F479666

General Info

Members Datasets Scaffolds Average Seq Length
762 544 1524 166

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2935648319|2935649548
Length 201
Sequence GWSELVLIGVVALIAIGPKELPGVLRMVGQWMGKARKMAAEFQGQFQEAMREAEMADLKKSFDEVKEAASGFAGNNLMTSLQKDVSDALRVDALDKPAETSTTAAVEPPATSSEALATSSEALATSSEALATSSELPATPTTPEAPTPETFVEAEAHAAVNEPLAITREVEQAQVAQGSVTQDSVIQDTAPAEAIKDAKAS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
62 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
100 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
101 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
147 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
148 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
197 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
236 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
302 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
305 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
306 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
307 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
308 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
309 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
312 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
315 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
316 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
319 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
320 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
325 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
328 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
331 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
332 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
333 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
334 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
335 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
336 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
337 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
338 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
339 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
340 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
341 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
342 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
343 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
344 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
345 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
346 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
347 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
348 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
349 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
350 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
351 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
352 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
353 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
354 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
355 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
356 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
357 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
358 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
359 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
360 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
361 2791355199
362 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
363 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
364 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
365 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
366 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
367 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
368 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
369 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
370 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
371 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
372 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
373 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
374 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
375 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
376 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
377 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
378 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
379 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
380 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
381 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
382 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
383 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
384 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
385 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
386 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
387 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
388 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
389 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
390 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
391 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
392 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
393 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
394 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
395 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
396 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
397 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
398 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
399 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
400 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
401 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
402 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
403 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
404 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
405 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
406 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
407 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
408 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
409 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
410 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
411 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
412 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
413 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
414 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
415 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
416 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
417 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
418 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
419 2904699407
420 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
421 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
422 2906610324
423 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
424 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
425 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
426 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
427 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
428 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
429 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
430 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
431 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
432 2922368715
433 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
434 2922425934
435 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
436 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
437 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
438 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
439 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
440 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
441 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
442 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
443 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
444 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
445 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
446 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
447 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
448 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
449 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
450 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
451 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
452 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
453 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
454 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
455 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
456 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
457 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
458 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
459 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
460 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
461 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
462 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
463 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
464 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
465 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
466 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
467 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
468 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
469 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
470 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
471 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
472 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
473 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
474 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
475 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
476 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
477 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
478 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
479 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
480 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
481 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
482 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
483 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
484 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
485 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
486 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
487 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
488 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
489 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
490 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
491 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
492 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
493 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
494 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
495 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
496 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
497 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
498 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
499 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
500 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
501 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
502 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
503 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
504 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
505 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
506 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
507 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
508 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
509 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
510 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
511 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
512 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
513 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
514 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
515 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
516 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
517 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
518 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
519 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
520 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
521 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
522 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
523 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
524 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
525 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
526 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
527 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
528 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
529 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
530 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
531 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
532 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
533 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
534 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
535 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
536 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
537 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
538 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
539 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
540 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
541 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
542 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
543 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
544 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.41
Metatranscriptomes 1.98
Isolates 27.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 21.26
Rhizoplane 3.02
Rhizosphere 56.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005380 3300001979 Bacteria 5423
2 JGI24737J22298_10027637 3300001990 Bacteria 1788
3 JGI24735J21928_10006861 3300002067 Bacteria 3728
4 JGI25406J46586_10000029 3300003203 Bacteria 70143
5 JGI25165J46597_1018610 3300003214 Bacteria 920
6 Ga0055539_1020437 3300003752 Bacteria 790
7 Ga0065707_10309970 3300005295 Bacteria 986
8 Ga0070658_10474332 3300005327 Bacteria 1079
9 Ga0070683_100012000 3300005329 Bacteria 7516
10 Ga0068869_100245268 3300005334 Bacteria 1428
11 Ga0068868_100088762 3300005338 Bacteria 2488
12 Ga0070660_100524511 3300005339 Bacteria 987
13 Ga0070691_10250555 3300005341 Bacteria 949
14 Ga0070687_100155558 3300005343 Bacteria 1346
15 Ga0070692_10131783 3300005345 Bacteria 1406
16 Ga0070668_100074341 3300005347 Bacteria 2651
17 Ga0070675_100248937 3300005354 Bacteria 1554
18 Ga0070671_100305450 3300005355 Bacteria 1355
19 Ga0070673_100592201 3300005364 Bacteria 1011
20 Ga0070659_100255997 3300005366 Bacteria 1451
21 Ga0070708_100388705 3300005445 Bacteria 1316
22 Ga0070663_100031255 3300005455 Bacteria 3658
23 Ga0070663_100040635 3300005455 Bacteria 3258
24 Ga0070663_100203447 3300005455 Bacteria 1546
25 Ga0070678_100733390 3300005456 Bacteria 893
26 Ga0070706_101086527 3300005467 Bacteria 736
27 Ga0070684_100012965 3300005535 Bacteria 6703
28 Ga0070697_100117118 3300005536 Bacteria 2225
29 Ga0068853_100317074 3300005539 Bacteria 1445
30 Ga0070696_100196338 3300005546 Bacteria 1504
31 Ga0070696_100513036 3300005546 Bacteria 955
32 Ga0070693_100448964 3300005547 Bacteria 904
33 Ga0070665_100045631 3300005548 Bacteria 4401
34 Ga0070665_100115498 3300005548 Bacteria 2687
35 Ga0070665_100130792 3300005548 Bacteria 2512
36 Ga0070665_100146951 3300005548 Bacteria 2360
37 Ga0070665_100204457 3300005548 Bacteria 1975
38 Ga0068855_100030416 3300005563 Bacteria 6459
39 Ga0068855_100149163 3300005563 Bacteria 2659
40 Ga0068855_100210621 3300005563 Bacteria 2184
41 Ga0068855_100499153 3300005563 Bacteria 1322
42 Ga0070664_100433789 3300005564 Bacteria 1204
43 Ga0070664_100509789 3300005564 Bacteria 1109
44 Ga0070664_101338311 3300005564 Bacteria 677
45 Ga0068857_100197039 3300005577 Bacteria 1835
46 Ga0068854_100000966 3300005578 Bacteria 17304
47 Ga0068854_100181847 3300005578 Bacteria 1643
48 Ga0068854_100746796 3300005578 Bacteria 848
49 Ga0068854_100838959 3300005578 Bacteria 804
50 Ga0068856_100003361 3300005614 Bacteria 16212
51 Ga0068856_100057021 3300005614 Bacteria 3856
52 Ga0068856_101622787 3300005614 Bacteria 660
53 Ga0068852_100792308 3300005616 Bacteria 961
54 Ga0068859_100123228 3300005617 Bacteria 2659
55 Ga0068864_100999501 3300005618 Bacteria 830
56 Ga0068861_100124839 3300005719 Bacteria 2081
57 Ga0068861_100240537 3300005719 Bacteria 1539
58 Ga0068863_100224458 3300005841 Bacteria 1811
59 Ga0068858_100018465 3300005842 Bacteria 6529
60 Ga0068860_100249384 3300005843 Bacteria 1728
61 Ga0068862_100481793 3300005844 Bacteria 1174
62 Ga0068862_101704306 3300005844 Bacteria 638
63 Ga0081455_10006771 3300005937 Bacteria 12228
64 Ga0081540_1006816 3300005983 Bacteria 8252
65 Ga0081540_1117521 3300005983 Bacteria 1111
66 Ga0081539_10000379 3300005985 Bacteria 97134
67 Ga0081539_10001714 3300005985 Bacteria 35156
68 Ga0075365_10098774 3300006038 Bacteria 1997
69 Ga0075368_10029287 3300006042 Bacteria 2128
70 Ga0075368_10135374 3300006042 Bacteria 1025
71 Ga0075363_100000537 3300006048 Bacteria 12253
72 Ga0075363_100202884 3300006048 Bacteria 1133
73 Ga0075364_10069135 3300006051 Bacteria 2323
74 Ga0070712_100555726 3300006175 Bacteria 967
75 Ga0075367_10201242 3300006178 Bacteria 1244
76 Ga0075367_10486564 3300006178 Bacteria 782
77 Ga0075369_10203727 3300006186 Bacteria 913
78 Ga0075427_10046420 3300006194 Bacteria 741
79 Ga0097621_100215701 3300006237 Bacteria 1670
80 Ga0075370_10038750 3300006353 Bacteria 2683
81 Ga0075370_10097336 3300006353 Bacteria 1701
82 Ga0075370_10350825 3300006353 Bacteria 881
83 Ga0068871_100192474 3300006358 Bacteria 1757
84 Ga0075434_100074375 3300006871 Bacteria 3391
85 Ga0075436_100750793 3300006914 Bacteria 725
86 Ga0097620_100123230 3300006931 Bacteria 2659
87 Ga0099824_1020964 3300006942 Bacteria 4669
88 Ga0099822_1058602 3300006943 Bacteria 1337
89 Ga0099795_10079078 3300007788 Bacteria 1255
90 Ga0105250_10033685 3300009092 Bacteria 2057
91 Ga0105240_10202867 3300009093 Bacteria 2323
92 Ga0105240_10213488 3300009093 Bacteria 2253
93 Ga0105240_10561103 3300009093 Bacteria 1262
94 Ga0105240_11846650 3300009093 Bacteria 629
95 Ga0105245_10192381 3300009098 Bacteria 1955
96 Ga0105245_10988481 3300009098 Bacteria 885
97 Ga0105245_11876141 3300009098 Bacteria 652
98 Ga0114129_10225442 3300009147 Bacteria 2526
99 Ga0105243_10103348 3300009148 Bacteria 2369
100 Ga0105241_10143856 3300009174 Bacteria 1944
101 Ga0105241_10505422 3300009174 Bacteria 1078
102 Ga0105242_10905384 3300009176 Bacteria 882
103 Ga0105248_10907809 3300009177 Bacteria 995
104 Ga0105237_10383130 3300009545 Bacteria 1411
105 Ga0105237_11223647 3300009545 Bacteria 757
106 Ga0105238_10002475 3300009551 Bacteria 18487
107 Ga0105238_10003960 3300009551 Bacteria 14692
108 Ga0105238_10067659 3300009551 Bacteria 3573
109 Ga0105238_10264638 3300009551 Bacteria 1699
110 Ga0105238_10615374 3300009551 Bacteria 1094
111 Ga0105249_10330994 3300009553 Bacteria 1537
112 Ga0105249_10476581 3300009553 Bacteria 1290
113 Ga0099796_10025320 3300010159 Bacteria 1872
114 Ga0099796_10163090 3300010159 Bacteria 885
115 Ga0105239_10024851 3300010375 Bacteria 6598
116 Ga0105239_10108947 3300010375 Bacteria 3068
117 Ga0105239_10120061 3300010375 Bacteria 2918
118 Ga0105239_10533313 3300010375 Bacteria 1336
119 Ga0105246_10262734 3300011119 Bacteria 1376
120 Ga0157373_10235929 3300013100 Bacteria 1292
121 Ga0157373_10440828 3300013100 Bacteria 936
122 Ga0157370_10127209 3300013104 Bacteria 2378
123 Ga0157369_10218921 3300013105 Bacteria 1993
124 Ga0157374_10259691 3300013296 Bacteria 1710
125 Ga0157378_10013488 3300013297 Bacteria 7146
126 Ga0157378_10354746 3300013297 Bacteria 1434
127 Ga0163162_10689339 3300013306 Bacteria 1144
128 Ga0163162_11111804 3300013306 Bacteria 895
129 Ga0163162_11330256 3300013306 Bacteria 817
130 Ga0157372_10492480 3300013307 Bacteria 1429
131 Ga0157372_11263431 3300013307 Bacteria 852
132 Ga0157372_11619715 3300013307 Bacteria 745
133 Ga0157375_10751736 3300013308 Bacteria 1126
134 Ga0163163_10616739 3300014325 Bacteria 1148
135 Ga0163163_10938846 3300014325 Bacteria 928
136 Ga0157380_10636890 3300014326 Bacteria 1061
137 Ga0157379_10845068 3300014968 Bacteria 866
138 Ga0157376_10265929 3300014969 Bacteria 1609
139 Ga0163161_10348799 3300017792 Bacteria 1176
140 Ga0197907_10460259 3300020069 Bacteria 1145
141 Ga0197907_11073140 3300020069 Bacteria 749
142 Ga0206356_10649126 3300020070 Bacteria 1056
143 Ga0206349_1641650 3300020075 Bacteria 630
144 Ga0206355_1198159 3300020076 Bacteria 1149
145 Ga0206351_10298373 3300020077 Bacteria 1133
146 Ga0206352_10123997 3300020078 Bacteria 863
147 Ga0206352_10244717 3300020078 Bacteria 903
148 Ga0206350_10092383 3300020080 Bacteria 1769
149 Ga0154015_1321210 3300020610 Bacteria 950
150 Ga0214544_1000051 3300021320 Bacteria 134645
151 Ga0214542_1000149 3300021321 Bacteria 102700
152 Ga0214545_1000126 3300021324 Bacteria 91489
153 Ga0214543_1000148 3300021327 Bacteria 98370
154 Ga0224712_10045162 3300022467 Bacteria 1684
155 Ga0224712_10074068 3300022467 Bacteria 1390
156 Ga0224712_10175410 3300022467 Bacteria 963
157 Ga0209677_100663 3300025253 Bacteria 17947
158 Ga0209677_101621 3300025253 Bacteria 9490
159 Ga0209233_1004776 3300025261 Bacteria 4566
160 Ga0209564_1005824 3300025295 Bacteria 6872
161 Ga0209758_1000521 3300025297 Bacteria 61693
162 Ga0209758_1024000 3300025297 Bacteria 2734
163 Ga0207697_10262460 3300025315 Bacteria 765
164 Ga0207653_10007642 3300025885 Bacteria 3372
165 Ga0207642_10162995 3300025899 Bacteria 1199
166 Ga0207688_10061522 3300025901 Bacteria 2116
167 Ga0207647_10001630 3300025904 Bacteria 17263
168 Ga0207643_10108886 3300025908 Bacteria 1631
169 Ga0207684_10503599 3300025910 Bacteria 1038
170 Ga0207654_10000321 3300025911 Bacteria 28754
171 Ga0207654_10003420 3300025911 Bacteria 8024
172 Ga0207707_10631985 3300025912 Bacteria 904
173 Ga0207695_10000822 3300025913 Bacteria 57493
174 Ga0207695_10002470 3300025913 Bacteria 27240
175 Ga0207671_10035837 3300025914 Bacteria 3679
176 Ga0207671_10244029 3300025914 Bacteria 1411
177 Ga0207693_10690336 3300025915 Bacteria 791
178 Ga0207663_10012968 3300025916 Bacteria 4520
179 Ga0207694_10000095 3300025924 Bacteria 99130
180 Ga0207694_10025361 3300025924 Bacteria 4506
181 Ga0207694_10064064 3300025924 Bacteria 2864
182 Ga0207694_10306707 3300025924 Bacteria 1308
183 Ga0207687_10824326 3300025927 Bacteria 792
184 Ga0207706_10245532 3300025933 Bacteria 1564
185 Ga0207706_10362880 3300025933 Bacteria 1258
186 Ga0207709_10419260 3300025935 Bacteria 1028
187 Ga0207670_10129891 3300025936 Bacteria 1844
188 Ga0207669_11046408 3300025937 Bacteria 687
189 Ga0207691_10911635 3300025940 Bacteria 735
190 Ga0207711_10094035 3300025941 Bacteria 2641
191 Ga0207689_10037986 3300025942 Bacteria 3990
192 Ga0207689_10132795 3300025942 Bacteria 2049
193 Ga0207689_10178020 3300025942 Bacteria 1754
194 Ga0207661_10001062 3300025944 Bacteria 18274
195 Ga0207679_10991923 3300025945 Bacteria 770
196 Ga0207667_10020629 3300025949 Bacteria 7323
197 Ga0207667_10158307 3300025949 Bacteria 2330
198 Ga0207667_10330345 3300025949 Bacteria 1557
199 Ga0207667_10518875 3300025949 Bacteria 1207
200 Ga0207667_10927740 3300025949 Bacteria 861
201 Ga0207712_10063647 3300025961 Bacteria 2627
202 Ga0207712_10127549 3300025961 Bacteria 1934
203 Ga0207712_10686652 3300025961 Bacteria 892
204 Ga0207668_10054781 3300025972 Bacteria 2769
205 Ga0207640_10565210 3300025981 Bacteria 958
206 Ga0207640_10632635 3300025981 Bacteria 910
207 Ga0207658_10308440 3300025986 Bacteria 1366
208 Ga0207677_10007903 3300026023 Bacteria 5913
209 Ga0207677_11205467 3300026023 Bacteria 693
210 Ga0207639_10032020 3300026041 Bacteria 3868
211 Ga0207639_10185256 3300026041 Bacteria 1774
212 Ga0207639_10453015 3300026041 Bacteria 1165
213 Ga0207639_10737084 3300026041 Bacteria 916
214 Ga0207678_10018096 3300026067 Bacteria 6188
215 Ga0207678_10087533 3300026067 Bacteria 2662
216 Ga0207678_10405279 3300026067 Bacteria 1181
217 Ga0207678_10609981 3300026067 Bacteria 957
218 Ga0207678_10752176 3300026067 Bacteria 859
219 Ga0207702_10000025 3300026078 Bacteria 186312
220 Ga0207702_10622731 3300026078 Bacteria 1060
221 Ga0207702_10978222 3300026078 Bacteria 839
222 Ga0207676_10776116 3300026095 Bacteria 933
223 Ga0207674_10005830 3300026116 Bacteria 14612
224 Ga0207674_10177151 3300026116 Bacteria 2085
225 Ga0207674_10284876 3300026116 Bacteria 1601
226 Ga0207675_100030053 3300026118 Bacteria 5058
227 Ga0207683_10451783 3300026121 Bacteria 1185
228 Ga0207698_10010299 3300026142 Bacteria 5996
229 Ga0207698_10227302 3300026142 Bacteria 1691
230 Ga0209389_1000656 3300027296 Bacteria 21454
231 Ga0209589_1000874 3300027357 Bacteria 45837
232 Ga0209489_100178 3300027361 Bacteria 99953
233 Ga0209813_10046702 3300027866 Bacteria 1339
234 Ga0268266_10014666 3300028379 Bacteria 6732
235 Ga0268266_10049514 3300028379 Bacteria 3603
236 Ga0268266_10151802 3300028379 Bacteria 2088
237 Ga0268266_10280983 3300028379 Bacteria 1548
238 Ga0268266_10720016 3300028379 Bacteria 962
239 Ga0268265_10067180 3300028380 Bacteria 2774
240 Ga0268265_10276844 3300028380 Bacteria 1499
241 Ga0268265_10323108 3300028380 Bacteria 1398
242 Ga0268264_10293259 3300028381 Bacteria 1528
243 Ga0307509_10072213 3300031507 Bacteria 3596
244 Ga0307410_10737361 3300031852 Bacteria 833
245 Ga0307406_11416593 3300031901 Bacteria 609
246 Ga0307416_102056522 3300032002 Bacteria 673
247 Ga0307411_10364101 3300032005 Bacteria 1183
248 Ga0307415_100414086 3300032126 Bacteria 1154
249 Ga0307415_100825769 3300032126 Bacteria 848
250 Ga0307415_100838399 3300032126 Bacteria 842
251 Ga0307510_10008714 3300033180 Bacteria 12084
252 Ga0373923_0041595 3300035111 Bacteria 1895
253 Ga0373923_0042039 3300035111 Bacteria 1886
254 Ga0373953_0016628 3300035117 Bacteria 2689
255 Ga0373943_0157576 3300035170 Bacteria 1234
256 Ga0373946_0001445 3300035171 Bacteria 8272
257 Ga0373931_0553805 3300035691 Bacteria 747
258 Ga0373935_0002269 3300035692 Bacteria 10940
259 Ga0373935_0018636 3300035692 Bacteria 4226
260 Ga0373927_0005027 3300035695 Bacteria 9152
261 Ga0373933_0069440 3300035724 Bacteria 2141
262 Ga0373947_0000485 3300035725 Bacteria 22890
263 Ga0373937_0266701 3300036401 Bacteria 1615
264 Ga0373925_0000863 3300037068 Bacteria 27740
265 Ga0373925_0009857 3300037068 Bacteria 6939
266 Ga0373925_0025895 3300037068 Bacteria 4289
267 Ga0395900_0000591 3300037418 Bacteria 49743
268 Ga0395900_0520033 3300037418 Bacteria 1138
269 Ga0395898_0056665 3300037466 Bacteria 3820
270 Ga0395898_0124168 3300037466 Bacteria 2473
271 Ga0395901_0066685 3300038443 Bacteria 3749
272 Ga0395901_0590033 3300038443 Bacteria 1121
273 Ga0436363_0627188 3300039450 Bacteria 537
274 Ga0451791_1933912 3300041451 Bacteria 966
275 Ga0466969_0014408 3300044656 Bacteria 4157
276 Ga0466972_0000294 3300044658 Bacteria 30366
277 Ga0466972_0066601 3300044658 Bacteria 1721
278 Ga0466972_0137408 3300044658 Bacteria 1150
279 Ga0466965_0061194 3300044683 Bacteria 1882
280 Ga0466965_0149797 3300044683 Bacteria 1219
281 Ga0466965_0440903 3300044683 Bacteria 724
282 Ga0466966_0002892 3300044684 Bacteria 11321
283 Ga0466961_0000162 3300044693 Bacteria 45301
284 Ga0466961_0241203 3300044693 Bacteria 1111
285 Ga0466964_0190306 3300044706 Bacteria 979
286 Ga0466971_0199677 3300044719 Bacteria 944
287 Ga0466968_0016434 3300044735 Bacteria 2947
288 Ga0466957_0071774 3300044842 Bacteria 2142
289 Ga0466957_0183890 3300044842 Bacteria 1366
290 Ga0466957_0930147 3300044842 Bacteria 622
291 Ga0466959_0003742 3300045049 Bacteria 10061
292 Ga0466959_0004502 3300045049 Bacteria 9341
293 Ga0466959_0226281 3300045049 Bacteria 1296
294 Ga0466967_0592032 3300045976 Bacteria 1094
295 Ga0466967_0806569 3300045976 Bacteria 932
296 Ga0495617_141679 3300046452 Bacteria 767
297 Ga0495603_0000091 3300046455 Bacteria 41074
298 Ga0495603_0102504 3300046455 Bacteria 1670
299 Ga0495603_0107797 3300046455 Bacteria 1625
300 Ga0495603_0287137 3300046455 Bacteria 945
301 Ga0495590_0016895 3300046457 Bacteria 2633
302 Ga0495590_0199191 3300046457 Bacteria 735
303 Ga0495629_0000766 3300046459 Bacteria 25905
304 Ga0495638_0002361 3300046460 Bacteria 15466
305 Ga0495641_0005333 3300046461 Bacteria 8723
306 Ga0495650_0086970 3300046471 Bacteria 1195
307 Ga0495580_0001720 3300046472 Bacteria 19231
308 Ga0495580_0187562 3300046472 Bacteria 1427
309 Ga0495582_0000049 3300046473 Bacteria 59194
310 Ga0495605_0047764 3300046474 Bacteria 2098
311 Ga0495639_0000106 3300046475 Bacteria 42031
312 Ga0495584_0185704 3300046491 Bacteria 1056
313 Ga0495594_0003318 3300046499 Bacteria 8326
314 Ga0495583_0153370 3300046506 Bacteria 954
315 Ga0495606_0002722 3300046507 Bacteria 19932
316 Ga0495606_0104811 3300046507 Bacteria 1715
317 Ga0495608_0287266 3300046511 Bacteria 1020
318 Ga0495616_0407705 3300046513 Bacteria 557
319 Ga0495618_0165789 3300046514 Bacteria 1407
320 Ga0495628_0048219 3300046516 Bacteria 3377
321 Ga0495630_0034856 3300046517 Bacteria 3760
322 Ga0495648_0000895 3300046524 Bacteria 31207
323 Ga0495648_0089419 3300046524 Bacteria 1728
324 Ga0495648_0158678 3300046524 Bacteria 1172
325 Ga0495666_0111685 3300046526 Bacteria 1283
326 Ga0495652_0059800 3300046529 Bacteria 3223
327 Ga0495665_0000101 3300046531 Bacteria 40147
328 Ga0495640_0044311 3300046533 Bacteria 3094
329 Ga0495622_0002797 3300046557 Bacteria 8331
330 Ga0495667_0304272 3300046559 Bacteria 1010
331 Ga0495668_0074396 3300046616 Bacteria 1865
332 Ga0495668_0135050 3300046616 Bacteria 1350
333 Ga0495668_0240077 3300046616 Bacteria 992
334 Ga0495634_0000267 3300046642 Bacteria 49323
335 Ga0495634_0009395 3300046642 Bacteria 7213
336 Ga0495611_0231559 3300046648 Bacteria 858
337 Ga0495625_0141376 3300046660 Bacteria 1623
338 Ga0495635_0002050 3300046663 Bacteria 13651
339 Ga0495635_0084967 3300046663 Bacteria 2165
340 Ga0495588_0029661 3300046674 Bacteria 2745
341 Ga0495599_0296263 3300046678 Bacteria 977
342 Ga0495646_0015985 3300046680 Bacteria 4763
343 Ga0495646_0254780 3300046680 Bacteria 939
344 Ga0495647_0000503 3300046681 Bacteria 11373
345 Ga0495647_0115019 3300046681 Bacteria 1126
346 Ga0495658_0000173 3300046683 Bacteria 36536
347 Ga0495658_0002945 3300046683 Bacteria 8539
348 Ga0495658_0232983 3300046683 Bacteria 1155
349 Ga0495624_0002964 3300046690 Bacteria 12689
350 Ga0495670_0496689 3300046691 Bacteria 662
351 Ga0495649_0183439 3300046694 Bacteria 1091
352 Ga0495589_0219062 3300046794 Bacteria 894
353 Ga0495600_0208218 3300046809 Bacteria 1254
354 Ga0495660_0103117 3300046810 Bacteria 1466
355 Ga0495660_0159854 3300046810 Bacteria 1106
356 Ga0495581_0000022 3300047315 Bacteria 56149
357 Ga0495581_0114670 3300047315 Bacteria 1567
358 Ga0495604_0253071 3300047317 Bacteria 1200
359 Ga0495604_0319272 3300047317 Bacteria 1038
360 Ga0495674_0000629 3300047319 Bacteria 33021
361 Ga0495674_0020328 3300047319 Bacteria 6148
362 Ga0495672_0086733 3300047320 Bacteria 1730
363 Ga0495676_0012562 3300047321 Bacteria 7623
364 Ga0495675_0049670 3300047444 Bacteria 2666
365 Ga0495673_0040660 3300047469 Bacteria 2098
366 Ga0495684_0065276 3300047471 Bacteria 2767
367 Ga0495686_0352572 3300047472 Bacteria 799
368 Ga0495593_0000016 3300047673 Bacteria 80178
369 Ga0495626_0180640 3300048091 Bacteria 875
370 Ga0496100_0436762 3300048903 Bacteria 1002
371 Ga0496101_0118942 3300048904 Bacteria 1996
372 Ga0496101_0327161 3300048904 Bacteria 1203
373 Ga0496102_0182889 3300048905 Bacteria 1975
374 Ga0496102_0459289 3300048905 Bacteria 1194
375 Ga0496102_0998051 3300048905 Bacteria 758
376 Ga0496103_0119085 3300048906 Bacteria 1681
377 Ga0496104_0067210 3300048907 Bacteria 3405
378 Ga0496106_0234145 3300048909 Bacteria 1467
379 Ga0496108_0160899 3300048911 Bacteria 1940
380 Ga0496109_0085836 3300048912 Bacteria 2906
381 Ga0496110_0778965 3300048913 Bacteria 860
382 Ga0496110_1041144 3300048913 Bacteria 726
383 Ga0496111_0057468 3300048914 Bacteria 2817
384 Ga0496112_0264383 3300048915 Bacteria 1669
385 Ga0496112_0870959 3300048915 Bacteria 823
386 Ga0496113_0080297 3300048916 Bacteria 2498
387 Ga0496113_0519785 3300048916 Bacteria 955
388 Ga0496113_0877682 3300048916 Bacteria 710
389 Ga0496114_0206538 3300048917 Bacteria 1722
390 Ga0496114_0625556 3300048917 Bacteria 948
391 Ga0496116_0103701 3300048919 Bacteria 1692
392 Ga0496116_0168009 3300048919 Bacteria 1193
393 Ga0496118_0074493 3300048921 Bacteria 2426
394 Ga0496118_0138623 3300048921 Bacteria 1547
395 Ga0496118_0194240 3300048921 Bacteria 1210
396 Ga0496119_0178115 3300048922 Bacteria 1117
397 Ga0496121_0023184 3300048924 Bacteria 5991
398 Ga0496121_0030905 3300048924 Bacteria 4908
399 Ga0496121_0068922 3300048924 Bacteria 2858
400 Ga0496121_0133688 3300048924 Bacteria 1851
401 Ga0496121_0232476 3300048924 Bacteria 1290
402 Ga0496121_0301360 3300048924 Bacteria 1087
403 Ga0496121_0306999 3300048924 Bacteria 1074
404 Ga0496125_0008985 3300048928 Bacteria 10362
405 Ga0496125_0539681 3300048928 Bacteria 648
406 Ga0496126_0003051 3300048929 Bacteria 21707
407 Ga0496126_0054104 3300048929 Bacteria 3637
408 Ga0496126_0115984 3300048929 Bacteria 2328
409 Ga0496126_0259526 3300048929 Bacteria 1445
410 Ga0496126_0263814 3300048929 Bacteria 1431
411 Ga0496126_0264461 3300048929 Bacteria 1429
412 Ga0496126_0355521 3300048929 Bacteria 1197
413 Ga0496126_0523939 3300048929 Bacteria 944
414 Ga0501031_0000186 3300049568 Bacteria 34900
415 Ga0501031_0043135 3300049568 Bacteria 2944
416 Ga0501031_0116586 3300049568 Bacteria 1745
417 Ga0501031_0285058 3300049568 Bacteria 1071
418 Ga0501032_0000812 3300049569 Bacteria 25370
419 Ga0501032_0257808 3300049569 Bacteria 1131
420 Ga0501032_0354143 3300049569 Bacteria 945
421 Ga0501032_0486039 3300049569 Bacteria 789
422 Ga0501033_0000098 3300049570 Bacteria 82803
423 Ga0501033_0000558 3300049570 Bacteria 34644
424 Ga0501033_0357608 3300049570 Bacteria 1022
425 Ga0501033_0795645 3300049570 Bacteria 639
426 Ga0501034_0001272 3300049571 Bacteria 34179
427 Ga0501034_0040902 3300049571 Bacteria 4690
428 Ga0501034_0208699 3300049571 Bacteria 1909
429 Ga0501034_1109219 3300049571 Bacteria 672
430 Ga0501036_0000049 3300049572 Bacteria 75400
431 Ga0501036_0058130 3300049572 Bacteria 3276
432 Ga0501036_0063338 3300049572 Bacteria 3131
433 Ga0501036_0078237 3300049572 Bacteria 2797
434 Ga0501036_0696881 3300049572 Bacteria 839
435 Ga0501036_0835420 3300049572 Bacteria 757
436 Ga0501037_0000069 3300049573 Bacteria 95277
437 Ga0501037_0062592 3300049573 Bacteria 2712
438 Ga0501037_0147553 3300049573 Bacteria 1682
439 Ga0501037_0182765 3300049573 Bacteria 1487
440 Ga0501037_0335182 3300049573 Bacteria 1045
441 Ga0501038_0000034 3300049574 Bacteria 128854
442 Ga0501038_0012344 3300049574 Bacteria 7806
443 Ga0501038_0037370 3300049574 Bacteria 4257
444 Ga0501038_0127344 3300049574 Bacteria 2094
445 Ga0501038_0135455 3300049574 Bacteria 2018
446 Ga0501038_0194038 3300049574 Bacteria 1633
447 Ga0501038_0231496 3300049574 Bacteria 1470
448 Ga0501039_0000090 3300049575 Bacteria 63919
449 Ga0501039_0128477 3300049575 Bacteria 1988
450 Ga0501039_0257269 3300049575 Bacteria 1372
451 Ga0501039_0326257 3300049575 Bacteria 1206
452 Ga0501042_0025312 3300049578 Bacteria 4167
453 Ga0501042_0102076 3300049578 Bacteria 2063
454 Ga0501042_0209264 3300049578 Bacteria 1406
455 Ga0501042_0526993 3300049578 Bacteria 858
456 Ga0501043_0000130 3300049579 Bacteria 69795
457 Ga0501043_0005207 3300049579 Bacteria 10522
458 Ga0501043_0005391 3300049579 Bacteria 10331
459 Ga0501043_0186171 3300049579 Bacteria 1616
460 Ga0501043_0505413 3300049579 Bacteria 902
461 Ga0501046_0000213 3300049580 Bacteria 60602
462 Ga0501046_0287368 3300049580 Bacteria 1203
463 Ga0501046_0585928 3300049580 Bacteria 792
464 Ga0501047_0001193 3300049581 Bacteria 25735
465 Ga0501047_0270516 3300049581 Bacteria 1545
466 Ga0501048_0001677 3300049582 Bacteria 16871
467 Ga0501067_0000264 3300049583 Bacteria 28689
468 Ga0501068_0006089 3300049584 Bacteria 6631
469 Ga0501068_0153262 3300049584 Bacteria 1449
470 Ga0501069_0004059 3300049585 Bacteria 7558
471 Ga0501070_0061513 3300049586 Bacteria 3110
472 Ga0501070_0347870 3300049586 Bacteria 1203
473 Ga0501071_0169058 3300049587 Bacteria 1636
474 Ga0501071_0703618 3300049587 Bacteria 778
475 Ga0501072_0000146 3300049588 Bacteria 52958
476 Ga0501073_0000545 3300049589 Bacteria 26559
477 Ga0501074_0014578 3300049590 Bacteria 5718
478 Ga0501074_0315739 3300049590 Bacteria 1110
479 Ga0501076_0293804 3300049592 Bacteria 1331
480 Ga0501079_0001094 3300049741 Bacteria 18846
481 Ga0501079_0369163 3300049741 Bacteria 1125
482 Ga0501080_0030649 3300049742 Bacteria 5011
483 Ga0501081_0484614 3300049743 Bacteria 921
484 Ga0501083_0001109 3300049744 Bacteria 18027
485 Ga0501035_0004800 3300049822 Bacteria 12812
486 Ga0501035_0006698 3300049822 Bacteria 10766
487 Ga0501035_0161636 3300049822 Bacteria 1938
488 Ga0501035_0789176 3300049822 Bacteria 759
489 Ga0501044_0004850 3300049823 Bacteria 15038
490 Ga0501044_0004863 3300049823 Bacteria 15017
491 Ga0501044_0036225 3300049823 Bacteria 5162
492 Ga0501044_0077694 3300049823 Bacteria 3366
493 Ga0501044_0133105 3300049823 Bacteria 2479
494 Ga0501045_0008308 3300049824 Bacteria 7228
495 nmdc:mga03n38_30026_c1 3300050490 Bacteria 2281
496 nmdc:mga00v17_205190_c1 3300050491 Bacteria 1275
497 nmdc:mga00v17_47787_c1 3300050491 Bacteria 2592
498 nmdc:mga0yw44_157293_c1 3300050492 Bacteria 1486
499 nmdc:mga0yw44_270144_c1 3300050492 Bacteria 1135
500 nmdc:mga0yw44_73362_c1 3300050492 Bacteria 2129
501 nmdc:mga0k408_260379_c1 3300050493 Bacteria 1036
502 nmdc:mga06z11_200104_c1 3300050494 Bacteria 1160
503 nmdc:mga06z11_388505_c1 3300050494 Bacteria 839
504 nmdc:mga06z11_389671_c1 3300050494 Bacteria 838
505 nmdc:mga06z11_570784_c1 3300050494 Bacteria 688
506 nmdc:mga04h51_21687_c1 3300050495 Bacteria 1935
507 nmdc:mga07m45_253134_c1 3300050496 Bacteria 1025
508 nmdc:mga07m45_432102_c1 3300050496 Bacteria 764
509 nmdc:mga07m45_9322_c1 3300050496 Bacteria 5087
510 nmdc:mga08y16_243105_c1 3300050511 Bacteria 1860
511 nmdc:mga0n895_79859_c1 3300050512 Bacteria 3258
512 nmdc:mga08x19_274933_c1 3300050514 Bacteria 1166
513 nmdc:mga0sz30_386547_c1 3300050516 Bacteria 627
514 Ga0495601_0642301 3300053077 Bacteria 679
515 Ga0500610_0232479 3300053079 Bacteria 864
516 Ga0500610_0235319 3300053079 Bacteria 856
517 Ga0495655_0053674 3300053083 Bacteria 1076
518 Ga0495595_0179797 3300053084 Bacteria 1049
519 Ga0500578_0151215 3300053086 Bacteria 1446
520 Ga0500643_000116 3300053087 Bacteria 83687
521 Ga0500644_0098017 3300053088 Bacteria 1109
522 Ga0500651_0232971 3300053093 Bacteria 1076
523 Ga0500566_0004414 3300053094 Bacteria 8399
524 Ga0500555_001167 3300053103 Bacteria 8624
525 Ga0500562_007630 3300053108 Bacteria 2728
526 Ga0500595_028988 3300053119 Bacteria 1882
527 Ga0500614_056475 3300053123 Bacteria 1044
528 Ga0500618_099343 3300053125 Bacteria 655
529 Ga0500621_120756 3300053126 Bacteria 1015
530 Ga0500559_0000142 3300053136 Bacteria 55814
531 Ga0500559_0011875 3300053136 Bacteria 3712
532 Ga0500561_0005165 3300053137 Bacteria 2403
533 Ga0500568_0003430 3300053139 Bacteria 8838
534 Ga0500573_0067381 3300053140 Bacteria 2045
535 Ga0500603_020058 3300053150 Bacteria 1629
536 Ga0500604_0128026 3300053151 Bacteria 852
537 Ga0500627_0001120 3300053158 Bacteria 7332
538 Ga0500627_0052263 3300053158 Bacteria 1783
539 Ga0500636_0025189 3300053177 Bacteria 3515
540 Ga0500645_027998 3300053730 Bacteria 1707
541 Ga0500552_026183 3300053733 Bacteria 869
542 Ga0500596_003901 3300053735 Bacteria 2788
543 Ga0500596_009002 3300053735 Bacteria 1571
544 Ga0501084_0000932 3300054114 Bacteria 22659
545 Ga0500661_019821 3300055283 Bacteria 1197
546 Ga0587076_030712 3300059645 Bacteria 950
547 Ga0587114_072891 3300059655 Bacteria 625
548 Ga0501082_0032140 3300060353 Bacteria 4527
549 2935649548 2935648319 Bacteria 8801166
550 2507509194 2507262055 Bacteria 8048963
551 2508543259 2508501009 Bacteria 7784016
552 2508690997 2508501042 Bacteria 8719808
553 2509147448 2508501128 Bacteria 8613869
554 2511396239 2511231028 Bacteria 8046582
555 2513637749 2513237094 Bacteria 8789602
556 2513646830 2513237095 Bacteria 8976980
557 2513654536 2513237096 Bacteria 8722461
558 2513675527 2513237098 Bacteria 9902361
559 2513691986 2513237101 Bacteria 7952346
560 2513723125 2513237104 Bacteria 10034502
561 2513860908 2513237137 Bacteria 9558895
562 2513892838 2513237141 Bacteria 8496279
563 2513915285 2513237145 Bacteria 8979722
564 2515626602 2515154112 Bacteria 8294334
565 2517101831 2517093001 Bacteria 9002274
566 2517892584 2517572143 Bacteria 9484767
567 2524436752 2524023205 Bacteria 8918781
568 2524465136 2524023210 Bacteria 9029266
569 2524539074 2524023228 Bacteria 10118060
570 2528855760 2528768022 Bacteria 10457665
571 2617351286 2617270735 Bacteria 9163226
572 2617376300 2617270741 Bacteria 8201522
573 2671122315 2667528175 Bacteria 7532676
574 2723845621 2721755755 Bacteria 8322773
575 2728750492 2728368998 Bacteria 8720350
576 2745079177 2744054633 Bacteria 8678936
577 2793063889 2791355196 Bacteria 7323613
578 2793068591 2791355197 Bacteria 8420563
579 2793083778
580 2805918149 2802429603 Bacteria 8777136
581 2818242670 2816332527 Bacteria 8933356
582 2824606745 2824600985 Bacteria 8488197
583 2824616643 2824609381 Bacteria 8672835
584 2824621840 2824617872 Bacteria 8814715
585 2824632543 2824626560 Bacteria 8813858
586 2824639503 2824635225 Bacteria 8785348
587 2824651525 2824644064 Bacteria 8743947
588 2824660982 2824653114 Bacteria 8493680
589 2824670842 2824661429 Bacteria 9877870
590 2824677639 2824671348 Bacteria 8369588
591 2824695359 2824687955 Bacteria 8360029
592 2824702249 2824696289 Bacteria 8335049
593 2824708771 2824704595 Bacteria 9667483
594 2824721572 2824714736 Bacteria 8717648
595 2824729239 2824723954 Bacteria 8758240
596 2824739718 2824732956 Bacteria 7810675
597 2824753511 2824746037 Bacteria 7911610
598 2824761262 2824753945 Bacteria 9787441
599 2824773186 2824763712 Bacteria 9792355
600 2824779180 2824773399 Bacteria 8360218
601 2842039602 2842038055 Bacteria 8002051
602 2842047452 2842045827 Bacteria 8006841
603 2844318536 2844315083 Bacteria 8138177
604 2847935470 2847930680 Bacteria 9342022
605 2847946030 2847939898 Bacteria 8606328
606 2857513745 2857509624 Bacteria 7472071
607 2857527916 2857524615 Bacteria 6615449
608 2874597308 2874590934 Bacteria 8299676
609 2874609767 2874604998 Bacteria 7834745
610 2874626795 2874620515 Bacteria 8290088
611 2874631207 2874628541 Bacteria 8630250
612 2874649359 2874645413 Bacteria 8214782
613 2876770418 2876761206 Bacteria 10111113
614 2876777895 2876771140 Bacteria 8287509
615 2876809345 2876808645 Bacteria 8824342
616 2876823084 2876818435 Bacteria 8274608
617 2879078652 2879074833 Bacteria 8279565
618 2879088502 2879083081 Bacteria 8587928
619 2879108133 2879099564 Bacteria 10442239
620 2879118365 2879110137 Bacteria 8907982
621 2879132871 2879127579 Bacteria 8294491
622 2879148670 2879142872 Bacteria 8267021
623 2881366842 2881364244 Bacteria 7710352
624 2881672156 2881665667 Bacteria 8175609
625 2885371963 2885366525 Bacteria 8326213
626 2885379305 2885374607 Bacteria 8927485
627 2885386307 2885383462 Bacteria 9473874
628 2885415255 2885409591 Bacteria 9235467
629 2888383498 2888378607 Bacteria 9652610
630 2888394449 2888388044 Bacteria 7304136
631 2889040427 2889033259 Bacteria 9099371
632 2903730098 2903727486 Bacteria 8281579
633 2903753540 2903748898 Bacteria 9972761
634 2903771931 2903768456 Bacteria 9749579
635 2904668373 2904666416 Bacteria 8226587
636 2904695938 2904690495 Bacteria 9412302
637 2904702690
638 2904717331 2904711408 Bacteria 9771557
639 2906603483 2906602504 Bacteria 8295279
640 2906618421
641 2906632233 2906626472 Bacteria 8826946
642 2906638720 2906635258 Bacteria 8601019
643 2906650831 2906643746 Bacteria 8722424
644 2906664122 2906660503 Bacteria 8595048
645 2908742907 2908739725 Bacteria 8628932
646 2908760567 2908756301 Bacteria 8864324
647 2908779578 2908775508 Bacteria 8092255
648 2919075316 2919073203 Bacteria 6531949
649 2922368297 2922361189 Bacteria 7436256
650 2922373694
651 2922388239 2922386360 Bacteria 7017218
652 2922429679
653 2929617422 2929615660 Bacteria 9193770
654 2929627127 2929624759 Bacteria 9339455
655 2932787543 2932784394 Bacteria 9704911
656 2932800722 2932794094 Bacteria 7915132
657 2932803341 2932801729 Bacteria 7987968
658 2932813276 2932809354 Bacteria 9135765
659 2932820803 2932818245 Bacteria 9955613
660 2932834824 2932828146 Bacteria 9745859
661 2933579378 2933577622 Bacteria 9116884
662 2935611923 2935608549 Bacteria 8203142
663 2935621789 2935616580 Bacteria 9032984
664 2935631848 2935630451 Bacteria 8169952
665 2935642733 2935638405 Bacteria 10015038
666 2935658937 2935656913 Bacteria 8965014
667 2935667835 2935665750 Bacteria 9571747
668 2935682327 2935675223 Bacteria 9928132
669 2935688586 2935684952 Bacteria 9590419
670 2935695937 2935694250 Bacteria 9291695
671 2935706676 2935703347 Bacteria 10242284
672 2935715605 2935713505 Bacteria 9608509
673 2935725831 2935722832 Bacteria 9608746
674 2935734424 2935732158 Bacteria 9706831
675 2935743803 2935741537 Bacteria 9707219
676 2935754160 2935750917 Bacteria 9590372
677 2935763199 2935760218 Bacteria 9817913
678 2935772604 2935769743 Bacteria 7878163
679 2935783156 2935777560 Bacteria 8077691
680 2935790897 2935785616 Bacteria 7962367
681 2935799402 2935793552 Bacteria 8012592
682 2935806349 2935801545 Bacteria 9301974
683 2935812950 2935810662 Bacteria 9401221
684 2935821403 2935819856 Bacteria 8261050
685 2935830602 2935827899 Bacteria 10038562
686 2935840631 2935837841 Bacteria 9454360
687 2935850338 2935847175 Bacteria 8228321
688 2935860036 2935855204 Bacteria 9035059
689 2935869329 2935864058 Bacteria 9784707
690 2935880510 2935873716 Bacteria 9632195
691 2935886413 2935883170 Bacteria 7964738
692 2935914383 2935908558 Bacteria 8568796
693 2935921097 2935916978 Bacteria 9113783
694 2935932039 2935926038 Bacteria 8601059
695 2935940636 2935934488 Bacteria 8602579
696 2935948579 2935942939 Bacteria 8599779
697 2935956950 2935951376 Bacteria 8602333
698 2935960282 2935959822 Bacteria 7869783
699 2935973548 2935967501 Bacteria 8603075
700 2935977531 2935975950 Bacteria 8347125
701 2935989999 2935984226 Bacteria 8302647
702 2935999558 2935992306 Bacteria 9802711
703 2936006457 2936002035 Bacteria 9362176
704 2936012970 2936011229 Bacteria 8801034
705 2936021534 2936019824 Bacteria 8804134
706 2936030263 2936028420 Bacteria 8965941
707 2936041538 2936037263 Bacteria 9446081
708 2936047728 2936046547 Bacteria 8903709
709 2936057114 2936055302 Bacteria 8785755
710 2940560464 2940556831 Bacteria 9590747
711 2941513037 2941507105 Bacteria 8166816
712 2941521059 2941515067 Bacteria 8166720
713 2941526077 2941523033 Bacteria 8169134
714 2941534286 2941531003 Bacteria 7653939
715 2941541239 2941538514 Bacteria 9402094
716 3005480017 3005474847 Bacteria 9259049
717 3005590058 3005587118 Bacteria 7794411
718 3005598647 3005594810 Bacteria 8716512
719 3005714304 3005710791 Bacteria 7622528
720 3005721811 3005718088 Bacteria 8283608
721 8006928992 8006926726 Bacteria 6749210
722 8006941213 8006933436 Bacteria 10410654
723 8006967249 8006964411 Bacteria 8966052
724 8006980581 8006973647 Bacteria 10679141
725 8006992066 8006984368 Bacteria 9651211
726 8006997485 8006994254 Bacteria 8309700
727 8016513989 8016511872 Bacteria 9921665
728 8016530203 8016522445 Bacteria 8156687
729 8016535458 8016530956 Bacteria 8155261
730 8016548656 8016539877 Bacteria 8155419
731 8016553475 8016548790 Bacteria 8155074
732 8016561857 8016557553 Bacteria 8154380
733 8016573790 8016566248 Bacteria 8158151
734 8016577915 8016575299 Bacteria 8154085
735 8016592561 8016583857 Bacteria 10421953
736 8016599685 8016595262 Bacteria 8149947
737 8016611163 8016603502 Bacteria 8731218
738 8016622473 8016613128 Bacteria 8794220
739 8016627312 8016622563 Bacteria 7999408
740 8016631599 8016630954 Bacteria 9217207
741 8017062417 8017057580 Bacteria 10023680
742 8019535195 8019530166 Bacteria 8155624
743 8019544286 8019538911 Bacteria 7872763
744 8019554413 8019547302 Bacteria 7996444
745 8019556989 8019555841 Bacteria 9642137
746 8019568310 8019565922 Bacteria 9639779
747 8019581878 8019576017 Bacteria 10049540
748 8019589559 8019586578 Bacteria 10212056
749 8019616842 8019608314 Bacteria 10042931
750 8019627509 8019619141 Bacteria 9218857
751 8019635061 8019629233 Bacteria 8687553
752 8019644668 8019638758 Bacteria 9062356
753 8019657696 8019648815 Bacteria 10014479
754 8019662903 8019659431 Bacteria 8577854
755 8019672502 8019668869 Bacteria 8791617
756 8019683655 8019678201 Bacteria 8863603
757 8019689408 8019687851 Bacteria 8712826
758 8055746963 8055742211 Bacteria 9226248
759 8056674363 8056673599 Bacteria 7871253
760 8056683276 8056681323 Bacteria 8472857
761 8056690041 8056689827 Bacteria 6712655
762 8056972898 8056967851 Bacteria 9038162
763 JGI24740J21852_10005380
764 JGI24737J22298_10027637
765 JGI24735J21928_10006861
766 JGI25406J46586_10000029
767 JGI25165J46597_1018610
768 Ga0055539_1020437
769 Ga0065707_10309970
770 Ga0070658_10474332
771 Ga0070683_100012000
772 Ga0068869_100245268
773 Ga0068868_100088762
774 Ga0070660_100524511
775 Ga0070691_10250555
776 Ga0070687_100155558
777 Ga0070692_10131783
778 Ga0070668_100074341
779 Ga0070675_100248937
780 Ga0070671_100305450
781 Ga0070673_100592201
782 Ga0070659_100255997
783 Ga0070708_100388705
784 Ga0070663_100031255
785 Ga0070663_100040635
786 Ga0070663_100203447
787 Ga0070678_100733390
788 Ga0070706_101086527
789 Ga0070684_100012965
790 Ga0070697_100117118
791 Ga0068853_100317074
792 Ga0070696_100196338
793 Ga0070696_100513036
794 Ga0070693_100448964
795 Ga0070665_100045631
796 Ga0070665_100115498
797 Ga0070665_100130792
798 Ga0070665_100146951
799 Ga0070665_100204457
800 Ga0068855_100030416
801 Ga0068855_100149163
802 Ga0068855_100210621
803 Ga0068855_100499153
804 Ga0070664_100433789
805 Ga0070664_100509789
806 Ga0070664_101338311
807 Ga0068857_100197039
808 Ga0068854_100000966
809 Ga0068854_100181847
810 Ga0068854_100746796
811 Ga0068854_100838959
812 Ga0068856_100003361
813 Ga0068856_100057021
814 Ga0068856_101622787
815 Ga0068852_100792308
816 Ga0068859_100123228
817 Ga0068864_100999501
818 Ga0068861_100124839
819 Ga0068861_100240537
820 Ga0068863_100224458
821 Ga0068858_100018465
822 Ga0068860_100249384
823 Ga0068862_100481793
824 Ga0068862_101704306
825 Ga0081455_10006771
826 Ga0081540_1006816
827 Ga0081540_1117521
828 Ga0081539_10000379
829 Ga0081539_10001714
830 Ga0075365_10098774
831 Ga0075368_10029287
832 Ga0075368_10135374
833 Ga0075363_100000537
834 Ga0075363_100202884
835 Ga0075364_10069135
836 Ga0070712_100555726
837 Ga0075367_10201242
838 Ga0075367_10486564
839 Ga0075369_10203727
840 Ga0075427_10046420
841 Ga0097621_100215701
842 Ga0075370_10038750
843 Ga0075370_10097336
844 Ga0075370_10350825
845 Ga0068871_100192474
846 Ga0075434_100074375
847 Ga0075436_100750793
848 Ga0097620_100123230
849 Ga0099824_1020964
850 Ga0099822_1058602
851 Ga0099795_10079078
852 Ga0105250_10033685
853 Ga0105240_10202867
854 Ga0105240_10213488
855 Ga0105240_10561103
856 Ga0105240_11846650
857 Ga0105245_10192381
858 Ga0105245_10988481
859 Ga0105245_11876141
860 Ga0114129_10225442
861 Ga0105243_10103348
862 Ga0105241_10143856
863 Ga0105241_10505422
864 Ga0105242_10905384
865 Ga0105248_10907809
866 Ga0105237_10383130
867 Ga0105237_11223647
868 Ga0105238_10002475
869 Ga0105238_10003960
870 Ga0105238_10067659
871 Ga0105238_10264638
872 Ga0105238_10615374
873 Ga0105249_10330994
874 Ga0105249_10476581
875 Ga0099796_10025320
876 Ga0099796_10163090
877 Ga0105239_10024851
878 Ga0105239_10108947
879 Ga0105239_10120061
880 Ga0105239_10533313
881 Ga0105246_10262734
882 Ga0157373_10235929
883 Ga0157373_10440828
884 Ga0157370_10127209
885 Ga0157369_10218921
886 Ga0157374_10259691
887 Ga0157378_10013488
888 Ga0157378_10354746
889 Ga0163162_10689339
890 Ga0163162_11111804
891 Ga0163162_11330256
892 Ga0157372_10492480
893 Ga0157372_11263431
894 Ga0157372_11619715
895 Ga0157375_10751736
896 Ga0163163_10616739
897 Ga0163163_10938846
898 Ga0157380_10636890
899 Ga0157379_10845068
900 Ga0157376_10265929
901 Ga0163161_10348799
902 Ga0197907_10460259
903 Ga0197907_11073140
904 Ga0206356_10649126
905 Ga0206349_1641650
906 Ga0206355_1198159
907 Ga0206351_10298373
908 Ga0206352_10123997
909 Ga0206352_10244717
910 Ga0206350_10092383
911 Ga0154015_1321210
912 Ga0214544_1000051
913 Ga0214542_1000149
914 Ga0214545_1000126
915 Ga0214543_1000148
916 Ga0224712_10045162
917 Ga0224712_10074068
918 Ga0224712_10175410
919 Ga0209677_100663
920 Ga0209677_101621
921 Ga0209233_1004776
922 Ga0209564_1005824
923 Ga0209758_1000521
924 Ga0209758_1024000
925 Ga0207697_10262460
926 Ga0207653_10007642
927 Ga0207642_10162995
928 Ga0207688_10061522
929 Ga0207647_10001630
930 Ga0207643_10108886
931 Ga0207684_10503599
932 Ga0207654_10000321
933 Ga0207654_10003420
934 Ga0207707_10631985
935 Ga0207695_10000822
936 Ga0207695_10002470
937 Ga0207671_10035837
938 Ga0207671_10244029
939 Ga0207693_10690336
940 Ga0207663_10012968
941 Ga0207694_10000095
942 Ga0207694_10025361
943 Ga0207694_10064064
944 Ga0207694_10306707
945 Ga0207687_10824326
946 Ga0207706_10245532
947 Ga0207706_10362880
948 Ga0207709_10419260
949 Ga0207670_10129891
950 Ga0207669_11046408
951 Ga0207691_10911635
952 Ga0207711_10094035
953 Ga0207689_10037986
954 Ga0207689_10132795
955 Ga0207689_10178020
956 Ga0207661_10001062
957 Ga0207679_10991923
958 Ga0207667_10020629
959 Ga0207667_10158307
960 Ga0207667_10330345
961 Ga0207667_10518875
962 Ga0207667_10927740
963 Ga0207712_10063647
964 Ga0207712_10127549
965 Ga0207712_10686652
966 Ga0207668_10054781
967 Ga0207640_10565210
968 Ga0207640_10632635
969 Ga0207658_10308440
970 Ga0207677_10007903
971 Ga0207677_11205467
972 Ga0207639_10032020
973 Ga0207639_10185256
974 Ga0207639_10453015
975 Ga0207639_10737084
976 Ga0207678_10018096
977 Ga0207678_10087533
978 Ga0207678_10405279
979 Ga0207678_10609981
980 Ga0207678_10752176
981 Ga0207702_10000025
982 Ga0207702_10622731
983 Ga0207702_10978222
984 Ga0207676_10776116
985 Ga0207674_10005830
986 Ga0207674_10177151
987 Ga0207674_10284876
988 Ga0207675_100030053
989 Ga0207683_10451783
990 Ga0207698_10010299
991 Ga0207698_10227302
992 Ga0209389_1000656
993 Ga0209589_1000874
994 Ga0209489_100178
995 Ga0209813_10046702
996 Ga0268266_10014666
997 Ga0268266_10049514
998 Ga0268266_10151802
999 Ga0268266_10280983
1000 Ga0268266_10720016
1001 Ga0268265_10067180
1002 Ga0268265_10276844
1003 Ga0268265_10323108
1004 Ga0268264_10293259
1005 Ga0307509_10072213
1006 Ga0307410_10737361
1007 Ga0307406_11416593
1008 Ga0307416_102056522
1009 Ga0307411_10364101
1010 Ga0307415_100414086
1011 Ga0307415_100825769
1012 Ga0307415_100838399
1013 Ga0307510_10008714
1014 Ga0373923_0041595
1015 Ga0373923_0042039
1016 Ga0373953_0016628
1017 Ga0373943_0157576
1018 Ga0373946_0001445
1019 Ga0373931_0553805
1020 Ga0373935_0002269
1021 Ga0373935_0018636
1022 Ga0373927_0005027
1023 Ga0373933_0069440
1024 Ga0373947_0000485
1025 Ga0373937_0266701
1026 Ga0373925_0000863
1027 Ga0373925_0009857
1028 Ga0373925_0025895
1029 Ga0395900_0000591
1030 Ga0395900_0520033
1031 Ga0395898_0056665
1032 Ga0395898_0124168
1033 Ga0395901_0066685
1034 Ga0395901_0590033
1035 Ga0436363_0627188
1036 Ga0451791_1933912
1037 Ga0466969_0014408
1038 Ga0466972_0000294
1039 Ga0466972_0066601
1040 Ga0466972_0137408
1041 Ga0466965_0061194
1042 Ga0466965_0149797
1043 Ga0466965_0440903
1044 Ga0466966_0002892
1045 Ga0466961_0000162
1046 Ga0466961_0241203
1047 Ga0466964_0190306
1048 Ga0466971_0199677
1049 Ga0466968_0016434
1050 Ga0466957_0071774
1051 Ga0466957_0183890
1052 Ga0466957_0930147
1053 Ga0466959_0003742
1054 Ga0466959_0004502
1055 Ga0466959_0226281
1056 Ga0466967_0592032
1057 Ga0466967_0806569
1058 Ga0495617_141679
1059 Ga0495603_0000091
1060 Ga0495603_0102504
1061 Ga0495603_0107797
1062 Ga0495603_0287137
1063 Ga0495590_0016895
1064 Ga0495590_0199191
1065 Ga0495629_0000766
1066 Ga0495638_0002361
1067 Ga0495641_0005333
1068 Ga0495650_0086970
1069 Ga0495580_0001720
1070 Ga0495580_0187562
1071 Ga0495582_0000049
1072 Ga0495605_0047764
1073 Ga0495639_0000106
1074 Ga0495584_0185704
1075 Ga0495594_0003318
1076 Ga0495583_0153370
1077 Ga0495606_0002722
1078 Ga0495606_0104811
1079 Ga0495608_0287266
1080 Ga0495616_0407705
1081 Ga0495618_0165789
1082 Ga0495628_0048219
1083 Ga0495630_0034856
1084 Ga0495648_0000895
1085 Ga0495648_0089419
1086 Ga0495648_0158678
1087 Ga0495666_0111685
1088 Ga0495652_0059800
1089 Ga0495665_0000101
1090 Ga0495640_0044311
1091 Ga0495622_0002797
1092 Ga0495667_0304272
1093 Ga0495668_0074396
1094 Ga0495668_0135050
1095 Ga0495668_0240077
1096 Ga0495634_0000267
1097 Ga0495634_0009395
1098 Ga0495611_0231559
1099 Ga0495625_0141376
1100 Ga0495635_0002050
1101 Ga0495635_0084967
1102 Ga0495588_0029661
1103 Ga0495599_0296263
1104 Ga0495646_0015985
1105 Ga0495646_0254780
1106 Ga0495647_0000503
1107 Ga0495647_0115019
1108 Ga0495658_0000173
1109 Ga0495658_0002945
1110 Ga0495658_0232983
1111 Ga0495624_0002964
1112 Ga0495670_0496689
1113 Ga0495649_0183439
1114 Ga0495589_0219062
1115 Ga0495600_0208218
1116 Ga0495660_0103117
1117 Ga0495660_0159854
1118 Ga0495581_0000022
1119 Ga0495581_0114670
1120 Ga0495604_0253071
1121 Ga0495604_0319272
1122 Ga0495674_0000629
1123 Ga0495674_0020328
1124 Ga0495672_0086733
1125 Ga0495676_0012562
1126 Ga0495675_0049670
1127 Ga0495673_0040660
1128 Ga0495684_0065276
1129 Ga0495686_0352572
1130 Ga0495593_0000016
1131 Ga0495626_0180640
1132 Ga0496100_0436762
1133 Ga0496101_0118942
1134 Ga0496101_0327161
1135 Ga0496102_0182889
1136 Ga0496102_0459289
1137 Ga0496102_0998051
1138 Ga0496103_0119085
1139 Ga0496104_0067210
1140 Ga0496106_0234145
1141 Ga0496108_0160899
1142 Ga0496109_0085836
1143 Ga0496110_0778965
1144 Ga0496110_1041144
1145 Ga0496111_0057468
1146 Ga0496112_0264383
1147 Ga0496112_0870959
1148 Ga0496113_0080297
1149 Ga0496113_0519785
1150 Ga0496113_0877682
1151 Ga0496114_0206538
1152 Ga0496114_0625556
1153 Ga0496116_0103701
1154 Ga0496116_0168009
1155 Ga0496118_0074493
1156 Ga0496118_0138623
1157 Ga0496118_0194240
1158 Ga0496119_0178115
1159 Ga0496121_0023184
1160 Ga0496121_0030905
1161 Ga0496121_0068922
1162 Ga0496121_0133688
1163 Ga0496121_0232476
1164 Ga0496121_0301360
1165 Ga0496121_0306999
1166 Ga0496125_0008985
1167 Ga0496125_0539681
1168 Ga0496126_0003051
1169 Ga0496126_0054104
1170 Ga0496126_0115984
1171 Ga0496126_0259526
1172 Ga0496126_0263814
1173 Ga0496126_0264461
1174 Ga0496126_0355521
1175 Ga0496126_0523939
1176 Ga0501031_0000186
1177 Ga0501031_0043135
1178 Ga0501031_0116586
1179 Ga0501031_0285058
1180 Ga0501032_0000812
1181 Ga0501032_0257808
1182 Ga0501032_0354143
1183 Ga0501032_0486039
1184 Ga0501033_0000098
1185 Ga0501033_0000558
1186 Ga0501033_0357608
1187 Ga0501033_0795645
1188 Ga0501034_0001272
1189 Ga0501034_0040902
1190 Ga0501034_0208699
1191 Ga0501034_1109219
1192 Ga0501036_0000049
1193 Ga0501036_0058130
1194 Ga0501036_0063338
1195 Ga0501036_0078237
1196 Ga0501036_0696881
1197 Ga0501036_0835420
1198 Ga0501037_0000069
1199 Ga0501037_0062592
1200 Ga0501037_0147553
1201 Ga0501037_0182765
1202 Ga0501037_0335182
1203 Ga0501038_0000034
1204 Ga0501038_0012344
1205 Ga0501038_0037370
1206 Ga0501038_0127344
1207 Ga0501038_0135455
1208 Ga0501038_0194038
1209 Ga0501038_0231496
1210 Ga0501039_0000090
1211 Ga0501039_0128477
1212 Ga0501039_0257269
1213 Ga0501039_0326257
1214 Ga0501042_0025312
1215 Ga0501042_0102076
1216 Ga0501042_0209264
1217 Ga0501042_0526993
1218 Ga0501043_0000130
1219 Ga0501043_0005207
1220 Ga0501043_0005391
1221 Ga0501043_0186171
1222 Ga0501043_0505413
1223 Ga0501046_0000213
1224 Ga0501046_0287368
1225 Ga0501046_0585928
1226 Ga0501047_0001193
1227 Ga0501047_0270516
1228 Ga0501048_0001677
1229 Ga0501067_0000264
1230 Ga0501068_0006089
1231 Ga0501068_0153262
1232 Ga0501069_0004059
1233 Ga0501070_0061513
1234 Ga0501070_0347870
1235 Ga0501071_0169058
1236 Ga0501071_0703618
1237 Ga0501072_0000146
1238 Ga0501073_0000545
1239 Ga0501074_0014578
1240 Ga0501074_0315739
1241 Ga0501076_0293804
1242 Ga0501079_0001094
1243 Ga0501079_0369163
1244 Ga0501080_0030649
1245 Ga0501081_0484614
1246 Ga0501083_0001109
1247 Ga0501035_0004800
1248 Ga0501035_0006698
1249 Ga0501035_0161636
1250 Ga0501035_0789176
1251 Ga0501044_0004850
1252 Ga0501044_0004863
1253 Ga0501044_0036225
1254 Ga0501044_0077694
1255 Ga0501044_0133105
1256 Ga0501045_0008308
1257 nmdc:mga03n38_30026_c1
1258 nmdc:mga00v17_205190_c1
1259 nmdc:mga00v17_47787_c1
1260 nmdc:mga0yw44_157293_c1
1261 nmdc:mga0yw44_270144_c1
1262 nmdc:mga0yw44_73362_c1
1263 nmdc:mga0k408_260379_c1
1264 nmdc:mga06z11_200104_c1
1265 nmdc:mga06z11_388505_c1
1266 nmdc:mga06z11_389671_c1
1267 nmdc:mga06z11_570784_c1
1268 nmdc:mga04h51_21687_c1
1269 nmdc:mga07m45_253134_c1
1270 nmdc:mga07m45_432102_c1
1271 nmdc:mga07m45_9322_c1
1272 nmdc:mga08y16_243105_c1
1273 nmdc:mga0n895_79859_c1
1274 nmdc:mga08x19_274933_c1
1275 nmdc:mga0sz30_386547_c1
1276 Ga0495601_0642301
1277 Ga0500610_0232479
1278 Ga0500610_0235319
1279 Ga0495655_0053674
1280 Ga0495595_0179797
1281 Ga0500578_0151215
1282 Ga0500643_000116
1283 Ga0500644_0098017
1284 Ga0500651_0232971
1285 Ga0500566_0004414
1286 Ga0500555_001167
1287 Ga0500562_007630
1288 Ga0500595_028988
1289 Ga0500614_056475
1290 Ga0500618_099343
1291 Ga0500621_120756
1292 Ga0500559_0000142
1293 Ga0500559_0011875
1294 Ga0500561_0005165
1295 Ga0500568_0003430
1296 Ga0500573_0067381
1297 Ga0500603_020058
1298 Ga0500604_0128026
1299 Ga0500627_0001120
1300 Ga0500627_0052263
1301 Ga0500636_0025189
1302 Ga0500645_027998
1303 Ga0500552_026183
1304 Ga0500596_003901
1305 Ga0500596_009002
1306 Ga0501084_0000932
1307 Ga0500661_019821
1308 Ga0587076_030712
1309 Ga0587114_072891
1310 Ga0501082_0032140
1311 2935649548
1312 2507509194
1313 2508543259
1314 2508690997
1315 2509147448
1316 2511396239
1317 2513637749
1318 2513646830
1319 2513654536
1320 2513675527
1321 2513691986
1322 2513723125
1323 2513860908
1324 2513892838
1325 2513915285
1326 2515626602
1327 2517101831
1328 2517892584
1329 2524436752
1330 2524465136
1331 2524539074
1332 2528855760
1333 2617351286
1334 2617376300
1335 2671122315
1336 2723845621
1337 2728750492
1338 2745079177
1339 2793063889
1340 2793068591
1341 2793083778
1342 2805918149
1343 2818242670
1344 2824606745
1345 2824616643
1346 2824621840
1347 2824632543
1348 2824639503
1349 2824651525
1350 2824660982
1351 2824670842
1352 2824677639
1353 2824695359
1354 2824702249
1355 2824708771
1356 2824721572
1357 2824729239
1358 2824739718
1359 2824753511
1360 2824761262
1361 2824773186
1362 2824779180
1363 2842039602
1364 2842047452
1365 2844318536
1366 2847935470
1367 2847946030
1368 2857513745
1369 2857527916
1370 2874597308
1371 2874609767
1372 2874626795
1373 2874631207
1374 2874649359
1375 2876770418
1376 2876777895
1377 2876809345
1378 2876823084
1379 2879078652
1380 2879088502
1381 2879108133
1382 2879118365
1383 2879132871
1384 2879148670
1385 2881366842
1386 2881672156
1387 2885371963
1388 2885379305
1389 2885386307
1390 2885415255
1391 2888383498
1392 2888394449
1393 2889040427
1394 2903730098
1395 2903753540
1396 2903771931
1397 2904668373
1398 2904695938
1399 2904702690
1400 2904717331
1401 2906603483
1402 2906618421
1403 2906632233
1404 2906638720
1405 2906650831
1406 2906664122
1407 2908742907
1408 2908760567
1409 2908779578
1410 2919075316
1411 2922368297
1412 2922373694
1413 2922388239
1414 2922429679
1415 2929617422
1416 2929627127
1417 2932787543
1418 2932800722
1419 2932803341
1420 2932813276
1421 2932820803
1422 2932834824
1423 2933579378
1424 2935611923
1425 2935621789
1426 2935631848
1427 2935642733
1428 2935658937
1429 2935667835
1430 2935682327
1431 2935688586
1432 2935695937
1433 2935706676
1434 2935715605
1435 2935725831
1436 2935734424
1437 2935743803
1438 2935754160
1439 2935763199
1440 2935772604
1441 2935783156
1442 2935790897
1443 2935799402
1444 2935806349
1445 2935812950
1446 2935821403
1447 2935830602
1448 2935840631
1449 2935850338
1450 2935860036
1451 2935869329
1452 2935880510
1453 2935886413
1454 2935914383
1455 2935921097
1456 2935932039
1457 2935940636
1458 2935948579
1459 2935956950
1460 2935960282
1461 2935973548
1462 2935977531
1463 2935989999
1464 2935999558
1465 2936006457
1466 2936012970
1467 2936021534
1468 2936030263
1469 2936041538
1470 2936047728
1471 2936057114
1472 2940560464
1473 2941513037
1474 2941521059
1475 2941526077
1476 2941534286
1477 2941541239
1478 3005480017
1479 3005590058
1480 3005598647
1481 3005714304
1482 3005721811
1483 8006928992
1484 8006941213
1485 8006967249
1486 8006980581
1487 8006992066
1488 8006997485
1489 8016513989
1490 8016530203
1491 8016535458
1492 8016548656
1493 8016553475
1494 8016561857
1495 8016573790
1496 8016577915
1497 8016592561
1498 8016599685
1499 8016611163
1500 8016622473
1501 8016627312
1502 8016631599
1503 8017062417
1504 8019535195
1505 8019544286
1506 8019554413
1507 8019556989
1508 8019568310
1509 8019581878
1510 8019589559
1511 8019616842
1512 8019627509
1513 8019635061
1514 8019644668
1515 8019657696
1516 8019662903
1517 8019672502
1518 8019683655
1519 8019689408
1520 8055746963
1521 8056674363
1522 8056683276
1523 8056690041
1524 8056972898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map