ga0081539_10000057 Ga0081539_10000057200 286
557 3300013105 Ga0157369_10026207 Ga0157369_100262073 286
558 3300013105 Ga0157369_10402858 Ga0157369_104028582 286
559 3300027876 Ga0209974_10041971 Ga0209974_100419711 286
560 3300037312 Ga0395899_0022179 Ga0395899_0022179_3843_4793 286
561 3300037312 Ga0395899_0027135 Ga0395899_0027135_2216_3157 286
562 3300037418 Ga0395900_0008527 Ga0395900_0008527_7660_8610 286
563 3300037466 Ga0395898_0035644 Ga0395898_0035644_410_1351 286
564 3300037466 Ga0395898_0048677 Ga0395898_0048677_2148_3098 286
565 3300037471 Ga0395905_0061834 Ga0395905_0061834_1784_2734 286
566 3300038443 Ga0395901_0074737 Ga0395901_0074737_1453_2394 286
567 3300046542 Ga0495597_0049274 Ga0495597_0049274_806_1762 286
568 3300048917 Ga0496114_0012605 Ga0496114_0012605_5310_6287 286
569 3300048918 Ga0496115_0034821 Ga0496115_0034821_2685_3662 286
570 3300049580 Ga0501046_0011051 Ga0501046_0011051_3490_4455 286
571 3300005337 Ga0070682_100061657 Ga0070682_1000616572 287
572 3300005937 Ga0081455_10000737 Ga0081455_1000073725 287
573 3300005937 Ga0081455_10017573 Ga0081455_100175735 287
574 3300005937 Ga0081455_10026568 Ga0081455_100265685 287
575 3300005937 Ga0081455_10035417 Ga0081455_100354173 287
576 3300005937 Ga0081455_10040335 Ga0081455_100403354 287
577 3300005985 Ga0081539_10042400 Ga0081539_100424002 287
578 3300006058 Ga0075432_10000007 Ga0075432_100000072 287
579 3300006844 Ga0075428_100046304 Ga0075428_1000463043 287
580 3300006844 Ga0075428_100065149 Ga0075428_1000651493 287
581 3300006846 Ga0075430_100406290 Ga0075430_1004062902 287
582 3300006847 Ga0075431_100139831 Ga0075431_1001398312 287
583 3300006852 Ga0075433_10006291 Ga0075433_100062912 287
584 3300006871 Ga0075434_100000163 Ga0075434_1000001634 287
585 3300006871 Ga0075434_100072255 Ga0075434_1000722552 287
586 3300006914 Ga0075436_100001036 Ga0075436_1000010362 287
587 3300007076 Ga0075435_100001686 Ga0075435_1000016862 287
588 3300009094 Ga0111539_10000078 Ga0111539_1000007890 287
589 3300009094 Ga0111539_10031641 Ga0111539_100316412 287
590 3300009094 Ga0111539_10093908 Ga0111539_100939082 287
591 3300009147 Ga0114129_10075130 Ga0114129_100751303 287
592 3300009147 Ga0114129_10222741 Ga0114129_102227412 287
593 3300009176 Ga0105242_10386668 Ga0105242_103866681 287
594 3300010375 Ga0105239_10225290 Ga0105239_102252902 287
595 3300025901 Ga0207688_10051785 Ga0207688_100517853 287
596 3300027907 Ga0207428_10000662 Ga0207428_100006622 287
597 3300027907 Ga0207428_10006298 Ga0207428_100062988 287
598 3300027907 Ga0207428_10088416 Ga0207428_100884161 287
599 3300031548 Ga0307408_100002815 Ga0307408_1000028152 287
600 3300031548 Ga0307408_100043234 Ga0307408_1000432343 287
601 3300031731 Ga0307405_10016478 Ga0307405_100164783 287
602 3300031731 Ga0307405_10045587 Ga0307405_100455872 287
603 3300031852 Ga0307410_10067432 Ga0307410_100674322 287
604 3300031852 Ga0307410_10106889 Ga0307410_101068891 287
605 3300031901 Ga0307406_10000019 Ga0307406_100000192 287
606 3300031903 Ga0307407_10001475 Ga0307407_100014752 287
607 3300031911 Ga0307412_10021870 Ga0307412_100218702 287
608 3300031911 Ga0307412_10108712 Ga0307412_101087121 287
609 3300031911 Ga0307412_10308910 Ga0307412_103089102 287
610 3300031911 Ga0307412_10430297 Ga0307412_104302971 287
611 3300031995 Ga0307409_100000024 Ga0307409_1000000249 287
612 3300032002 Ga0307416_100000040 Ga0307416_100000040108 287
613 3300032002 Ga0307416_100048054 Ga0307416_1000480543 287
614 3300032004 Ga0307414_10042056 Ga0307414_100420562 287
615 3300032005 Ga0307411_10008677 Ga0307411_100086774 287
616 3300032005 Ga0307411_10108517 Ga0307411_101085172 287
617 3300032126 Ga0307415_100011198 Ga0307415_1000111984 287
618 3300032126 Ga0307415_100066323 Ga0307415_1000663232 287
619 3300042016 Ga0439463_003841 Ga0439463_003841_308_1264 287
620 3300042437 Ga0439444_0004741 Ga0439444_0004741_967_1923 287
621 3300044683 Ga0466965_0000019 Ga0466965_0000019_2679_3614 287
622 3300049569 Ga0501032_0027505 Ga0501032_0027505_1328_2263 287
623 3300049569 Ga0501032_0102303 Ga0501032_0102303_225_1160 287
624 3300049570 Ga0501033_0034953 Ga0501033_0034953_2768_3703 287
625 3300049570 Ga0501033_0065927 Ga0501033_0065927_1049_1984 287
626 3300049571 Ga0501034_0038852 Ga0501034_0038852_975_1910 287
627 3300049571 Ga0501034_0080887 Ga0501034_0080887_163_1098 287
628 3300049571 Ga0501034_0224328 Ga0501034_0224328_420_1355 287
629 3300049573 Ga0501037_0014339 Ga0501037_0014339_1495_2430 287
630 3300049574 Ga0501038_0101199 Ga0501038_0101199_1425_2360 287
631 3300049574 Ga0501038_0124605 Ga0501038_0124605_72_1007 287
632 3300049575 Ga0501039_0052534 Ga0501039_0052534_280_1215 287
633 3300049579 Ga0501043_0061837 Ga0501043_0061837_411_1397 287
634 3300049579 Ga0501043_0092421 Ga0501043_0092421_1098_2033 287
635 3300049581 Ga0501047_0023386 Ga0501047_0023386_298_1284 287
636 3300049581 Ga0501047_0137918 Ga0501047_0137918_274_1209 287
637 3300049581 Ga0501047_0369025 Ga0501047_0369025_68_1003 287
638 3300049583 Ga0501067_0184274 Ga0501067_0184274_57_992 287
639 3300049589 Ga0501073_0180741 Ga0501073_0180741_92_1027 287
640 3300049675 Ga0501243_001947 Ga0501243_001947_1540_2496 287
641 3300049822 Ga0501035_0005907 Ga0501035_0005907_6811_7797 287
642 3300049851 Ga0501212_003302 Ga0501212_003302_419_1375 287
643 3300050507 nmdc:mga05p37_177898_c1 nmdc:mga05p37_177898_c1_1077_2033 287
644 3300050509 nmdc:mga0qj67_358556_c1 nmdc:mga0qj67_358556_c1_135_1091 287
645 3300050511 nmdc:mga08y16_22896_c1 nmdc:mga08y16_22896_c1_1279_2235 287
646 3300050511 nmdc:mga08y16_73623_c1 nmdc:mga08y16_73623_c1_1074_2030 287
647 3300050511 nmdc:mga08y16_80833_c1 nmdc:mga08y16_80833_c1_1419_2375 287
648 3300050512 nmdc:mga0n895_200_c1 nmdc:mga0n895_200_c1_2240_3196 287
649 3300050512 nmdc:mga0n895_66676_c1 nmdc:mga0n895_66676_c1_1412_2368 287
650 3300050512 nmdc:mga0n895_78222_c1 nmdc:mga0n895_78222_c1_464_1420 287
651 3300050513 nmdc:mga0rr50_842_c1 nmdc:mga0rr50_842_c1_12008_12964 287
652 3300050514 nmdc:mga08x19_1049_c1 nmdc:mga08x19_1049_c1_752_1708 287
653 3300050515 nmdc:mga0a205_109336_c1 nmdc:mga0a205_109336_c1_1385_2341 287
654 3300050515 nmdc:mga0a205_116_c3 nmdc:mga0a205_116_c3_2580_3536 287
655 3300059490 Ga0587066_008637 Ga0587066_008637_241_1197 287
656 3300059491 Ga0587070_007899 Ga0587070_007899_241_1197 287
657 3300059493 Ga0587077_005203 Ga0587077_005203_38_994 287
658 3300059644 Ga0587075_003232 Ga0587075_003232_120_1076 287
659 3300059647 Ga0587079_005537 Ga0587079_005537_827_1783 287
660 3300001979 JGI24740J21852_10026220 JGI24740J21852_100262202 288
661 3300001989 JGI24739J22299_10016370 JGI24739J22299_100163702 288
662 3300001990 JGI24737J22298_10006891 JGI24737J22298_100068913 288
663 3300002067 JGI24735J21928_10048850 JGI24735J21928_100488502 288
664 3300005337 Ga0070682_100102394 Ga0070682_1001023942 288
665 3300005347 Ga0070668_100089555 Ga0070668_1000895552 288
666 3300005539 Ga0068853_100259231 Ga0068853_1002592312 288
667 3300005577 Ga0068857_100023416 Ga0068857_1000234162 288
668 3300006058 Ga0075432_10007054 Ga0075432_100070543 288
669 3300006237 Ga0097621_100346750 Ga0097621_1003467501 288
670 3300009036 Ga0105244_10011771 Ga0105244_100117714 288
671 3300009176 Ga0105242_10337297 Ga0105242_103372972 288
672 3300011119 Ga0105246_10006494 Ga0105246_100064943 288
673 3300011119 Ga0105246_10006584 Ga0105246_100065842 288
674 3300011119 Ga0105246_10019358 Ga0105246_100193581 288
675 3300013105 Ga0157369_10103516 Ga0157369_101035163 288
676 3300013307 Ga0157372_10279135 Ga0157372_102791352 288
677 3300025303 Ga0209051_1001809 Ga0209051_10018093 288
678 3300025315 Ga0207697_10004027 Ga0207697_100040274 288
679 3300025728 Ga0207655_1009481 Ga0207655_10094814 288
680 3300025904 Ga0207647_10009069 Ga0207647_100090694 288
681 3300025932 Ga0207690_10287722 Ga0207690_102877221 288
682 3300025961 Ga0207712_10423300 Ga0207712_104233001 288
683 3300025986 Ga0207658_10133646 Ga0207658_101336462 288
684 3300026041 Ga0207639_10190915 Ga0207639_101909152 288
685 3300026067 Ga0207678_10126680 Ga0207678_101266802 288
686 3300026116 Ga0207674_10049585 Ga0207674_100495853 288
687 3300027907 Ga0207428_10045197 Ga0207428_100451972 288
688 3300027907 Ga0207428_10110571 Ga0207428_101105712 288
689 3300031456 Ga0307513_10114752 Ga0307513_101147523 288
690 3300031548 Ga0307408_100001012 Ga0307408_10000101212 288
691 3300031548 Ga0307408_100020440 Ga0307408_1000204403 288
692 3300031548 Ga0307408_100080760 Ga0307408_1000807602 288
693 3300031548 Ga0307408_100087272 Ga0307408_1000872722 288
694 3300031548 Ga0307408_100125168 Ga0307408_1001251682 288
695 3300031548 Ga0307408_100396952 Ga0307408_1003969521 288
696 3300031731 Ga0307405_10020274 Ga0307405_100202741 288
697 3300031731 Ga0307405_10066943 Ga0307405_100669432 288
698 3300031731 Ga0307405_10107100 Ga0307405_101071002 288
699 3300031731 Ga0307405_10217141 Ga0307405_102171412 288
700 3300031731 Ga0307405_10274589 Ga0307405_102745892 288
701 3300031824 Ga0307413_10018500 Ga0307413_100185002 288
702 3300031824 Ga0307413_10019858 Ga0307413_100198584 288
703 3300031824 Ga0307413_10033541 Ga0307413_100335413 288
704 3300031824 Ga0307413_10141722 Ga0307413_101417222 288
705 3300031852 Ga0307410_10027075 Ga0307410_100270752 288
706 3300031852 Ga0307410_10035602 Ga0307410_100356022 288
707 3300031852 Ga0307410_10084852 Ga0307410_100848521 288
708 3300031852 Ga0307410_10088514 Ga0307410_100885142 288
709 3300031852 Ga0307410_10108360 Ga0307410_101083602 288
710 3300031901 Ga0307406_10083097 Ga0307406_100830972 288
711 3300031901 Ga0307406_10140767 Ga0307406_101407672 288
712 3300031901 Ga0307406_10231643 Ga0307406_102316431 288
713 3300031903 Ga0307407_10011039 Ga0307407_100110392 288
714 3300031903 Ga0307407_10033918 Ga0307407_100339181 288
715 3300031903 Ga0307407_10044386 Ga0307407_100443863 288
716 3300031911 Ga0307412_10001015 Ga0307412_100010159 288
717 3300031911 Ga0307412_10026992 Ga0307412_100269922 288
718 3300031911 Ga0307412_10036484 Ga0307412_100364842 288
719 3300031911 Ga0307412_10041593 Ga0307412_100415932 288
720 3300031911 Ga0307412_10136452 Ga0307412_101364522 288
721 3300031911 Ga0307412_10223628 Ga0307412_102236282 288
722 3300031911 Ga0307412_10230707 Ga0307412_102307072 288
723 3300031911 Ga0307412_10236276 Ga0307412_102362762 288
724 3300031911 Ga0307412_10252403 Ga0307412_102524032 288
725 3300031995 Ga0307409_100037824 Ga0307409_1000378243 288
726 3300031995 Ga0307409_100137952 Ga0307409_1001379522 288
727 3300031995 Ga0307409_100159704 Ga0307409_1001597042 288
728 3300032002 Ga0307416_100020331 Ga0307416_1000203314 288
729 3300032002 Ga0307416_100022408 Ga0307416_1000224083 288
730 3300032002 Ga0307416_100128287 Ga0307416_1001282872 288
731 3300032002 Ga0307416_100268381 Ga0307416_1002683811 288
732 3300032005 Ga0307411_10055609 Ga0307411_100556091 288
733 3300032005 Ga0307411_10093907 Ga0307411_100939072 288
734 3300032005 Ga0307411_10252513 Ga0307411_102525132 288
735 3300032126 Ga0307415_100006009 Ga0307415_1000060093 288
736 3300032126 Ga0307415_100035008 Ga0307415_1000350081 288
737 3300037312 Ga0395899_0073520 Ga0395899_0073520_1130_2074 288
738 3300037418 Ga0395900_0015527 Ga0395900_0015527_5156_6100 288
739 3300037418 Ga0395900_0053543 Ga0395900_0053543_2130_3074 288
740 3300037466 Ga0395898_0063855 Ga0395898_0063855_203_1147 288
741 3300038443 Ga0395901_0073476 Ga0395901_0073476_993_1937 288
742 3300038443 Ga0395901_0170079 Ga0395901_0170079_1008_1952 288
743 3300041404 Ga0439436_0006583 Ga0439436_0006583_1795_2739 288
744 3300041411 Ga0439466_0007754 Ga0439466_0007754_2688_3632 288
745 3300041999 Ga0439433_0000759 Ga0439433_0000759_4238_5182 288
746 3300041999 Ga0439433_0009460 Ga0439433_0009460_702_1646 288
747 3300042002 Ga0439442_000821 Ga0439442_000821_2630_3574 288
748 3300042002 Ga0439442_002321 Ga0439442_002321_1603_2547 288
749 3300042002 Ga0439442_030779 Ga0439442_030779_123_1067 288
750 3300042007 Ga0439449_0001548 Ga0439449_0001548_1695_2639 288
751 3300042007 Ga0439449_0006758 Ga0439449_0006758_1953_2897 288
752 3300042014 Ga0439457_004666 Ga0439457_004666_719_1663 288
753 3300042015 Ga0439462_0007302 Ga0439462_0007302_1768_2712 288
754 3300042122 Ga0450920_000660 Ga0450920_000660_984_1928 288
755 3300042435 Ga0439434_0072571 Ga0439434_0072571_27_971 288
756 3300046492 Ga0495585_0113760 Ga0495585_0113760_433_1392 288
757 3300046615 Ga0495656_0002387 Ga0495656_0002387_5218_6162 288
758 3300046691 Ga0495670_0000463 Ga0495670_0000463_5795_6739 288
759 3300048906 Ga0496103_0010753 Ga0496103_0010753_3868_4821 288
760 3300048913 Ga0496110_0499289 Ga0496110_0499289_85_1038 288
761 3300048927 Ga0496124_0047953 Ga0496124_0047953_1643_2632 288
762 3300049569 Ga0501032_0004795 Ga0501032_0004795_7254_8198 288
763 3300049569 Ga0501032_0006992 Ga0501032_0006992_4825_5769 288
764 3300049571 Ga0501034_0000042 Ga0501034_0000042_223369_224313 288
765 3300049573 Ga0501037_0014282 Ga0501037_0014282_2466_3410 288
766 3300049573 Ga0501037_0022295 Ga0501037_0022295_1265_2209 288
767 3300049574 Ga0501038_0090819 Ga0501038_0090819_896_1840 288
768 3300049575 Ga0501039_0095822 Ga0501039_0095822_1283_2227 288
769 3300049575 Ga0501039_0217070 Ga0501039_0217070_246_1190 288
770 3300049579 Ga0501043_0031651 Ga0501043_0031651_1087_2031 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

129

356

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6336 54 279
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.6305 54 272
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.6303 54 274
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.6294 61 276
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6054 25 276
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7318 62 285 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7277 154 281 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7271 62 281 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7015 62 281 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6937 62 281 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2D6YLF3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9606 166 288 GO:0005886
GO:0055085
AF-A0A059WS29-F1-model_v4 Binding-protein-dependent transport system inner membrane component 0.9571 128 287 GO:0005886
GO:0055085
AF-A0A2W5HI08-F1-model_v4 ABC transporter permease 0.9425 188 288 GO:0005886
GO:0055085
AF-A0A2S5VQ39-F1-model_v4 ABC transporter permease 0.9401 140 287 GO:0005886
GO:0055085
AF-A0A4V1TA30-F1-model_v4 deleted 0.9398 166 288

Feature Viewer

pLDDT pTM Quality
76.86 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map