F479487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 759 | 392 | 754 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10096785|Ga0307516_100967852 |
| Length | 277 |
| Sequence | MIFTQVSRDDRTQASTRECRGGAESPESRANPGNRARADCLVTGGDGTGNAAAMQQPTRIAPSILSADFARLGAEVEAIDAAGADYIHVDVMDGHFVPNLTIGPVVVRALRPHSNKTFDVHLMIAPVDPYVPEFAEAGADILTFHPEAGPHAHRTVQLIRSHGKKAGISLNPGTPIDFIDHLLPELDLVLIMSVNPGFGGQKFLPLALDKIQAVRRKINQVAESQNGRPIDLEVDGGITADNAASVIKAGADVLVAGTASFTGGAKRYADNIARLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 3 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 4 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 5 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 6 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 7 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 8 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 17 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 124 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 204 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 218 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 224 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 260 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 261 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 262 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 263 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 264 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 331 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 339 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 369 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 377 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 378 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 379 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 382 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 383 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 384 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 388 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 389 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 390 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.23 |
| Metatranscriptomes | 2.11 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.77 |
| Nodule | 0.13 |
| Rhizoplane | 2.77 |
| Rhizosphere | 84.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2903557 | 2162886007 | Bacteria | 1012 |
| 2 | JGI24736J21556_1007878 | 3300001904 | Bacteria | 1782 |
| 3 | JGI24741J21665_1001461 | 3300001915 | Bacteria | 6768 |
| 4 | JGI24741J21665_1001635 | 3300001915 | Bacteria | 6242 |
| 5 | JGI24741J21665_1018071 | 3300001915 | Bacteria | 1130 |
| 6 | JGI24740J21852_10000218 | 3300001979 | Bacteria | 24225 |
| 7 | JGI24740J21852_10000952 | 3300001979 | Bacteria | 12863 |
| 8 | JGI24740J21852_10042802 | 3300001979 | Bacteria | 1354 |
| 9 | JGI25150J39212_1000032 | 3300002774 | Bacteria | 99615 |
| 10 | JGI25151J46595_10000010 | 3300003187 | Bacteria | 277507 |
| 11 | JGI25151J46595_10001571 | 3300003187 | Bacteria | 15244 |
| 12 | JGI25165J46597_1003063 | 3300003214 | Bacteria | 4534 |
| 13 | JGI25153J46596_10000013 | 3300003215 | Bacteria | 303690 |
| 14 | JGI25153J46596_10001011 | 3300003215 | Bacteria | 17119 |
| 15 | Ga0055542_1007844 | 3300003762 | Bacteria | 2130 |
| 16 | Ga0055526_1029522 | 3300003771 | Bacteria | 1625 |
| 17 | Ga0055531_10011784 | 3300003794 | Bacteria | 4177 |
| 18 | Ga0055531_10012303 | 3300003794 | Bacteria | 4037 |
| 19 | Ga0058863_11530858 | 3300004799 | Bacteria | 910 |
| 20 | Ga0058861_11853254 | 3300004800 | Bacteria | 1340 |
| 21 | Ga0058862_12563802 | 3300004803 | Bacteria | 988 |
| 22 | Ga0058862_12839795 | 3300004803 | Bacteria | 1097 |
| 23 | Ga0065704_10013744 | 3300005289 | Bacteria | 1832 |
| 24 | Ga0065704_10114139 | 3300005289 | Bacteria | 1897 |
| 25 | Ga0065704_10178728 | 3300005289 | Bacteria | 1249 |
| 26 | Ga0070658_10005847 | 3300005327 | Bacteria | 9974 |
| 27 | Ga0070683_100059060 | 3300005329 | Bacteria | 3563 |
| 28 | Ga0070683_100090405 | 3300005329 | Bacteria | 2874 |
| 29 | Ga0070670_100961896 | 3300005331 | Bacteria | 776 |
| 30 | Ga0070677_10009295 | 3300005333 | Bacteria | 3329 |
| 31 | Ga0070680_100002370 | 3300005336 | Bacteria | 13928 |
| 32 | Ga0070680_100006137 | 3300005336 | Bacteria | 9111 |
| 33 | Ga0070680_100117031 | 3300005336 | Bacteria | 2222 |
| 34 | Ga0070682_100012978 | 3300005337 | Bacteria | 4782 |
| 35 | Ga0070682_100030283 | 3300005337 | Bacteria | 3265 |
| 36 | Ga0070682_100132106 | 3300005337 | Bacteria | 1691 |
| 37 | Ga0070660_100105114 | 3300005339 | Bacteria | 2240 |
| 38 | Ga0070660_100153544 | 3300005339 | Bacteria | 1852 |
| 39 | Ga0070689_100228815 | 3300005340 | Bacteria | 1528 |
| 40 | Ga0070691_10000192 | 3300005341 | Bacteria | 20485 |
| 41 | Ga0070691_10105392 | 3300005341 | Bacteria | 1405 |
| 42 | Ga0070661_100008590 | 3300005344 | Bacteria | 7062 |
| 43 | Ga0070661_100062142 | 3300005344 | Bacteria | 2742 |
| 44 | Ga0070661_100062792 | 3300005344 | Bacteria | 2727 |
| 45 | Ga0070692_10000140 | 3300005345 | Bacteria | 17499 |
| 46 | Ga0070692_10075286 | 3300005345 | Bacteria | 1807 |
| 47 | Ga0070668_100013534 | 3300005347 | Bacteria | 6090 |
| 48 | Ga0070669_100041926 | 3300005353 | Bacteria | 3330 |
| 49 | Ga0070675_100111468 | 3300005354 | Bacteria | 2315 |
| 50 | Ga0070671_100012619 | 3300005355 | Bacteria | 6809 |
| 51 | Ga0070674_100036125 | 3300005356 | Bacteria | 3314 |
| 52 | Ga0070674_100076735 | 3300005356 | Bacteria | 2376 |
| 53 | Ga0070674_100222311 | 3300005356 | Bacteria | 1469 |
| 54 | Ga0070673_100134200 | 3300005364 | Bacteria | 2081 |
| 55 | Ga0070673_100343246 | 3300005364 | Bacteria | 1324 |
| 56 | Ga0070667_100071236 | 3300005367 | Bacteria | 2960 |
| 57 | Ga0070667_100685241 | 3300005367 | Bacteria | 948 |
| 58 | Ga0070709_10337142 | 3300005434 | Bacteria | 1111 |
| 59 | Ga0070714_100027224 | 3300005435 | Bacteria | 4731 |
| 60 | Ga0070713_100008932 | 3300005436 | Bacteria | 7139 |
| 61 | Ga0070713_100337264 | 3300005436 | Bacteria | 1396 |
| 62 | Ga0070713_100928042 | 3300005436 | Bacteria | 838 |
| 63 | Ga0070713_100986314 | 3300005436 | Bacteria | 812 |
| 64 | Ga0070710_10045605 | 3300005437 | Bacteria | 2438 |
| 65 | Ga0070710_10115171 | 3300005437 | Bacteria | 1620 |
| 66 | Ga0070701_10164164 | 3300005438 | Bacteria | 1289 |
| 67 | Ga0070705_100236541 | 3300005440 | Bacteria | 1274 |
| 68 | Ga0070700_100264326 | 3300005441 | Bacteria | 1240 |
| 69 | Ga0070708_100004705 | 3300005445 | Bacteria | 10757 |
| 70 | Ga0070663_100051357 | 3300005455 | Bacteria | 2937 |
| 71 | Ga0070663_100205801 | 3300005455 | Bacteria | 1538 |
| 72 | Ga0070678_100021861 | 3300005456 | Bacteria | 4228 |
| 73 | Ga0070678_100022127 | 3300005456 | Bacteria | 4204 |
| 74 | Ga0070678_100060385 | 3300005456 | Bacteria | 2790 |
| 75 | Ga0070662_100049987 | 3300005457 | Bacteria | 3016 |
| 76 | Ga0070681_10002172 | 3300005458 | Bacteria | 17847 |
| 77 | Ga0070681_10003218 | 3300005458 | Bacteria | 15216 |
| 78 | Ga0070681_10026450 | 3300005458 | Bacteria | 5830 |
| 79 | Ga0070681_10065692 | 3300005458 | Bacteria | 3596 |
| 80 | Ga0068867_100048884 | 3300005459 | Bacteria | 3113 |
| 81 | Ga0070706_100000078 | 3300005467 | Bacteria | 112530 |
| 82 | Ga0070706_100093691 | 3300005467 | Bacteria | 2787 |
| 83 | Ga0070706_100241398 | 3300005467 | Bacteria | 1687 |
| 84 | Ga0070707_100407371 | 3300005468 | Bacteria | 1320 |
| 85 | Ga0070698_100099465 | 3300005471 | Bacteria | 2882 |
| 86 | Ga0070699_100019801 | 3300005518 | Bacteria | 5800 |
| 87 | Ga0070699_100135906 | 3300005518 | Bacteria | 2169 |
| 88 | Ga0070699_100169212 | 3300005518 | Bacteria | 1936 |
| 89 | Ga0070679_100000921 | 3300005530 | Bacteria | 25586 |
| 90 | Ga0070679_100001059 | 3300005530 | Bacteria | 23994 |
| 91 | Ga0070679_100031516 | 3300005530 | Bacteria | 5238 |
| 92 | Ga0070679_100119971 | 3300005530 | Bacteria | 2615 |
| 93 | Ga0070684_100080002 | 3300005535 | Bacteria | 2890 |
| 94 | Ga0070684_100083930 | 3300005535 | Bacteria | 2823 |
| 95 | Ga0070684_100200333 | 3300005535 | Bacteria | 1818 |
| 96 | Ga0070697_100009172 | 3300005536 | Bacteria | 7730 |
| 97 | Ga0068853_100018102 | 3300005539 | Bacteria | 5826 |
| 98 | Ga0068853_100089986 | 3300005539 | Bacteria | 2696 |
| 99 | Ga0068853_100114077 | 3300005539 | Bacteria | 2403 |
| 100 | Ga0070672_100025661 | 3300005543 | Bacteria | 4374 |
| 101 | Ga0070672_100052932 | 3300005543 | Bacteria | 3172 |
| 102 | Ga0070696_100060833 | 3300005546 | Bacteria | 2641 |
| 103 | Ga0070693_100074101 | 3300005547 | Bacteria | 2013 |
| 104 | Ga0070665_100013951 | 3300005548 | Bacteria | 8082 |
| 105 | Ga0070665_100271255 | 3300005548 | Bacteria | 1698 |
| 106 | Ga0070665_100394469 | 3300005548 | Bacteria | 1392 |
| 107 | Ga0070665_100827597 | 3300005548 | Bacteria | 939 |
| 108 | Ga0068855_100005890 | 3300005563 | Bacteria | 14942 |
| 109 | Ga0068855_100425079 | 3300005563 | Bacteria | 1453 |
| 110 | Ga0068855_100481229 | 3300005563 | Bacteria | 1351 |
| 111 | Ga0070664_100068179 | 3300005564 | Bacteria | 3041 |
| 112 | Ga0070664_100187272 | 3300005564 | Bacteria | 1843 |
| 113 | Ga0068857_100060138 | 3300005577 | Bacteria | 3375 |
| 114 | Ga0068857_100111168 | 3300005577 | Bacteria | 2463 |
| 115 | Ga0068854_100015268 | 3300005578 | Bacteria | 5083 |
| 116 | Ga0068854_100022402 | 3300005578 | Bacteria | 4303 |
| 117 | Ga0068854_100077711 | 3300005578 | Bacteria | 2443 |
| 118 | Ga0068854_100113938 | 3300005578 | Bacteria | 2043 |
| 119 | Ga0068856_100020297 | 3300005614 | Bacteria | 6454 |
| 120 | Ga0068856_100180940 | 3300005614 | Bacteria | 2121 |
| 121 | Ga0068852_100003635 | 3300005616 | Bacteria | 10800 |
| 122 | Ga0068852_100018449 | 3300005616 | Bacteria | 5497 |
| 123 | Ga0068852_100022939 | 3300005616 | Bacteria | 5015 |
| 124 | Ga0068866_10067273 | 3300005718 | Bacteria | 1880 |
| 125 | Ga0068870_10004675 | 3300005840 | Bacteria | 5914 |
| 126 | Ga0068863_100215634 | 3300005841 | Bacteria | 1848 |
| 127 | Ga0068863_100686681 | 3300005841 | Bacteria | 1017 |
| 128 | Ga0068858_100190109 | 3300005842 | Bacteria | 1940 |
| 129 | Ga0068860_100426764 | 3300005843 | Bacteria | 1315 |
| 130 | Ga0068862_100010966 | 3300005844 | Bacteria | 7483 |
| 131 | Ga0068862_100045989 | 3300005844 | Bacteria | 3725 |
| 132 | Ga0081455_10143128 | 3300005937 | Bacteria | 1854 |
| 133 | Ga0081455_10153294 | 3300005937 | Bacteria | 1774 |
| 134 | Ga0081455_10168830 | 3300005937 | Bacteria | 1669 |
| 135 | Ga0081538_10009218 | 3300005981 | Bacteria | 8268 |
| 136 | Ga0081539_10147125 | 3300005985 | Bacteria | 1138 |
| 137 | Ga0070717_10058335 | 3300006028 | Bacteria | 3192 |
| 138 | Ga0070717_10227032 | 3300006028 | Bacteria | 1643 |
| 139 | Ga0075368_10079823 | 3300006042 | Bacteria | 1330 |
| 140 | Ga0075363_100005558 | 3300006048 | Bacteria | 5622 |
| 141 | Ga0070716_100247244 | 3300006173 | Bacteria | 1213 |
| 142 | Ga0070712_100116737 | 3300006175 | Bacteria | 2002 |
| 143 | Ga0070712_100120344 | 3300006175 | Bacteria | 1974 |
| 144 | Ga0097621_100065001 | 3300006237 | Bacteria | 3001 |
| 145 | Ga0097621_100145380 | 3300006237 | Bacteria | 2029 |
| 146 | Ga0097621_100374135 | 3300006237 | Bacteria | 1271 |
| 147 | Ga0075370_10009559 | 3300006353 | Bacteria | 5040 |
| 148 | Ga0068871_100052960 | 3300006358 | Bacteria | 3288 |
| 149 | Ga0068871_100198657 | 3300006358 | Bacteria | 1730 |
| 150 | Ga0075430_100361430 | 3300006846 | Bacteria | 1199 |
| 151 | Ga0075431_100209105 | 3300006847 | Bacteria | 1994 |
| 152 | Ga0075433_10117007 | 3300006852 | Bacteria | 2365 |
| 153 | Ga0068865_100063201 | 3300006881 | Bacteria | 2601 |
| 154 | Ga0068865_100064415 | 3300006881 | Bacteria | 2580 |
| 155 | Ga0068865_100171550 | 3300006881 | Bacteria | 1663 |
| 156 | Ga0068865_100416581 | 3300006881 | Bacteria | 1103 |
| 157 | Ga0105240_10001510 | 3300009093 | Bacteria | 39587 |
| 158 | Ga0105240_10005743 | 3300009093 | Bacteria | 18404 |
| 159 | Ga0105240_10197172 | 3300009093 | Bacteria | 2363 |
| 160 | Ga0105240_10580077 | 3300009093 | Bacteria | 1237 |
| 161 | Ga0105240_10884576 | 3300009093 | Bacteria | 962 |
| 162 | Ga0111539_10057730 | 3300009094 | Bacteria | 4608 |
| 163 | Ga0111539_10085414 | 3300009094 | Bacteria | 3709 |
| 164 | Ga0111539_10213592 | 3300009094 | Bacteria | 2247 |
| 165 | Ga0111539_10270444 | 3300009094 | Bacteria | 1978 |
| 166 | Ga0111539_10489632 | 3300009094 | Bacteria | 1432 |
| 167 | Ga0105245_10043644 | 3300009098 | Bacteria | 3999 |
| 168 | Ga0105245_10188069 | 3300009098 | Bacteria | 1976 |
| 169 | Ga0105247_10037319 | 3300009101 | Bacteria | 2965 |
| 170 | Ga0105247_10549251 | 3300009101 | Bacteria | 849 |
| 171 | Ga0114129_10154214 | 3300009147 | Bacteria | 3142 |
| 172 | Ga0114129_10259074 | 3300009147 | Bacteria | 2332 |
| 173 | Ga0105243_10558462 | 3300009148 | Bacteria | 1095 |
| 174 | Ga0105241_10054323 | 3300009174 | Bacteria | 3066 |
| 175 | Ga0105241_10155914 | 3300009174 | Bacteria | 1872 |
| 176 | Ga0105241_10546756 | 3300009174 | Bacteria | 1039 |
| 177 | Ga0105242_10126845 | 3300009176 | Bacteria | 2197 |
| 178 | Ga0105242_10328124 | 3300009176 | Bacteria | 1406 |
| 179 | Ga0105248_10007217 | 3300009177 | Bacteria | 12191 |
| 180 | Ga0105248_10176839 | 3300009177 | Bacteria | 2405 |
| 181 | Ga0105248_11143780 | 3300009177 | Bacteria | 880 |
| 182 | Ga0105248_11353140 | 3300009177 | Bacteria | 805 |
| 183 | Ga0105237_10001757 | 3300009545 | Bacteria | 28033 |
| 184 | Ga0105237_10798105 | 3300009545 | Bacteria | 951 |
| 185 | Ga0105238_10001945 | 3300009551 | Bacteria | 20780 |
| 186 | Ga0105238_10064580 | 3300009551 | Bacteria | 3660 |
| 187 | Ga0105249_11016791 | 3300009553 | Bacteria | 898 |
| 188 | Ga0099796_10084291 | 3300010159 | Bacteria | 1171 |
| 189 | Ga0105239_10048904 | 3300010375 | Bacteria | 4636 |
| 190 | Ga0105239_10205533 | 3300010375 | Bacteria | 2207 |
| 191 | Ga0105239_10746415 | 3300010375 | Bacteria | 1120 |
| 192 | Ga0105246_10003166 | 3300011119 | Bacteria | 9996 |
| 193 | Ga0105246_10076483 | 3300011119 | Bacteria | 2372 |
| 194 | Ga0157371_10066479 | 3300013102 | Bacteria | 2552 |
| 195 | Ga0157371_10081128 | 3300013102 | Bacteria | 2296 |
| 196 | Ga0157371_10207666 | 3300013102 | Bacteria | 1405 |
| 197 | Ga0157370_10002287 | 3300013104 | Bacteria | 23214 |
| 198 | Ga0157370_10051198 | 3300013104 | Bacteria | 3945 |
| 199 | Ga0157370_10172926 | 3300013104 | Bacteria | 2008 |
| 200 | Ga0157369_10012731 | 3300013105 | Bacteria | 9538 |
| 201 | Ga0157369_10152727 | 3300013105 | Bacteria | 2440 |
| 202 | Ga0157369_10228483 | 3300013105 | Bacteria | 1946 |
| 203 | Ga0157369_10285615 | 3300013105 | Bacteria | 1718 |
| 204 | Ga0157369_10331781 | 3300013105 | Bacteria | 1580 |
| 205 | Ga0157369_10478004 | 3300013105 | Bacteria | 1289 |
| 206 | Ga0157369_10487804 | 3300013105 | Bacteria | 1275 |
| 207 | Ga0157374_10404451 | 3300013296 | Bacteria | 1362 |
| 208 | Ga0157378_10694609 | 3300013297 | Bacteria | 1036 |
| 209 | Ga0157378_10889484 | 3300013297 | Bacteria | 921 |
| 210 | Ga0163162_10318699 | 3300013306 | Bacteria | 1687 |
| 211 | Ga0157372_10006467 | 3300013307 | Bacteria | 12478 |
| 212 | Ga0157372_10016224 | 3300013307 | Bacteria | 7992 |
| 213 | Ga0157372_10040855 | 3300013307 | Bacteria | 5126 |
| 214 | Ga0157375_10001924 | 3300013308 | Bacteria | 17865 |
| 215 | Ga0157375_10012821 | 3300013308 | Bacteria | 7444 |
| 216 | Ga0163163_10004832 | 3300014325 | Bacteria | 11577 |
| 217 | Ga0163163_10041829 | 3300014325 | Bacteria | 4484 |
| 218 | Ga0163163_10258025 | 3300014325 | Bacteria | 1794 |
| 219 | Ga0157380_10028522 | 3300014326 | Bacteria | 4256 |
| 220 | Ga0157380_10135749 | 3300014326 | Bacteria | 2105 |
| 221 | Ga0157380_10498600 | 3300014326 | Bacteria | 1182 |
| 222 | Ga0157380_10521437 | 3300014326 | Bacteria | 1159 |
| 223 | Ga0182008_10043776 | 3300014497 | Bacteria | 2228 |
| 224 | Ga0157377_10163989 | 3300014745 | Bacteria | 1384 |
| 225 | Ga0157377_10370863 | 3300014745 | Bacteria | 966 |
| 226 | Ga0157379_10669230 | 3300014968 | Bacteria | 973 |
| 227 | Ga0157376_10168196 | 3300014969 | Bacteria | 1994 |
| 228 | Ga0157376_10292583 | 3300014969 | Bacteria | 1538 |
| 229 | Ga0157376_10946608 | 3300014969 | Bacteria | 882 |
| 230 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 231 | Ga0163161_10403638 | 3300017792 | Bacteria | 1096 |
| 232 | Ga0197907_10554686 | 3300020069 | Bacteria | 2038 |
| 233 | Ga0206356_10126730 | 3300020070 | Bacteria | 6649 |
| 234 | Ga0206356_11225299 | 3300020070 | Bacteria | 1481 |
| 235 | Ga0206355_1250981 | 3300020076 | Bacteria | 1233 |
| 236 | Ga0206351_10305709 | 3300020077 | Bacteria | 2908 |
| 237 | Ga0206350_10835923 | 3300020080 | Bacteria | 1396 |
| 238 | Ga0206354_10204110 | 3300020081 | Bacteria | 3221 |
| 239 | Ga0206354_10880630 | 3300020081 | Bacteria | 3745 |
| 240 | Ga0206353_10150174 | 3300020082 | Bacteria | 6346 |
| 241 | Ga0206353_10254288 | 3300020082 | Bacteria | 3215 |
| 242 | Ga0154015_1491307 | 3300020610 | Bacteria | 1307 |
| 243 | Ga0213871_10042191 | 3300021441 | Bacteria | 1228 |
| 244 | Ga0207427_104998 | 3300025231 | Bacteria | 1997 |
| 245 | Ga0207425_1000015 | 3300025245 | Bacteria | 466368 |
| 246 | Ga0209148_1000723 | 3300025254 | Bacteria | 26037 |
| 247 | Ga0209129_1000126 | 3300025258 | Bacteria | 133335 |
| 248 | Ga0209233_1000411 | 3300025261 | Bacteria | 33377 |
| 249 | Ga0209565_1011175 | 3300025263 | Bacteria | 2195 |
| 250 | Ga0209455_1000401 | 3300025272 | Bacteria | 36831 |
| 251 | Ga0209675_1004324 | 3300025291 | Bacteria | 6366 |
| 252 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 253 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 254 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 255 | Ga0209564_1016660 | 3300025295 | Bacteria | 2908 |
| 256 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 257 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 258 | Ga0209758_1000029 | 3300025297 | Bacteria | 520787 |
| 259 | Ga0209758_1010914 | 3300025297 | Bacteria | 5352 |
| 260 | Ga0209758_1020203 | 3300025297 | Bacteria | 3165 |
| 261 | Ga0209050_1009108 | 3300025298 | Bacteria | 5149 |
| 262 | Ga0209256_1035608 | 3300025299 | Bacteria | 1313 |
| 263 | Ga0209051_1030515 | 3300025303 | Bacteria | 2091 |
| 264 | Ga0209257_1000549 | 3300025304 | Bacteria | 64410 |
| 265 | Ga0209257_1001093 | 3300025304 | Bacteria | 35344 |
| 266 | Ga0209257_1011604 | 3300025304 | Bacteria | 4216 |
| 267 | Ga0209257_1026999 | 3300025304 | Bacteria | 1920 |
| 268 | Ga0207697_10149171 | 3300025315 | Bacteria | 1017 |
| 269 | Ga0207656_10006407 | 3300025321 | Bacteria | 4228 |
| 270 | Ga0207682_10011592 | 3300025893 | Bacteria | 3443 |
| 271 | Ga0207682_10012266 | 3300025893 | Bacteria | 3346 |
| 272 | Ga0207710_10084974 | 3300025900 | Bacteria | 1473 |
| 273 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 274 | Ga0207647_10000224 | 3300025904 | Bacteria | 46793 |
| 275 | Ga0207647_10001467 | 3300025904 | Bacteria | 18124 |
| 276 | Ga0207647_10002765 | 3300025904 | Bacteria | 13242 |
| 277 | Ga0207647_10144961 | 3300025904 | Bacteria | 1390 |
| 278 | Ga0207699_10031276 | 3300025906 | Bacteria | 2987 |
| 279 | Ga0207645_10185183 | 3300025907 | Bacteria | 1367 |
| 280 | Ga0207645_10234916 | 3300025907 | Bacteria | 1211 |
| 281 | Ga0207643_10016764 | 3300025908 | Bacteria | 3998 |
| 282 | Ga0207705_10000198 | 3300025909 | Bacteria | 61005 |
| 283 | Ga0207705_10009476 | 3300025909 | Bacteria | 7084 |
| 284 | Ga0207705_10027594 | 3300025909 | Bacteria | 4049 |
| 285 | Ga0207684_10000157 | 3300025910 | Bacteria | 115860 |
| 286 | Ga0207684_10094538 | 3300025910 | Bacteria | 2550 |
| 287 | Ga0207684_10188705 | 3300025910 | Bacteria | 1778 |
| 288 | Ga0207654_10167856 | 3300025911 | Bacteria | 1423 |
| 289 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 290 | Ga0207707_10000020 | 3300025912 | Bacteria | 205480 |
| 291 | Ga0207707_10000319 | 3300025912 | Bacteria | 50819 |
| 292 | Ga0207707_10000512 | 3300025912 | Bacteria | 39777 |
| 293 | Ga0207707_10000792 | 3300025912 | Bacteria | 30994 |
| 294 | Ga0207707_10000976 | 3300025912 | Bacteria | 27495 |
| 295 | Ga0207707_10010022 | 3300025912 | Bacteria | 8223 |
| 296 | Ga0207707_10081753 | 3300025912 | Bacteria | 2820 |
| 297 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 298 | Ga0207695_10003007 | 3300025913 | Bacteria | 24236 |
| 299 | Ga0207695_10077679 | 3300025913 | Bacteria | 3371 |
| 300 | Ga0207695_10110662 | 3300025913 | Bacteria | 2727 |
| 301 | Ga0207695_10578113 | 3300025913 | Bacteria | 1005 |
| 302 | Ga0207671_10001718 | 3300025914 | Bacteria | 24713 |
| 303 | Ga0207693_10013217 | 3300025915 | Bacteria | 6661 |
| 304 | Ga0207660_10001995 | 3300025917 | Bacteria | 13594 |
| 305 | Ga0207660_10005591 | 3300025917 | Bacteria | 8162 |
| 306 | Ga0207660_10006586 | 3300025917 | Bacteria | 7540 |
| 307 | Ga0207660_10011098 | 3300025917 | Bacteria | 5856 |
| 308 | Ga0207660_10042529 | 3300025917 | Bacteria | 3190 |
| 309 | Ga0207660_10046282 | 3300025917 | Bacteria | 3069 |
| 310 | Ga0207657_10014555 | 3300025919 | Bacteria | 7669 |
| 311 | Ga0207657_10016071 | 3300025919 | Bacteria | 7225 |
| 312 | Ga0207657_10058709 | 3300025919 | Bacteria | 3309 |
| 313 | Ga0207657_10068787 | 3300025919 | Bacteria | 3007 |
| 314 | Ga0207657_10196848 | 3300025919 | Bacteria | 1623 |
| 315 | Ga0207649_10002249 | 3300025920 | Bacteria | 10901 |
| 316 | Ga0207649_10008623 | 3300025920 | Bacteria | 5566 |
| 317 | Ga0207649_10028900 | 3300025920 | Bacteria | 3269 |
| 318 | Ga0207649_10059101 | 3300025920 | Bacteria | 2404 |
| 319 | Ga0207649_10085744 | 3300025920 | Bacteria | 2050 |
| 320 | Ga0207652_10000037 | 3300025921 | Bacteria | 134369 |
| 321 | Ga0207652_10000490 | 3300025921 | Bacteria | 40239 |
| 322 | Ga0207652_10000548 | 3300025921 | Bacteria | 38056 |
| 323 | Ga0207652_10000879 | 3300025921 | Bacteria | 28409 |
| 324 | Ga0207652_10011649 | 3300025921 | Bacteria | 7094 |
| 325 | Ga0207652_10016592 | 3300025921 | Bacteria | 6016 |
| 326 | Ga0207652_10064934 | 3300025921 | Bacteria | 3159 |
| 327 | Ga0207646_10036689 | 3300025922 | Bacteria | 4424 |
| 328 | Ga0207681_10079662 | 3300025923 | Bacteria | 2308 |
| 329 | Ga0207687_10247901 | 3300025927 | Bacteria | 1414 |
| 330 | Ga0207700_10052055 | 3300025928 | Bacteria | 3059 |
| 331 | Ga0207700_10335155 | 3300025928 | Bacteria | 1314 |
| 332 | Ga0207664_10237495 | 3300025929 | Bacteria | 1586 |
| 333 | Ga0207690_10017142 | 3300025932 | Bacteria | 4418 |
| 334 | Ga0207690_10040891 | 3300025932 | Bacteria | 3034 |
| 335 | Ga0207690_10112866 | 3300025932 | Bacteria | 1960 |
| 336 | Ga0207706_10064955 | 3300025933 | Bacteria | 3213 |
| 337 | Ga0207709_10403152 | 3300025935 | Bacteria | 1046 |
| 338 | Ga0207670_10224482 | 3300025936 | Bacteria | 1440 |
| 339 | Ga0207669_10210538 | 3300025937 | Bacteria | 1418 |
| 340 | Ga0207704_10106974 | 3300025938 | Bacteria | 1880 |
| 341 | Ga0207691_10010224 | 3300025940 | Bacteria | 9002 |
| 342 | Ga0207691_10017495 | 3300025940 | Bacteria | 6797 |
| 343 | Ga0207711_10119661 | 3300025941 | Bacteria | 2350 |
| 344 | Ga0207711_10525427 | 3300025941 | Bacteria | 1103 |
| 345 | Ga0207689_10213293 | 3300025942 | Bacteria | 1595 |
| 346 | Ga0207661_10045493 | 3300025944 | Bacteria | 3474 |
| 347 | Ga0207661_10052825 | 3300025944 | Bacteria | 3248 |
| 348 | Ga0207679_10127387 | 3300025945 | Bacteria | 2037 |
| 349 | Ga0207667_10003741 | 3300025949 | Bacteria | 18770 |
| 350 | Ga0207667_10004107 | 3300025949 | Bacteria | 17890 |
| 351 | Ga0207667_10004852 | 3300025949 | Bacteria | 16442 |
| 352 | Ga0207667_10006666 | 3300025949 | Bacteria | 13959 |
| 353 | Ga0207667_10013127 | 3300025949 | Bacteria | 9503 |
| 354 | Ga0207667_10663099 | 3300025949 | Bacteria | 1048 |
| 355 | Ga0207651_10165679 | 3300025960 | Bacteria | 1737 |
| 356 | Ga0207668_10041421 | 3300025972 | Bacteria | 3113 |
| 357 | Ga0207640_10001250 | 3300025981 | Bacteria | 13851 |
| 358 | Ga0207640_10028897 | 3300025981 | Bacteria | 3396 |
| 359 | Ga0207640_10072442 | 3300025981 | Bacteria | 2324 |
| 360 | Ga0207640_10075251 | 3300025981 | Bacteria | 2288 |
| 361 | Ga0207640_10107066 | 3300025981 | Bacteria | 1973 |
| 362 | Ga0207658_10125426 | 3300025986 | Bacteria | 2054 |
| 363 | Ga0207658_10234846 | 3300025986 | Bacteria | 1550 |
| 364 | Ga0207703_10283482 | 3300026035 | Bacteria | 1506 |
| 365 | Ga0207639_10000562 | 3300026041 | Bacteria | 25536 |
| 366 | Ga0207639_10018506 | 3300026041 | Bacteria | 4952 |
| 367 | Ga0207639_10031301 | 3300026041 | Bacteria | 3909 |
| 368 | Ga0207639_10766995 | 3300026041 | Bacteria | 897 |
| 369 | Ga0207678_10011828 | 3300026067 | Bacteria | 7663 |
| 370 | Ga0207678_10022764 | 3300026067 | Bacteria | 5487 |
| 371 | Ga0207678_10036855 | 3300026067 | Bacteria | 4257 |
| 372 | Ga0207678_10054937 | 3300026067 | Bacteria | 3430 |
| 373 | Ga0207678_10125519 | 3300026067 | Bacteria | 2189 |
| 374 | Ga0207708_10014979 | 3300026075 | Bacteria | 5810 |
| 375 | Ga0207708_10562110 | 3300026075 | Bacteria | 963 |
| 376 | Ga0207702_10005433 | 3300026078 | Bacteria | 11150 |
| 377 | Ga0207702_10016316 | 3300026078 | Bacteria | 6148 |
| 378 | Ga0207702_10613363 | 3300026078 | Bacteria | 1068 |
| 379 | Ga0207641_10223705 | 3300026088 | Bacteria | 1746 |
| 380 | Ga0207641_10284921 | 3300026088 | Bacteria | 1555 |
| 381 | Ga0207648_10267351 | 3300026089 | Bacteria | 1527 |
| 382 | Ga0207674_10018087 | 3300026116 | Bacteria | 7672 |
| 383 | Ga0207674_10018959 | 3300026116 | Bacteria | 7459 |
| 384 | Ga0207674_10038080 | 3300026116 | Bacteria | 4997 |
| 385 | Ga0207674_10040967 | 3300026116 | Bacteria | 4793 |
| 386 | Ga0207674_10237670 | 3300026116 | Bacteria | 1769 |
| 387 | Ga0207675_100035406 | 3300026118 | Bacteria | 4656 |
| 388 | Ga0207675_100065106 | 3300026118 | Bacteria | 3407 |
| 389 | Ga0207675_100342464 | 3300026118 | Bacteria | 1464 |
| 390 | Ga0207683_10027978 | 3300026121 | Bacteria | 4872 |
| 391 | Ga0207683_10050516 | 3300026121 | Bacteria | 3642 |
| 392 | Ga0207683_10071833 | 3300026121 | Bacteria | 3060 |
| 393 | Ga0207683_10096611 | 3300026121 | Bacteria | 2634 |
| 394 | Ga0207698_10000506 | 3300026142 | Bacteria | 22646 |
| 395 | Ga0207698_10002967 | 3300026142 | Bacteria | 10165 |
| 396 | Ga0207698_10010590 | 3300026142 | Bacteria | 5937 |
| 397 | Ga0207698_10345253 | 3300026142 | Bacteria | 1404 |
| 398 | Ga0207428_10001290 | 3300027907 | Bacteria | 26731 |
| 399 | Ga0268266_10149473 | 3300028379 | Bacteria | 2104 |
| 400 | Ga0268266_10683160 | 3300028379 | Bacteria | 989 |
| 401 | Ga0268265_10009019 | 3300028380 | Bacteria | 6746 |
| 402 | Ga0268265_10019872 | 3300028380 | Bacteria | 4678 |
| 403 | Ga0268264_10376019 | 3300028381 | Bacteria | 1359 |
| 404 | Ga0265338_10047890 | 3300028800 | Bacteria | 3897 |
| 405 | Ga0307512_10244802 | 3300030522 | Bacteria | 902 |
| 406 | Ga0265760_10024309 | 3300031090 | Bacteria | 1765 |
| 407 | Ga0265330_10008931 | 3300031235 | Bacteria | 4786 |
| 408 | Ga0265320_10053712 | 3300031240 | Bacteria | 1946 |
| 409 | Ga0265325_10047319 | 3300031241 | Bacteria | 2226 |
| 410 | Ga0265329_10001600 | 3300031242 | Bacteria | 10849 |
| 411 | Ga0265339_10000008 | 3300031249 | Bacteria | 239647 |
| 412 | Ga0265339_10005817 | 3300031249 | Bacteria | 8180 |
| 413 | Ga0265339_10015834 | 3300031249 | Bacteria | 4511 |
| 414 | Ga0265339_10062706 | 3300031249 | Bacteria | 1998 |
| 415 | Ga0265327_10003819 | 3300031251 | Bacteria | 13924 |
| 416 | Ga0265327_10059902 | 3300031251 | Bacteria | 1948 |
| 417 | Ga0265327_10082102 | 3300031251 | Bacteria | 1589 |
| 418 | Ga0265316_10000203 | 3300031344 | Bacteria | 69095 |
| 419 | Ga0265316_10098488 | 3300031344 | Bacteria | 2225 |
| 420 | Ga0307513_10156721 | 3300031456 | Bacteria | 2176 |
| 421 | Ga0307509_10218896 | 3300031507 | Bacteria | 1720 |
| 422 | Ga0307408_100609602 | 3300031548 | Bacteria | 971 |
| 423 | Ga0265313_10057889 | 3300031595 | Bacteria | 1828 |
| 424 | Ga0307508_10111953 | 3300031616 | Bacteria | 2330 |
| 425 | Ga0316575_10006188 | 3300031665 | Bacteria | 4294 |
| 426 | Ga0265314_10029023 | 3300031711 | Bacteria | 4116 |
| 427 | Ga0265314_10045935 | 3300031711 | Bacteria | 3084 |
| 428 | Ga0265342_10000221 | 3300031712 | Bacteria | 64721 |
| 429 | Ga0265342_10006958 | 3300031712 | Bacteria | 8359 |
| 430 | Ga0265342_10027877 | 3300031712 | Bacteria | 3523 |
| 431 | Ga0316576_10003250 | 3300031727 | Bacteria | 9481 |
| 432 | Ga0307516_10096785 | 3300031730 | Bacteria | 2772 |
| 433 | Ga0307413_10018790 | 3300031824 | Bacteria | 3635 |
| 434 | Ga0307406_10377367 | 3300031901 | Bacteria | 1117 |
| 435 | Ga0307412_10169580 | 3300031911 | Bacteria | 1631 |
| 436 | Ga0307416_100275195 | 3300032002 | Bacteria | 1656 |
| 437 | Ga0307416_101334465 | 3300032002 | Bacteria | 823 |
| 438 | Ga0307411_10111274 | 3300032005 | Bacteria | 1960 |
| 439 | Ga0307415_100102862 | 3300032126 | Bacteria | 2100 |
| 440 | Ga0307415_100799185 | 3300032126 | Bacteria | 861 |
| 441 | Ga0307415_101157536 | 3300032126 | Bacteria | 727 |
| 442 | Ga0316585_10023767 | 3300032137 | Bacteria | 1892 |
| 443 | Ga0307510_10000164 | 3300033180 | Bacteria | 56009 |
| 444 | Ga0307510_10046569 | 3300033180 | Bacteria | 4660 |
| 445 | Ga0373926_0043068 | 3300035083 | Bacteria | 1615 |
| 446 | Ga0373934_0012539 | 3300035086 | Bacteria | 3199 |
| 447 | Ga0373934_0077165 | 3300035086 | Bacteria | 1336 |
| 448 | Ga0373936_0042290 | 3300035113 | Bacteria | 1829 |
| 449 | Ga0373939_0123995 | 3300035114 | Bacteria | 915 |
| 450 | Ga0373953_0043558 | 3300035117 | Bacteria | 1792 |
| 451 | Ga0373953_0236075 | 3300035117 | Bacteria | 793 |
| 452 | Ga0373954_0050713 | 3300035118 | Bacteria | 1947 |
| 453 | Ga0373956_0117423 | 3300035119 | Bacteria | 1241 |
| 454 | Ga0373957_0120440 | 3300035120 | Bacteria | 1062 |
| 455 | Ga0373943_0034559 | 3300035170 | Bacteria | 2412 |
| 456 | Ga0373943_0092378 | 3300035170 | Bacteria | 1569 |
| 457 | Ga0373943_0100701 | 3300035170 | Bacteria | 1511 |
| 458 | Ga0373946_0021523 | 3300035171 | Bacteria | 2501 |
| 459 | Ga0373946_0226058 | 3300035171 | Bacteria | 905 |
| 460 | Ga0373955_0036950 | 3300035172 | Bacteria | 2595 |
| 461 | Ga0373955_0125170 | 3300035172 | Bacteria | 1497 |
| 462 | Ga0373924_0007147 | 3300035410 | Bacteria | 4024 |
| 463 | Ga0373931_0449046 | 3300035691 | Bacteria | 824 |
| 464 | Ga0373935_0038791 | 3300035692 | Bacteria | 2984 |
| 465 | Ga0373935_0063540 | 3300035692 | Bacteria | 2366 |
| 466 | Ga0373935_0106066 | 3300035692 | Bacteria | 1859 |
| 467 | Ga0373935_0583530 | 3300035692 | Bacteria | 817 |
| 468 | Ga0373927_0069172 | 3300035695 | Bacteria | 2285 |
| 469 | Ga0373927_0072265 | 3300035695 | Bacteria | 2232 |
| 470 | Ga0373933_0001978 | 3300035724 | Bacteria | 11812 |
| 471 | Ga0373933_0069550 | 3300035724 | Bacteria | 2140 |
| 472 | Ga0373947_0021275 | 3300035725 | Bacteria | 3753 |
| 473 | Ga0373947_0184747 | 3300035725 | Bacteria | 1359 |
| 474 | Ga0373947_0204717 | 3300035725 | Bacteria | 1292 |
| 475 | Ga0373937_0013933 | 3300036401 | Bacteria | 7089 |
| 476 | Ga0373937_0050840 | 3300036401 | Bacteria | 3798 |
| 477 | Ga0373937_0448340 | 3300036401 | Bacteria | 1225 |
| 478 | Ga0316584_0115833 | 3300036712 | Bacteria | 2005 |
| 479 | Ga0316584_0321335 | 3300036712 | Bacteria | 1117 |
| 480 | Ga0373925_0005605 | 3300037068 | Bacteria | 9347 |
| 481 | Ga0373925_0025732 | 3300037068 | Bacteria | 4303 |
| 482 | Ga0373925_0106863 | 3300037068 | Bacteria | 2158 |
| 483 | Ga0373925_0415187 | 3300037068 | Bacteria | 1099 |
| 484 | Ga0373925_0512330 | 3300037068 | Bacteria | 985 |
| 485 | Ga0373925_0910391 | 3300037068 | Bacteria | 725 |
| 486 | Ga0395899_0015110 | 3300037312 | Bacteria | 5885 |
| 487 | Ga0395899_0126232 | 3300037312 | Bacteria | 1830 |
| 488 | Ga0395900_0094482 | 3300037418 | Bacteria | 3071 |
| 489 | Ga0395900_0558630 | 3300037418 | Bacteria | 1088 |
| 490 | Ga0395898_0134465 | 3300037466 | Bacteria | 2367 |
| 491 | Ga0395898_0207152 | 3300037466 | Bacteria | 1871 |
| 492 | Ga0436364_0242530 | 3300037853 | Bacteria | 1780 |
| 493 | Ga0436364_1298093 | 3300037853 | Bacteria | 3643 |
| 494 | Ga0395901_0022931 | 3300038443 | Bacteria | 6399 |
| 495 | Ga0400483_129729 | 3300039062 | Bacteria | 8364 |
| 496 | Ga0400483_257754 | 3300039062 | Bacteria | 8883 |
| 497 | Ga0436365_1252050 | 3300039437 | Bacteria | 1347 |
| 498 | Ga0436365_1605027 | 3300039437 | Bacteria | 2107 |
| 499 | Ga0436360_0120062 | 3300039438 | Bacteria | 763 |
| 500 | Ga0436360_0471757 | 3300039438 | Bacteria | 1210 |
| 501 | Ga0436360_0495490 | 3300039438 | Bacteria | 2204 |
| 502 | Ga0436360_0527097 | 3300039438 | Bacteria | 2477 |
| 503 | Ga0436360_1053742 | 3300039438 | Bacteria | 1320 |
| 504 | Ga0436361_0282143 | 3300039447 | Bacteria | 1491 |
| 505 | Ga0439436_0079888 | 3300041404 | Bacteria | 910 |
| 506 | Ga0439447_035762 | 3300041407 | Bacteria | 1229 |
| 507 | Ga0439465_0021787 | 3300041413 | Bacteria | 2011 |
| 508 | Ga0439441_048167 | 3300042001 | Bacteria | 871 |
| 509 | Ga0439449_0000008 | 3300042007 | Bacteria | 62060 |
| 510 | Ga0439449_0009302 | 3300042007 | Bacteria | 3725 |
| 511 | Ga0439449_0012567 | 3300042007 | Bacteria | 3184 |
| 512 | Ga0439464_0078814 | 3300042439 | Bacteria | 982 |
| 513 | Ga0451577_0001586 | 3300042876 | Bacteria | 29663 |
| 514 | Ga0453683_0207064 | 3300044673 | Bacteria | 1246 |
| 515 | Ga0453684_0000374 | 3300044712 | Bacteria | 183743 |
| 516 | Ga0453684_0086229 | 3300044712 | Bacteria | 3897 |
| 517 | Ga0451576_0001603 | 3300045051 | Bacteria | 38023 |
| 518 | Ga0451576_0029780 | 3300045051 | Bacteria | 5840 |
| 519 | Ga0451576_0064226 | 3300045051 | Bacteria | 3824 |
| 520 | Ga0451576_0205524 | 3300045051 | Bacteria | 2056 |
| 521 | Ga0451576_0512494 | 3300045051 | Bacteria | 1260 |
| 522 | Ga0466967_0269442 | 3300045976 | Bacteria | 1631 |
| 523 | Ga0466967_1008736 | 3300045976 | Bacteria | 829 |
| 524 | Ga0495592_0264513 | 3300046454 | Bacteria | 1131 |
| 525 | Ga0495603_0385842 | 3300046455 | Bacteria | 803 |
| 526 | Ga0495629_0181557 | 3300046459 | Bacteria | 1458 |
| 527 | Ga0495651_0025267 | 3300046462 | Bacteria | 4623 |
| 528 | Ga0495653_0123957 | 3300046463 | Bacteria | 1837 |
| 529 | Ga0495650_0000345 | 3300046471 | Bacteria | 82674 |
| 530 | Ga0495605_0074461 | 3300046474 | Bacteria | 1598 |
| 531 | Ga0495639_0394796 | 3300046475 | Bacteria | 698 |
| 532 | Ga0495664_0010209 | 3300046477 | Bacteria | 5269 |
| 533 | Ga0495664_0203653 | 3300046477 | Bacteria | 1199 |
| 534 | Ga0495607_0017440 | 3300046501 | Bacteria | 4608 |
| 535 | Ga0495606_0040103 | 3300046507 | Bacteria | 3149 |
| 536 | Ga0495606_0312053 | 3300046507 | Bacteria | 848 |
| 537 | Ga0495608_0025784 | 3300046511 | Bacteria | 4012 |
| 538 | Ga0495608_0199974 | 3300046511 | Bacteria | 1259 |
| 539 | Ga0495610_0064100 | 3300046512 | Bacteria | 1738 |
| 540 | Ga0495616_0022804 | 3300046513 | Bacteria | 3376 |
| 541 | Ga0495618_0127207 | 3300046514 | Bacteria | 1631 |
| 542 | Ga0495628_0213846 | 3300046516 | Bacteria | 1449 |
| 543 | Ga0495632_0047640 | 3300046519 | Bacteria | 2125 |
| 544 | Ga0495643_0016911 | 3300046522 | Bacteria | 4276 |
| 545 | Ga0495663_0133587 | 3300046525 | Bacteria | 838 |
| 546 | Ga0495652_0051987 | 3300046529 | Bacteria | 3496 |
| 547 | Ga0495652_0082658 | 3300046529 | Bacteria | 2646 |
| 548 | Ga0495665_0040266 | 3300046531 | Bacteria | 2488 |
| 549 | Ga0495640_0086184 | 3300046533 | Bacteria | 2080 |
| 550 | Ga0495640_0184823 | 3300046533 | Bacteria | 1327 |
| 551 | Ga0495587_0007000 | 3300046536 | Bacteria | 7324 |
| 552 | Ga0495645_0006870 | 3300046543 | Bacteria | 7914 |
| 553 | Ga0495645_0310906 | 3300046543 | Bacteria | 1026 |
| 554 | Ga0495667_0077662 | 3300046559 | Bacteria | 2159 |
| 555 | Ga0495667_0097084 | 3300046559 | Bacteria | 1907 |
| 556 | Ga0495656_0125549 | 3300046615 | Bacteria | 1216 |
| 557 | Ga0495668_0001101 | 3300046616 | Bacteria | 27963 |
| 558 | Ga0495625_0013865 | 3300046660 | Bacteria | 6454 |
| 559 | Ga0495635_0021684 | 3300046663 | Bacteria | 4477 |
| 560 | Ga0495635_0126640 | 3300046663 | Bacteria | 1742 |
| 561 | Ga0495657_0010621 | 3300046675 | Bacteria | 6923 |
| 562 | Ga0495657_0015043 | 3300046675 | Bacteria | 5673 |
| 563 | Ga0495599_0006872 | 3300046678 | Bacteria | 6878 |
| 564 | Ga0495623_0018805 | 3300046679 | Bacteria | 4461 |
| 565 | Ga0495646_0016845 | 3300046680 | Bacteria | 4642 |
| 566 | Ga0495646_0149837 | 3300046680 | Bacteria | 1298 |
| 567 | Ga0495613_0016833 | 3300046689 | Bacteria | 5444 |
| 568 | Ga0495649_0071044 | 3300046694 | Bacteria | 1866 |
| 569 | Ga0495600_0047099 | 3300046809 | Bacteria | 2812 |
| 570 | Ga0495600_0065746 | 3300046809 | Bacteria | 2371 |
| 571 | Ga0495660_0062291 | 3300046810 | Bacteria | 2000 |
| 572 | Ga0495604_0096772 | 3300047317 | Bacteria | 2177 |
| 573 | Ga0495674_0013405 | 3300047319 | Bacteria | 7708 |
| 574 | Ga0495674_0123162 | 3300047319 | Bacteria | 2189 |
| 575 | Ga0495674_0329783 | 3300047319 | Bacteria | 1242 |
| 576 | Ga0495674_0462697 | 3300047319 | Bacteria | 1018 |
| 577 | Ga0495672_0075268 | 3300047320 | Bacteria | 1899 |
| 578 | Ga0495676_0167043 | 3300047321 | Bacteria | 1551 |
| 579 | Ga0495680_0021973 | 3300047322 | Bacteria | 5331 |
| 580 | Ga0495680_0210505 | 3300047322 | Bacteria | 1392 |
| 581 | Ga0495683_0029465 | 3300047323 | Bacteria | 2805 |
| 582 | Ga0495687_010327 | 3300047443 | Bacteria | 5127 |
| 583 | Ga0495675_0049058 | 3300047444 | Bacteria | 2684 |
| 584 | Ga0495673_0084838 | 3300047469 | Bacteria | 1305 |
| 585 | Ga0495681_0078036 | 3300047470 | Bacteria | 1485 |
| 586 | Ga0495684_0121074 | 3300047471 | Bacteria | 1971 |
| 587 | Ga0495684_0149015 | 3300047471 | Bacteria | 1750 |
| 588 | Ga0495684_0207408 | 3300047471 | Bacteria | 1442 |
| 589 | Ga0495684_0227616 | 3300047471 | Bacteria | 1365 |
| 590 | Ga0495686_0140108 | 3300047472 | Bacteria | 1427 |
| 591 | Ga0495686_0215674 | 3300047472 | Bacteria | 1094 |
| 592 | Ga0495602_0028107 | 3300048088 | Bacteria | 5388 |
| 593 | Ga0495602_0097429 | 3300048088 | Bacteria | 2423 |
| 594 | Ga0496100_0057306 | 3300048903 | Bacteria | 2552 |
| 595 | Ga0496101_0176843 | 3300048904 | Bacteria | 1642 |
| 596 | Ga0496102_0192024 | 3300048905 | Bacteria | 1924 |
| 597 | Ga0496102_0762140 | 3300048905 | Bacteria | 890 |
| 598 | Ga0496103_0010626 | 3300048906 | Bacteria | 5447 |
| 599 | Ga0496103_0322149 | 3300048906 | Bacteria | 994 |
| 600 | Ga0496104_0007046 | 3300048907 | Bacteria | 9917 |
| 601 | Ga0496104_0065930 | 3300048907 | Bacteria | 3437 |
| 602 | Ga0496105_0036422 | 3300048908 | Bacteria | 4053 |
| 603 | Ga0496106_0120985 | 3300048909 | Bacteria | 2046 |
| 604 | Ga0496107_0033786 | 3300048910 | Bacteria | 3661 |
| 605 | Ga0496108_0016114 | 3300048911 | Bacteria | 6093 |
| 606 | Ga0496108_0144852 | 3300048911 | Bacteria | 2048 |
| 607 | Ga0496110_0351660 | 3300048913 | Bacteria | 1342 |
| 608 | Ga0496112_0002373 | 3300048915 | Bacteria | 15134 |
| 609 | Ga0496113_0020912 | 3300048916 | Bacteria | 4609 |
| 610 | Ga0496113_0199527 | 3300048916 | Bacteria | 1590 |
| 611 | Ga0496113_0367327 | 3300048916 | Bacteria | 1155 |
| 612 | Ga0496114_0040228 | 3300048917 | Bacteria | 3869 |
| 613 | Ga0496114_0386199 | 3300048917 | Bacteria | 1240 |
| 614 | Ga0496115_0129572 | 3300048918 | Bacteria | 2079 |
| 615 | Ga0496118_0012072 | 3300048921 | Bacteria | 8339 |
| 616 | Ga0496118_0197443 | 3300048921 | Bacteria | 1196 |
| 617 | Ga0496119_0006959 | 3300048922 | Bacteria | 10317 |
| 618 | Ga0496119_0026724 | 3300048922 | Bacteria | 3992 |
| 619 | Ga0496119_0039745 | 3300048922 | Bacteria | 3020 |
| 620 | Ga0496120_0000916 | 3300048923 | Bacteria | 41045 |
| 621 | Ga0496121_0072782 | 3300048924 | Bacteria | 2758 |
| 622 | Ga0496122_0003953 | 3300048925 | Bacteria | 18940 |
| 623 | Ga0496122_0137941 | 3300048925 | Bacteria | 1533 |
| 624 | Ga0496123_0003147 | 3300048926 | Bacteria | 18908 |
| 625 | Ga0496124_0000034 | 3300048927 | Bacteria | 325332 |
| 626 | Ga0496124_0019770 | 3300048927 | Bacteria | 6251 |
| 627 | Ga0496125_0014710 | 3300048928 | Bacteria | 7605 |
| 628 | Ga0496125_0033784 | 3300048928 | Bacteria | 4519 |
| 629 | Ga0496125_0116963 | 3300048928 | Bacteria | 1913 |
| 630 | Ga0496126_0016188 | 3300048929 | Bacteria | 7469 |
| 631 | Ga0496126_0016541 | 3300048929 | Bacteria | 7373 |
| 632 | Ga0496126_0172050 | 3300048929 | Bacteria | 1844 |
| 633 | Ga0501031_0573022 | 3300049568 | Bacteria | 727 |
| 634 | Ga0501033_0002244 | 3300049570 | Bacteria | 16561 |
| 635 | Ga0501034_0000263 | 3300049571 | Bacteria | 95188 |
| 636 | Ga0501034_0007533 | 3300049571 | Bacteria | 11582 |
| 637 | Ga0501034_0037555 | 3300049571 | Bacteria | 4904 |
| 638 | Ga0501034_0102152 | 3300049571 | Bacteria | 2860 |
| 639 | Ga0501034_0116035 | 3300049571 | Bacteria | 2666 |
| 640 | Ga0501034_0616297 | 3300049571 | Bacteria | 989 |
| 641 | Ga0501036_0014560 | 3300049572 | Bacteria | 6549 |
| 642 | Ga0501037_0008717 | 3300049573 | Bacteria | 7434 |
| 643 | Ga0501037_0022763 | 3300049573 | Bacteria | 4633 |
| 644 | Ga0501038_0003645 | 3300049574 | Bacteria | 14346 |
| 645 | Ga0501038_0028147 | 3300049574 | Bacteria | 4993 |
| 646 | Ga0501038_0696976 | 3300049574 | Bacteria | 761 |
| 647 | Ga0501039_0008739 | 3300049575 | Bacteria | 7715 |
| 648 | Ga0501043_0000689 | 3300049579 | Bacteria | 29829 |
| 649 | Ga0501043_0073269 | 3300049579 | Bacteria | 2690 |
| 650 | Ga0501046_0001447 | 3300049580 | Bacteria | 22837 |
| 651 | Ga0501047_0007684 | 3300049581 | Bacteria | 10156 |
| 652 | Ga0501047_0010031 | 3300049581 | Bacteria | 8955 |
| 653 | Ga0501047_0018738 | 3300049581 | Bacteria | 6637 |
| 654 | Ga0501047_0409890 | 3300049581 | Bacteria | 1188 |
| 655 | Ga0501048_0077439 | 3300049582 | Bacteria | 2347 |
| 656 | Ga0501067_0007614 | 3300049583 | Bacteria | 6021 |
| 657 | Ga0501067_0071905 | 3300049583 | Bacteria | 1916 |
| 658 | Ga0501067_0074445 | 3300049583 | Bacteria | 1882 |
| 659 | Ga0501067_0183855 | 3300049583 | Bacteria | 1164 |
| 660 | Ga0501068_0123383 | 3300049584 | Bacteria | 1616 |
| 661 | Ga0501069_0003590 | 3300049585 | Bacteria | 7992 |
| 662 | Ga0501069_0006085 | 3300049585 | Bacteria | 6297 |
| 663 | Ga0501069_0093871 | 3300049585 | Bacteria | 1698 |
| 664 | Ga0501069_0164499 | 3300049585 | Bacteria | 1278 |
| 665 | Ga0501069_0186929 | 3300049585 | Bacteria | 1198 |
| 666 | Ga0501070_0000303 | 3300049586 | Bacteria | 45531 |
| 667 | Ga0501070_0000863 | 3300049586 | Bacteria | 27570 |
| 668 | Ga0501070_0003662 | 3300049586 | Bacteria | 13287 |
| 669 | Ga0501070_0016136 | 3300049586 | Bacteria | 6278 |
| 670 | Ga0501070_0025376 | 3300049586 | Bacteria | 4971 |
| 671 | Ga0501070_0027609 | 3300049586 | Bacteria | 4761 |
| 672 | Ga0501070_0038282 | 3300049586 | Bacteria | 4001 |
| 673 | Ga0501070_0166202 | 3300049586 | Bacteria | 1818 |
| 674 | Ga0501070_0221578 | 3300049586 | Bacteria | 1551 |
| 675 | Ga0501070_0677498 | 3300049586 | Bacteria | 817 |
| 676 | Ga0501071_0024633 | 3300049587 | Bacteria | 4209 |
| 677 | Ga0501071_0604631 | 3300049587 | Bacteria | 843 |
| 678 | Ga0501072_0031522 | 3300049588 | Bacteria | 4151 |
| 679 | Ga0501072_0420950 | 3300049588 | Bacteria | 1059 |
| 680 | Ga0501073_0009019 | 3300049589 | Bacteria | 7364 |
| 681 | Ga0501073_0020690 | 3300049589 | Bacteria | 4745 |
| 682 | Ga0501073_0035055 | 3300049589 | Bacteria | 3567 |
| 683 | Ga0501073_0059897 | 3300049589 | Bacteria | 2658 |
| 684 | Ga0501073_0060865 | 3300049589 | Bacteria | 2635 |
| 685 | Ga0501073_0064940 | 3300049589 | Bacteria | 2545 |
| 686 | Ga0501074_0005155 | 3300049590 | Bacteria | 9391 |
| 687 | Ga0501074_0008058 | 3300049590 | Bacteria | 7631 |
| 688 | Ga0501074_0025665 | 3300049590 | Bacteria | 4276 |
| 689 | Ga0501074_0033086 | 3300049590 | Bacteria | 3747 |
| 690 | Ga0501076_0350172 | 3300049592 | Bacteria | 1213 |
| 691 | Ga0501225_0000850 | 3300049705 | Bacteria | 9490 |
| 692 | Ga0501080_0008404 | 3300049742 | Bacteria | 9350 |
| 693 | Ga0501080_0010871 | 3300049742 | Bacteria | 8330 |
| 694 | Ga0501080_0012404 | 3300049742 | Bacteria | 7814 |
| 695 | Ga0501080_0033617 | 3300049742 | Bacteria | 4786 |
| 696 | Ga0501080_0048684 | 3300049742 | Bacteria | 3944 |
| 697 | Ga0501080_0076514 | 3300049742 | Bacteria | 3112 |
| 698 | Ga0501080_0076953 | 3300049742 | Bacteria | 3102 |
| 699 | Ga0501080_0103490 | 3300049742 | Bacteria | 2640 |
| 700 | Ga0501083_0005937 | 3300049744 | Bacteria | 8643 |
| 701 | Ga0501083_0014713 | 3300049744 | Bacteria | 5470 |
| 702 | Ga0501083_0023242 | 3300049744 | Bacteria | 4301 |
| 703 | Ga0501083_0046820 | 3300049744 | Bacteria | 2924 |
| 704 | Ga0501083_0391063 | 3300049744 | Bacteria | 904 |
| 705 | Ga0501035_0000967 | 3300049822 | Bacteria | 30354 |
| 706 | Ga0501035_0005003 | 3300049822 | Bacteria | 12557 |
| 707 | Ga0501035_0012944 | 3300049822 | Bacteria | 7700 |
| 708 | Ga0501035_0040699 | 3300049822 | Bacteria | 4198 |
| 709 | Ga0501035_0075613 | 3300049822 | Bacteria | 2979 |
| 710 | Ga0501035_0098427 | 3300049822 | Bacteria | 2568 |
| 711 | Ga0501035_0131818 | 3300049822 | Bacteria | 2178 |
| 712 | Ga0501044_0010926 | 3300049823 | Bacteria | 9854 |
| 713 | Ga0501044_0019704 | 3300049823 | Bacteria | 7209 |
| 714 | Ga0501044_0078886 | 3300049823 | Bacteria | 3337 |
| 715 | Ga0501044_0161471 | 3300049823 | Bacteria | 2217 |
| 716 | Ga0501044_0211561 | 3300049823 | Bacteria | 1893 |
| 717 | Ga0501044_0386404 | 3300049823 | Bacteria | 1314 |
| 718 | nmdc:mga0k408_38374_c1 | 3300050493 | Bacteria | 2749 |
| 719 | nmdc:mga04h51_34720_c1 | 3300050495 | Bacteria | 1613 |
| 720 | nmdc:mga05p37_515375_c1 | 3300050507 | Bacteria | 1369 |
| 721 | nmdc:mga08y16_1076_c1 | 3300050511 | Bacteria | 26887 |
| 722 | nmdc:mga08y16_334440_c1 | 3300050511 | Bacteria | 1557 |
| 723 | nmdc:mga0sz30_281768_c1 | 3300050516 | Bacteria | 741 |
| 724 | Ga0495612_0078046 | 3300053078 | Bacteria | 1388 |
| 725 | Ga0495595_0012714 | 3300053084 | Bacteria | 3545 |
| 726 | Ga0495595_0383060 | 3300053084 | Bacteria | 712 |
| 727 | Ga0495619_0372368 | 3300053085 | Bacteria | 987 |
| 728 | Ga0500578_0209025 | 3300053086 | Bacteria | 1191 |
| 729 | Ga0500578_0423188 | 3300053086 | Bacteria | 763 |
| 730 | Ga0500646_0001896 | 3300053090 | Bacteria | 5476 |
| 731 | Ga0500646_0076553 | 3300053090 | Bacteria | 1013 |
| 732 | Ga0500651_0003060 | 3300053093 | Bacteria | 9046 |
| 733 | Ga0500651_0132163 | 3300053093 | Bacteria | 1509 |
| 734 | Ga0500641_0069236 | 3300053096 | Bacteria | 1482 |
| 735 | Ga0500555_007058 | 3300053103 | Bacteria | 3194 |
| 736 | Ga0500562_074214 | 3300053108 | Bacteria | 919 |
| 737 | Ga0500595_004492 | 3300053119 | Bacteria | 6247 |
| 738 | Ga0500642_0001139 | 3300053130 | Bacteria | 7620 |
| 739 | Ga0500642_0037482 | 3300053130 | Bacteria | 2072 |
| 740 | Ga0500568_0002440 | 3300053139 | Bacteria | 10940 |
| 741 | Ga0500588_0001056 | 3300053146 | Bacteria | 5003 |
| 742 | Ga0500616_0001156 | 3300053153 | Bacteria | 26962 |
| 743 | Ga0500622_0181043 | 3300053156 | Bacteria | 974 |
| 744 | Ga0500633_0103679 | 3300053160 | Bacteria | 1049 |
| 745 | Ga0500609_001594 | 3300053731 | Bacteria | 3309 |
| 746 | Ga0500609_009033 | 3300053731 | Bacteria | 1344 |
| 747 | Ga0501084_0237376 | 3300054114 | Bacteria | 1539 |
| 748 | Ga0501084_0315616 | 3300054114 | Bacteria | 1320 |
| 749 | Ga0501084_0433291 | 3300054114 | Bacteria | 1111 |
| 750 | Ga0501084_0847234 | 3300054114 | Bacteria | 769 |
| 751 | Ga0501082_0023882 | 3300060353 | Bacteria | 5272 |
| 752 | Ga0501082_0042504 | 3300060353 | Bacteria | 3918 |
| 753 | Ga0501082_0390347 | 3300060353 | Bacteria | 1214 |
| 754 | Ga0501082_0941721 | 3300060353 | Bacteria | 755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050516 | nmdc:mga0sz30_281768_c1 | nmdc:mga0sz30_281768_c1_100_723 | 181 |
| 2 | 3300039438 | Ga0436360_0527097 | Ga0436360_0527097_1700_2386 | 188 |
| 3 | 3300039438 | Ga0436360_0495490 | Ga0436360_0495490_810_1472 | 192 |
| 4 | 3300054114 | Ga0501084_0847234 | Ga0501084_0847234_110_736 | 193 |
| 5 | 3300005434 | Ga0070709_10337142 | Ga0070709_103371421 | 198 |
| 6 | 3300005435 | Ga0070714_100027224 | Ga0070714_1000272243 | 198 |
| 7 | 3300006028 | Ga0070717_10058335 | Ga0070717_100583353 | 198 |
| 8 | 3300006173 | Ga0070716_100247244 | Ga0070716_1002472442 | 198 |
| 9 | 3300006175 | Ga0070712_100120344 | Ga0070712_1001203442 | 198 |
| 10 | 3300025906 | Ga0207699_10031276 | Ga0207699_100312763 | 198 |
| 11 | 3300025915 | Ga0207693_10013217 | Ga0207693_100132172 | 198 |
| 12 | 3300025929 | Ga0207664_10237495 | Ga0207664_102374952 | 198 |
| 13 | 3300035172 | Ga0373955_0036950 | Ga0373955_0036950_1976_2578 | 198 |
| 14 | 3300053078 | Ga0495612_0078046 | Ga0495612_0078046_44_646 | 198 |
| 15 | 3300036712 | Ga0316584_0115833 | Ga0316584_0115833_295_960 | 199 |
| 16 | 3300031712 | Ga0265342_10006958 | Ga0265342_100069582 | 200 |
| 17 | 3300046475 | Ga0495639_0394796 | Ga0495639_0394796_12_626 | 202 |
| 18 | 3300025907 | Ga0207645_10234916 | Ga0207645_102349162 | 205 |
| 19 | 3300025927 | Ga0207687_10247901 | Ga0207687_102479012 | 205 |
| 20 | 3300031711 | Ga0265314_10045935 | Ga0265314_100459352 | 205 |
| 21 | 3300039437 | Ga0436365_1605027 | Ga0436365_1605027_381_1073 | 206 |
| 22 | 3300049574 | Ga0501038_0028147 | Ga0501038_0028147_785_1456 | 206 |
| 23 | 3300003762 | Ga0055542_1007844 | Ga0055542_10078442 | 207 |
| 24 | 3300003794 | Ga0055531_10011784 | Ga0055531_100117842 | 207 |
| 25 | 3300005441 | Ga0070700_100264326 | Ga0070700_1002643261 | 207 |
| 26 | 3300005445 | Ga0070708_100004705 | Ga0070708_1000047053 | 207 |
| 27 | 3300005459 | Ga0068867_100048884 | Ga0068867_1000488843 | 207 |
| 28 | 3300005467 | Ga0070706_100000078 | Ga0070706_10000007899 | 207 |
| 29 | 3300005518 | Ga0070699_100019801 | Ga0070699_1000198012 | 207 |
| 30 | 3300005536 | Ga0070697_100009172 | Ga0070697_1000091722 | 207 |
| 31 | 3300005718 | Ga0068866_10067273 | Ga0068866_100672732 | 207 |
| 32 | 3300005844 | Ga0068862_100010966 | Ga0068862_1000109662 | 207 |
| 33 | 3300005844 | Ga0068862_100045989 | Ga0068862_1000459894 | 207 |
| 34 | 3300005981 | Ga0081538_10009218 | Ga0081538_100092186 | 207 |
| 35 | 3300005985 | Ga0081539_10147125 | Ga0081539_101471252 | 207 |
| 36 | 3300006237 | Ga0097621_100374135 | Ga0097621_1003741352 | 207 |
| 37 | 3300006852 | Ga0075433_10117007 | Ga0075433_101170073 | 207 |
| 38 | 3300006881 | Ga0068865_100064415 | Ga0068865_1000644153 | 207 |
| 39 | 3300009094 | Ga0111539_10085414 | Ga0111539_100854143 | 207 |
| 40 | 3300009094 | Ga0111539_10213592 | Ga0111539_102135922 | 207 |
| 41 | 3300009101 | Ga0105247_10549251 | Ga0105247_105492511 | 207 |
| 42 | 3300009147 | Ga0114129_10154214 | Ga0114129_101542143 | 207 |
| 43 | 3300009177 | Ga0105248_11143780 | Ga0105248_111437801 | 207 |
| 44 | 3300010159 | Ga0099796_10084291 | Ga0099796_100842911 | 207 |
| 45 | 3300014326 | Ga0157380_10521437 | Ga0157380_105214371 | 207 |
| 46 | 3300014969 | Ga0157376_10946608 | Ga0157376_109466082 | 207 |
| 47 | 3300025254 | Ga0209148_1000723 | Ga0209148_100072320 | 207 |
| 48 | 3300025272 | Ga0209455_1000401 | Ga0209455_10004012 | 207 |
| 49 | 3300025297 | Ga0209758_1000029 | Ga0209758_10000298 | 207 |
| 50 | 3300025297 | Ga0209758_1020203 | Ga0209758_10202032 | 207 |
| 51 | 3300025298 | Ga0209050_1009108 | Ga0209050_10091084 | 207 |
| 52 | 3300025299 | Ga0209256_1035608 | Ga0209256_10356082 | 207 |
| 53 | 3300025303 | Ga0209051_1030515 | Ga0209051_10305152 | 207 |
| 54 | 3300025304 | Ga0209257_1000549 | Ga0209257_100054963 | 207 |
| 55 | 3300025304 | Ga0209257_1026999 | Ga0209257_10269992 | 207 |
| 56 | 3300025910 | Ga0207684_10000157 | Ga0207684_1000015798 | 207 |
| 57 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001254 | 207 |
| 58 | 3300025921 | Ga0207652_10000879 | Ga0207652_1000087920 | 207 |
| 59 | 3300025922 | Ga0207646_10036689 | Ga0207646_100366892 | 207 |
| 60 | 3300025928 | Ga0207700_10052055 | Ga0207700_100520554 | 207 |
| 61 | 3300025938 | Ga0207704_10106974 | Ga0207704_101069743 | 207 |
| 62 | 3300026075 | Ga0207708_10562110 | Ga0207708_105621102 | 207 |
| 63 | 3300026089 | Ga0207648_10267351 | Ga0207648_102673512 | 207 |
| 64 | 3300026118 | Ga0207675_100065106 | Ga0207675_1000651062 | 207 |
| 65 | 3300027907 | Ga0207428_10001290 | Ga0207428_1000129021 | 207 |
| 66 | 3300028380 | Ga0268265_10009019 | Ga0268265_100090193 | 207 |
| 67 | 3300028380 | Ga0268265_10019872 | Ga0268265_100198724 | 207 |
| 68 | 3300028800 | Ga0265338_10047890 | Ga0265338_100478901 | 207 |
| 69 | 3300031241 | Ga0265325_10047319 | Ga0265325_100473192 | 207 |
| 70 | 3300031249 | Ga0265339_10000008 | Ga0265339_1000000852 | 207 |
| 71 | 3300031249 | Ga0265339_10015834 | Ga0265339_100158343 | 207 |
| 72 | 3300031249 | Ga0265339_10062706 | Ga0265339_100627062 | 207 |
| 73 | 3300031251 | Ga0265327_10059902 | Ga0265327_100599021 | 207 |
| 74 | 3300031251 | Ga0265327_10082102 | Ga0265327_100821022 | 207 |
| 75 | 3300031456 | Ga0307513_10156721 | Ga0307513_101567212 | 207 |
| 76 | 3300031595 | Ga0265313_10057889 | Ga0265313_100578892 | 207 |
| 77 | 3300031616 | Ga0307508_10111953 | Ga0307508_101119532 | 207 |
| 78 | 3300031712 | Ga0265342_10027877 | Ga0265342_100278773 | 207 |
| 79 | 3300031730 | Ga0307516_10096785 | Ga0307516_100967852 | 207 |
| 80 | 3300031824 | Ga0307413_10018790 | Ga0307413_100187902 | 207 |
| 81 | 3300031911 | Ga0307412_10169580 | Ga0307412_101695802 | 207 |
| 82 | 3300032002 | Ga0307416_100275195 | Ga0307416_1002751952 | 207 |
| 83 | 3300032005 | Ga0307411_10111274 | Ga0307411_101112743 | 207 |
| 84 | 3300032126 | Ga0307415_100799185 | Ga0307415_1007991852 | 207 |
| 85 | 3300032137 | Ga0316585_10023767 | Ga0316585_100237672 | 207 |
| 86 | 3300035114 | Ga0373939_0123995 | Ga0373939_0123995_239_901 | 207 |
| 87 | 3300035692 | Ga0373935_0583530 | Ga0373935_0583530_98_769 | 207 |
| 88 | 3300035725 | Ga0373947_0184747 | Ga0373947_0184747_455_1126 | 207 |
| 89 | 3300037068 | Ga0373925_0106863 | Ga0373925_0106863_640_1311 | 207 |
| 90 | 3300039438 | Ga0436360_0120062 | Ga0436360_0120062_42_713 | 207 |
| 91 | 3300042001 | Ga0439441_048167 | Ga0439441_048167_163_837 | 207 |
| 92 | 3300046454 | Ga0495592_0264513 | Ga0495592_0264513_290_961 | 207 |
| 93 | 3300046531 | Ga0495665_0040266 | Ga0495665_0040266_1666_2337 | 207 |
| 94 | 3300047320 | Ga0495672_0075268 | Ga0495672_0075268_142_816 | 207 |
| 95 | 3300047472 | Ga0495686_0215674 | Ga0495686_0215674_34_708 | 207 |
| 96 | 3300049570 | Ga0501033_0002244 | Ga0501033_0002244_518_1192 | 207 |
| 97 | 3300049571 | Ga0501034_0007533 | Ga0501034_0007533_3310_3972 | 207 |
| 98 | 3300049571 | Ga0501034_0037555 | Ga0501034_0037555_494_1168 | 207 |
| 99 | 3300049571 | Ga0501034_0116035 | Ga0501034_0116035_1318_1992 | 207 |
| 100 | 3300049571 | Ga0501034_0616297 | Ga0501034_0616297_165_959 | 207 |
| 101 | 3300049572 | Ga0501036_0014560 | Ga0501036_0014560_2190_2864 | 207 |
| 102 | 3300049573 | Ga0501037_0008717 | Ga0501037_0008717_6531_7205 | 207 |
| 103 | 3300049574 | Ga0501038_0003645 | Ga0501038_0003645_9097_9771 | 207 |
| 104 | 3300049575 | Ga0501039_0008739 | Ga0501039_0008739_3080_3754 | 207 |
| 105 | 3300049579 | Ga0501043_0000689 | Ga0501043_0000689_20126_20800 | 207 |
| 106 | 3300049579 | Ga0501043_0073269 | Ga0501043_0073269_1432_2106 | 207 |
| 107 | 3300049580 | Ga0501046_0001447 | Ga0501046_0001447_3839_4513 | 207 |
| 108 | 3300049581 | Ga0501047_0007684 | Ga0501047_0007684_5370_6203 | 207 |
| 109 | 3300049581 | Ga0501047_0409890 | Ga0501047_0409890_35_709 | 207 |
| 110 | 3300049582 | Ga0501048_0077439 | Ga0501048_0077439_1062_1736 | 207 |
| 111 | 3300049583 | Ga0501067_0007614 | Ga0501067_0007614_1107_1781 | 207 |
| 112 | 3300049583 | Ga0501067_0074445 | Ga0501067_0074445_375_1208 | 207 |
| 113 | 3300049584 | Ga0501068_0123383 | Ga0501068_0123383_684_1358 | 207 |
| 114 | 3300049585 | Ga0501069_0003590 | Ga0501069_0003590_5951_6625 | 207 |
| 115 | 3300049585 | Ga0501069_0186929 | Ga0501069_0186929_63_737 | 207 |
| 116 | 3300049587 | Ga0501071_0604631 | Ga0501071_0604631_76_750 | 207 |
| 117 | 3300049588 | Ga0501072_0031522 | Ga0501072_0031522_3372_4046 | 207 |
| 118 | 3300049588 | Ga0501072_0420950 | Ga0501072_0420950_329_991 | 207 |
| 119 | 3300049589 | Ga0501073_0020690 | Ga0501073_0020690_3971_4645 | 207 |
| 120 | 3300049589 | Ga0501073_0035055 | Ga0501073_0035055_2399_3232 | 207 |
| 121 | 3300049589 | Ga0501073_0059897 | Ga0501073_0059897_565_1239 | 207 |
| 122 | 3300049590 | Ga0501074_0005155 | Ga0501074_0005155_2196_2870 | 207 |
| 123 | 3300049592 | Ga0501076_0350172 | Ga0501076_0350172_277_951 | 207 |
| 124 | 3300049742 | Ga0501080_0048684 | Ga0501080_0048684_1408_2082 | 207 |
| 125 | 3300049742 | Ga0501080_0076514 | Ga0501080_0076514_2074_2907 | 207 |
| 126 | 3300049742 | Ga0501080_0076953 | Ga0501080_0076953_1060_1734 | 207 |
| 127 | 3300049742 | Ga0501080_0103490 | Ga0501080_0103490_274_1074 | 207 |
| 128 | 3300049744 | Ga0501083_0023242 | Ga0501083_0023242_186_1019 | 207 |
| 129 | 3300049744 | Ga0501083_0046820 | Ga0501083_0046820_220_894 | 207 |
| 130 | 3300049744 | Ga0501083_0391063 | Ga0501083_0391063_212_886 | 207 |
| 131 | 3300049822 | Ga0501035_0012944 | Ga0501035_0012944_3059_3733 | 207 |
| 132 | 3300049822 | Ga0501035_0075613 | Ga0501035_0075613_402_1076 | 207 |
| 133 | 3300049822 | Ga0501035_0098427 | Ga0501035_0098427_1419_2174 | 207 |
| 134 | 3300049823 | Ga0501044_0010926 | Ga0501044_0010926_2731_3405 | 207 |
| 135 | 3300049823 | Ga0501044_0078886 | Ga0501044_0078886_1726_2400 | 207 |
| 136 | 3300050511 | nmdc:mga08y16_1076_c1 | nmdc:mga08y16_1076_c1_20195_20869 | 207 |
| 137 | 3300050511 | nmdc:mga08y16_334440_c1 | nmdc:mga08y16_334440_c1_214_888 | 207 |
| 138 | 3300053086 | Ga0500578_0423188 | Ga0500578_0423188_72_746 | 207 |
| 139 | 3300053093 | Ga0500651_0132163 | Ga0500651_0132163_763_1437 | 207 |
| 140 | 3300053096 | Ga0500641_0069236 | Ga0500641_0069236_64_738 | 207 |
| 141 | 3300053103 | Ga0500555_007058 | Ga0500555_007058_391_1083 | 207 |
| 142 | 3300053119 | Ga0500595_004492 | Ga0500595_004492_4727_5401 | 207 |
| 143 | 3300053146 | Ga0500588_0001056 | Ga0500588_0001056_2084_2758 | 207 |
| 144 | 3300053153 | Ga0500616_0001156 | Ga0500616_0001156_2080_2754 | 207 |
| 145 | 3300053156 | Ga0500622_0181043 | Ga0500622_0181043_107_781 | 207 |
| 146 | 3300053731 | Ga0500609_009033 | Ga0500609_009033_40_714 | 207 |
| 147 | 3300054114 | Ga0501084_0237376 | Ga0501084_0237376_101_934 | 207 |
| 148 | 3300054114 | Ga0501084_0315616 | Ga0501084_0315616_546_1220 | 207 |
| 149 | 3300054114 | Ga0501084_0433291 | Ga0501084_0433291_79_753 | 207 |
| 150 | 3300060353 | Ga0501082_0042504 | Ga0501082_0042504_2207_3040 | 207 |
| 151 | 3300060353 | Ga0501082_0390347 | Ga0501082_0390347_181_855 | 207 |
| 152 | 3300060353 | Ga0501082_0941721 | Ga0501082_0941721_50_712 | 207 |
| 153 | 3300006846 | Ga0075430_100361430 | Ga0075430_1003614302 | 208 |
| 154 | 3300006847 | Ga0075431_100209105 | Ga0075431_1002091052 | 208 |
| 155 | 3300030522 | Ga0307512_10244802 | Ga0307512_102448021 | 208 |
| 156 | 3300031901 | Ga0307406_10377367 | Ga0307406_103773672 | 208 |
| 157 | 3300045051 | Ga0451576_0512494 | Ga0451576_0512494_93_755 | 208 |
| 158 | 3300053090 | Ga0500646_0076553 | Ga0500646_0076553_310_987 | 208 |
| 159 | 3300053108 | Ga0500562_074214 | Ga0500562_074214_47_724 | 208 |
| 160 | 3300053130 | Ga0500642_0001139 | Ga0500642_0001139_5577_6254 | 208 |
| 161 | 3300053130 | Ga0500642_0037482 | Ga0500642_0037482_188_865 | 208 |
| 162 | 3300053139 | Ga0500568_0002440 | Ga0500568_0002440_8775_9452 | 208 |
| 163 | 3300053160 | Ga0500633_0103679 | Ga0500633_0103679_261_938 | 208 |
| 164 | 3300053731 | Ga0500609_001594 | Ga0500609_001594_2426_3103 | 208 |
| 165 | 3300001904 | JGI24736J21556_1007878 | JGI24736J21556_10078783 | 209 |
| 166 | 3300001915 | JGI24741J21665_1001461 | JGI24741J21665_10014612 | 209 |
| 167 | 3300001915 | JGI24741J21665_1001635 | JGI24741J21665_10016354 | 209 |
| 168 | 3300001915 | JGI24741J21665_1018071 | JGI24741J21665_10180712 | 209 |
| 169 | 3300001979 | JGI24740J21852_10000218 | JGI24740J21852_1000021823 | 209 |
| 170 | 3300001979 | JGI24740J21852_10000952 | JGI24740J21852_100009522 | 209 |
| 171 | 3300001979 | JGI24740J21852_10042802 | JGI24740J21852_100428021 | 209 |
| 172 | 3300003215 | JGI25153J46596_10001011 | JGI25153J46596_1000101117 | 209 |
| 173 | 3300003771 | Ga0055526_1029522 | Ga0055526_10295221 | 209 |
| 174 | 3300003794 | Ga0055531_10012303 | Ga0055531_100123034 | 209 |
| 175 | 3300004803 | Ga0058862_12839795 | Ga0058862_128397952 | 209 |
| 176 | 3300005327 | Ga0070658_10005847 | Ga0070658_100058479 | 209 |
| 177 | 3300005329 | Ga0070683_100059060 | Ga0070683_1000590602 | 209 |
| 178 | 3300005329 | Ga0070683_100090405 | Ga0070683_1000904053 | 209 |
| 179 | 3300005336 | Ga0070680_100002370 | Ga0070680_10000237010 | 209 |
| 180 | 3300005336 | Ga0070680_100006137 | Ga0070680_1000061378 | 209 |
| 181 | 3300005337 | Ga0070682_100012978 | Ga0070682_1000129783 | 209 |
| 182 | 3300005337 | Ga0070682_100030283 | Ga0070682_1000302831 | 209 |
| 183 | 3300005339 | Ga0070660_100105114 | Ga0070660_1001051142 | 209 |
| 184 | 3300005339 | Ga0070660_100153544 | Ga0070660_1001535442 | 209 |
| 185 | 3300005341 | Ga0070691_10000192 | Ga0070691_1000019211 | 209 |
| 186 | 3300005341 | Ga0070691_10105392 | Ga0070691_101053922 | 209 |
| 187 | 3300005344 | Ga0070661_100008590 | Ga0070661_1000085905 | 209 |
| 188 | 3300005344 | Ga0070661_100062142 | Ga0070661_1000621423 | 209 |
| 189 | 3300005344 | Ga0070661_100062792 | Ga0070661_1000627923 | 209 |
| 190 | 3300005345 | Ga0070692_10000140 | Ga0070692_1000014011 | 209 |
| 191 | 3300005345 | Ga0070692_10075286 | Ga0070692_100752861 | 209 |
| 192 | 3300005347 | Ga0070668_100013534 | Ga0070668_1000135344 | 209 |
| 193 | 3300005355 | Ga0070671_100012619 | Ga0070671_1000126191 | 209 |
| 194 | 3300005367 | Ga0070667_100071236 | Ga0070667_1000712364 | 209 |
| 195 | 3300005436 | Ga0070713_100008932 | Ga0070713_1000089324 | 209 |
| 196 | 3300005436 | Ga0070713_100337264 | Ga0070713_1003372641 | 209 |
| 197 | 3300005436 | Ga0070713_100928042 | Ga0070713_1009280421 | 209 |
| 198 | 3300005437 | Ga0070710_10115171 | Ga0070710_101151712 | 209 |
| 199 | 3300005440 | Ga0070705_100236541 | Ga0070705_1002365412 | 209 |
| 200 | 3300005455 | Ga0070663_100051357 | Ga0070663_1000513572 | 209 |
| 201 | 3300005455 | Ga0070663_100205801 | Ga0070663_1002058011 | 209 |
| 202 | 3300005456 | Ga0070678_100021861 | Ga0070678_1000218612 | 209 |
| 203 | 3300005457 | Ga0070662_100049987 | Ga0070662_1000499873 | 209 |
| 204 | 3300005458 | Ga0070681_10002172 | Ga0070681_1000217213 | 209 |
| 205 | 3300005458 | Ga0070681_10003218 | Ga0070681_100032189 | 209 |
| 206 | 3300005458 | Ga0070681_10026450 | Ga0070681_100264504 | 209 |
| 207 | 3300005458 | Ga0070681_10065692 | Ga0070681_100656922 | 209 |
| 208 | 3300005467 | Ga0070706_100093691 | Ga0070706_1000936913 | 209 |
| 209 | 3300005467 | Ga0070706_100241398 | Ga0070706_1002413982 | 209 |
| 210 | 3300005468 | Ga0070707_100407371 | Ga0070707_1004073712 | 209 |
| 211 | 3300005471 | Ga0070698_100099465 | Ga0070698_1000994654 | 209 |
| 212 | 3300005518 | Ga0070699_100135906 | Ga0070699_1001359062 | 209 |
| 213 | 3300005518 | Ga0070699_100169212 | Ga0070699_1001692122 | 209 |
| 214 | 3300005530 | Ga0070679_100000921 | Ga0070679_10000092116 | 209 |
| 215 | 3300005530 | Ga0070679_100001059 | Ga0070679_10000105914 | 209 |
| 216 | 3300005530 | Ga0070679_100031516 | Ga0070679_1000315163 | 209 |
| 217 | 3300005530 | Ga0070679_100119971 | Ga0070679_1001199711 | 209 |
| 218 | 3300005535 | Ga0070684_100080002 | Ga0070684_1000800024 | 209 |
| 219 | 3300005535 | Ga0070684_100083930 | Ga0070684_1000839304 | 209 |
| 220 | 3300005535 | Ga0070684_100200333 | Ga0070684_1002003332 | 209 |
| 221 | 3300005539 | Ga0068853_100018102 | Ga0068853_1000181024 | 209 |
| 222 | 3300005539 | Ga0068853_100089986 | Ga0068853_1000899862 | 209 |
| 223 | 3300005539 | Ga0068853_100114077 | Ga0068853_1001140772 | 209 |
| 224 | 3300005546 | Ga0070696_100060833 | Ga0070696_1000608334 | 209 |
| 225 | 3300005547 | Ga0070693_100074101 | Ga0070693_1000741012 | 209 |
| 226 | 3300005548 | Ga0070665_100013951 | Ga0070665_1000139513 | 209 |
| 227 | 3300005548 | Ga0070665_100394469 | Ga0070665_1003944692 | 209 |
| 228 | 3300005563 | Ga0068855_100005890 | Ga0068855_1000058904 | 209 |
| 229 | 3300005563 | Ga0068855_100425079 | Ga0068855_1004250791 | 209 |
| 230 | 3300005563 | Ga0068855_100481229 | Ga0068855_1004812292 | 209 |
| 231 | 3300005564 | Ga0070664_100068179 | Ga0070664_1000681791 | 209 |
| 232 | 3300005564 | Ga0070664_100187272 | Ga0070664_1001872722 | 209 |
| 233 | 3300005577 | Ga0068857_100060138 | Ga0068857_1000601382 | 209 |
| 234 | 3300005577 | Ga0068857_100111168 | Ga0068857_1001111682 | 209 |
| 235 | 3300005578 | Ga0068854_100015268 | Ga0068854_1000152682 | 209 |
| 236 | 3300005578 | Ga0068854_100022402 | Ga0068854_1000224024 | 209 |
| 237 | 3300005578 | Ga0068854_100077711 | Ga0068854_1000777112 | 209 |
| 238 | 3300005578 | Ga0068854_100113938 | Ga0068854_1001139382 | 209 |
| 239 | 3300005614 | Ga0068856_100020297 | Ga0068856_1000202975 | 209 |
| 240 | 3300005614 | Ga0068856_100180940 | Ga0068856_1001809402 | 209 |
| 241 | 3300005616 | Ga0068852_100003635 | Ga0068852_1000036359 | 209 |
| 242 | 3300005616 | Ga0068852_100018449 | Ga0068852_1000184491 | 209 |
| 243 | 3300005616 | Ga0068852_100022939 | Ga0068852_1000229396 | 209 |
| 244 | 3300005842 | Ga0068858_100190109 | Ga0068858_1001901092 | 209 |
| 245 | 3300005843 | Ga0068860_100426764 | Ga0068860_1004267641 | 209 |
| 246 | 3300006042 | Ga0075368_10079823 | Ga0075368_100798231 | 209 |
| 247 | 3300006048 | Ga0075363_100005558 | Ga0075363_1000055582 | 209 |
| 248 | 3300006175 | Ga0070712_100116737 | Ga0070712_1001167372 | 209 |
| 249 | 3300006353 | Ga0075370_10009559 | Ga0075370_100095595 | 209 |
| 250 | 3300009093 | Ga0105240_10001510 | Ga0105240_100015106 | 209 |
| 251 | 3300009093 | Ga0105240_10197172 | Ga0105240_101971724 | 209 |
| 252 | 3300009093 | Ga0105240_10580077 | Ga0105240_105800772 | 209 |
| 253 | 3300009093 | Ga0105240_10884576 | Ga0105240_108845762 | 209 |
| 254 | 3300009094 | Ga0111539_10270444 | Ga0111539_102704442 | 209 |
| 255 | 3300009098 | Ga0105245_10043644 | Ga0105245_100436442 | 209 |
| 256 | 3300009098 | Ga0105245_10188069 | Ga0105245_101880692 | 209 |
| 257 | 3300009101 | Ga0105247_10037319 | Ga0105247_100373192 | 209 |
| 258 | 3300009147 | Ga0114129_10259074 | Ga0114129_102590742 | 209 |
| 259 | 3300009148 | Ga0105243_10558462 | Ga0105243_105584621 | 209 |
| 260 | 3300009174 | Ga0105241_10054323 | Ga0105241_100543234 | 209 |
| 261 | 3300009174 | Ga0105241_10155914 | Ga0105241_101559142 | 209 |
| 262 | 3300009176 | Ga0105242_10126845 | Ga0105242_101268452 | 209 |
| 263 | 3300009177 | Ga0105248_10007217 | Ga0105248_1000721714 | 209 |
| 264 | 3300009177 | Ga0105248_11353140 | Ga0105248_113531401 | 209 |
| 265 | 3300009545 | Ga0105237_10001757 | Ga0105237_1000175722 | 209 |
| 266 | 3300009545 | Ga0105237_10798105 | Ga0105237_107981052 | 209 |
| 267 | 3300009551 | Ga0105238_10001945 | Ga0105238_100019457 | 209 |
| 268 | 3300009551 | Ga0105238_10064580 | Ga0105238_100645805 | 209 |
| 269 | 3300010375 | Ga0105239_10048904 | Ga0105239_100489041 | 209 |
| 270 | 3300010375 | Ga0105239_10205533 | Ga0105239_102055332 | 209 |
| 271 | 3300010375 | Ga0105239_10746415 | Ga0105239_107464152 | 209 |
| 272 | 3300011119 | Ga0105246_10003166 | Ga0105246_100031669 | 209 |
| 273 | 3300011119 | Ga0105246_10076483 | Ga0105246_100764832 | 209 |
| 274 | 3300013102 | Ga0157371_10066479 | Ga0157371_100664792 | 209 |
| 275 | 3300013102 | Ga0157371_10081128 | Ga0157371_100811282 | 209 |
| 276 | 3300013102 | Ga0157371_10207666 | Ga0157371_102076662 | 209 |
| 277 | 3300013104 | Ga0157370_10002287 | Ga0157370_1000228711 | 209 |
| 278 | 3300013104 | Ga0157370_10051198 | Ga0157370_100511982 | 209 |
| 279 | 3300013104 | Ga0157370_10172926 | Ga0157370_101729262 | 209 |
| 280 | 3300013105 | Ga0157369_10012731 | Ga0157369_100127316 | 209 |
| 281 | 3300013105 | Ga0157369_10152727 | Ga0157369_101527274 | 209 |
| 282 | 3300013105 | Ga0157369_10285615 | Ga0157369_102856153 | 209 |
| 283 | 3300013105 | Ga0157369_10487804 | Ga0157369_104878042 | 209 |
| 284 | 3300013297 | Ga0157378_10694609 | Ga0157378_106946092 | 209 |
| 285 | 3300013297 | Ga0157378_10889484 | Ga0157378_108894841 | 209 |
| 286 | 3300013306 | Ga0163162_10318699 | Ga0163162_103186993 | 209 |
| 287 | 3300013307 | Ga0157372_10006467 | Ga0157372_100064672 | 209 |
| 288 | 3300013307 | Ga0157372_10016224 | Ga0157372_100162242 | 209 |
| 289 | 3300013307 | Ga0157372_10040855 | Ga0157372_100408551 | 209 |
| 290 | 3300014325 | Ga0163163_10004832 | Ga0163163_100048324 | 209 |
| 291 | 3300014325 | Ga0163163_10041829 | Ga0163163_100418296 | 209 |
| 292 | 3300014745 | Ga0157377_10370863 | Ga0157377_103708632 | 209 |
| 293 | 3300014968 | Ga0157379_10669230 | Ga0157379_106692302 | 209 |
| 294 | 3300020069 | Ga0197907_10554686 | Ga0197907_105546862 | 209 |
| 295 | 3300020070 | Ga0206356_10126730 | Ga0206356_101267302 | 209 |
| 296 | 3300020070 | Ga0206356_11225299 | Ga0206356_112252992 | 209 |
| 297 | 3300020076 | Ga0206355_1250981 | Ga0206355_12509812 | 209 |
| 298 | 3300020077 | Ga0206351_10305709 | Ga0206351_103057093 | 209 |
| 299 | 3300020080 | Ga0206350_10835923 | Ga0206350_108359232 | 209 |
| 300 | 3300020081 | Ga0206354_10204110 | Ga0206354_102041104 | 209 |
| 301 | 3300020081 | Ga0206354_10880630 | Ga0206354_108806302 | 209 |
| 302 | 3300020082 | Ga0206353_10150174 | Ga0206353_101501746 | 209 |
| 303 | 3300020082 | Ga0206353_10254288 | Ga0206353_102542882 | 209 |
| 304 | 3300020610 | Ga0154015_1491307 | Ga0154015_14913072 | 209 |
| 305 | 3300025291 | Ga0209675_1004324 | Ga0209675_10043242 | 209 |
| 306 | 3300025295 | Ga0209564_1016660 | Ga0209564_10166603 | 209 |
| 307 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011723 | 209 |
| 308 | 3300025304 | Ga0209257_1001093 | Ga0209257_100109341 | 209 |
| 309 | 3300025304 | Ga0209257_1011604 | Ga0209257_10116044 | 209 |
| 310 | 3300025315 | Ga0207697_10149171 | Ga0207697_101491711 | 209 |
| 311 | 3300025321 | Ga0207656_10006407 | Ga0207656_100064072 | 209 |
| 312 | 3300025900 | Ga0207710_10084974 | Ga0207710_100849742 | 209 |
| 313 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001624 | 209 |
| 314 | 3300025904 | Ga0207647_10000224 | Ga0207647_1000022425 | 209 |
| 315 | 3300025904 | Ga0207647_10001467 | Ga0207647_100014679 | 209 |
| 316 | 3300025904 | Ga0207647_10002765 | Ga0207647_100027654 | 209 |
| 317 | 3300025904 | Ga0207647_10144961 | Ga0207647_101449613 | 209 |
| 318 | 3300025909 | Ga0207705_10000198 | Ga0207705_1000019813 | 209 |
| 319 | 3300025909 | Ga0207705_10009476 | Ga0207705_100094764 | 209 |
| 320 | 3300025909 | Ga0207705_10027594 | Ga0207705_100275944 | 209 |
| 321 | 3300025910 | Ga0207684_10094538 | Ga0207684_100945383 | 209 |
| 322 | 3300025910 | Ga0207684_10188705 | Ga0207684_101887052 | 209 |
| 323 | 3300025911 | Ga0207654_10167856 | Ga0207654_101678562 | 209 |
| 324 | 3300025912 | Ga0207707_10000020 | Ga0207707_1000002087 | 209 |
| 325 | 3300025912 | Ga0207707_10000319 | Ga0207707_1000031913 | 209 |
| 326 | 3300025912 | Ga0207707_10000512 | Ga0207707_1000051224 | 209 |
| 327 | 3300025912 | Ga0207707_10000792 | Ga0207707_1000079232 | 209 |
| 328 | 3300025912 | Ga0207707_10000976 | Ga0207707_1000097622 | 209 |
| 329 | 3300025912 | Ga0207707_10010022 | Ga0207707_100100224 | 209 |
| 330 | 3300025912 | Ga0207707_10081753 | Ga0207707_100817534 | 209 |
| 331 | 3300025913 | Ga0207695_10000163 | Ga0207695_10000163139 | 209 |
| 332 | 3300025913 | Ga0207695_10003007 | Ga0207695_1000300710 | 209 |
| 333 | 3300025913 | Ga0207695_10077679 | Ga0207695_100776795 | 209 |
| 334 | 3300025913 | Ga0207695_10110662 | Ga0207695_101106623 | 209 |
| 335 | 3300025913 | Ga0207695_10578113 | Ga0207695_105781131 | 209 |
| 336 | 3300025914 | Ga0207671_10001718 | Ga0207671_100017189 | 209 |
| 337 | 3300025917 | Ga0207660_10001995 | Ga0207660_100019955 | 209 |
| 338 | 3300025917 | Ga0207660_10005591 | Ga0207660_100055917 | 209 |
| 339 | 3300025917 | Ga0207660_10006586 | Ga0207660_100065865 | 209 |
| 340 | 3300025917 | Ga0207660_10011098 | Ga0207660_100110984 | 209 |
| 341 | 3300025917 | Ga0207660_10042529 | Ga0207660_100425292 | 209 |
| 342 | 3300025917 | Ga0207660_10046282 | Ga0207660_100462822 | 209 |
| 343 | 3300025919 | Ga0207657_10014555 | Ga0207657_100145554 | 209 |
| 344 | 3300025919 | Ga0207657_10016071 | Ga0207657_100160714 | 209 |
| 345 | 3300025919 | Ga0207657_10058709 | Ga0207657_100587094 | 209 |
| 346 | 3300025919 | Ga0207657_10068787 | Ga0207657_100687874 | 209 |
| 347 | 3300025919 | Ga0207657_10196848 | Ga0207657_101968482 | 209 |
| 348 | 3300025920 | Ga0207649_10002249 | Ga0207649_1000224911 | 209 |
| 349 | 3300025920 | Ga0207649_10008623 | Ga0207649_100086237 | 209 |
| 350 | 3300025920 | Ga0207649_10028900 | Ga0207649_100289004 | 209 |
| 351 | 3300025920 | Ga0207649_10059101 | Ga0207649_100591013 | 209 |
| 352 | 3300025920 | Ga0207649_10085744 | Ga0207649_100857442 | 209 |
| 353 | 3300025921 | Ga0207652_10000037 | Ga0207652_1000003738 | 209 |
| 354 | 3300025921 | Ga0207652_10000490 | Ga0207652_1000049014 | 209 |
| 355 | 3300025921 | Ga0207652_10000548 | Ga0207652_1000054812 | 209 |
| 356 | 3300025921 | Ga0207652_10011649 | Ga0207652_100116494 | 209 |
| 357 | 3300025921 | Ga0207652_10016592 | Ga0207652_100165923 | 209 |
| 358 | 3300025921 | Ga0207652_10064934 | Ga0207652_100649345 | 209 |
| 359 | 3300025928 | Ga0207700_10335155 | Ga0207700_103351552 | 209 |
| 360 | 3300025932 | Ga0207690_10017142 | Ga0207690_100171422 | 209 |
| 361 | 3300025932 | Ga0207690_10040891 | Ga0207690_100408912 | 209 |
| 362 | 3300025932 | Ga0207690_10112866 | Ga0207690_101128662 | 209 |
| 363 | 3300025933 | Ga0207706_10064955 | Ga0207706_100649551 | 209 |
| 364 | 3300025935 | Ga0207709_10403152 | Ga0207709_104031522 | 209 |
| 365 | 3300025941 | Ga0207711_10525427 | Ga0207711_105254272 | 209 |
| 366 | 3300025944 | Ga0207661_10045493 | Ga0207661_100454934 | 209 |
| 367 | 3300025944 | Ga0207661_10052825 | Ga0207661_100528251 | 209 |
| 368 | 3300025945 | Ga0207679_10127387 | Ga0207679_101273872 | 209 |
| 369 | 3300025949 | Ga0207667_10003741 | Ga0207667_1000374120 | 209 |
| 370 | 3300025949 | Ga0207667_10004107 | Ga0207667_100041074 | 209 |
| 371 | 3300025949 | Ga0207667_10004852 | Ga0207667_1000485216 | 209 |
| 372 | 3300025949 | Ga0207667_10006666 | Ga0207667_100066663 | 209 |
| 373 | 3300025949 | Ga0207667_10013127 | Ga0207667_100131276 | 209 |
| 374 | 3300025949 | Ga0207667_10663099 | Ga0207667_106630992 | 209 |
| 375 | 3300025972 | Ga0207668_10041421 | Ga0207668_100414211 | 209 |
| 376 | 3300025981 | Ga0207640_10001250 | Ga0207640_1000125010 | 209 |
| 377 | 3300025981 | Ga0207640_10028897 | Ga0207640_100288974 | 209 |
| 378 | 3300025981 | Ga0207640_10072442 | Ga0207640_100724424 | 209 |
| 379 | 3300025981 | Ga0207640_10075251 | Ga0207640_100752512 | 209 |
| 380 | 3300025981 | Ga0207640_10107066 | Ga0207640_101070661 | 209 |
| 381 | 3300025986 | Ga0207658_10125426 | Ga0207658_101254262 | 209 |
| 382 | 3300026035 | Ga0207703_10283482 | Ga0207703_102834822 | 209 |
| 383 | 3300026041 | Ga0207639_10000562 | Ga0207639_1000056213 | 209 |
| 384 | 3300026041 | Ga0207639_10018506 | Ga0207639_100185066 | 209 |
| 385 | 3300026041 | Ga0207639_10031301 | Ga0207639_100313012 | 209 |
| 386 | 3300026041 | Ga0207639_10766995 | Ga0207639_107669952 | 209 |
| 387 | 3300026067 | Ga0207678_10011828 | Ga0207678_100118284 | 209 |
| 388 | 3300026067 | Ga0207678_10022764 | Ga0207678_100227642 | 209 |
| 389 | 3300026067 | Ga0207678_10036855 | Ga0207678_100368554 | 209 |
| 390 | 3300026067 | Ga0207678_10054937 | Ga0207678_100549374 | 209 |
| 391 | 3300026067 | Ga0207678_10125519 | Ga0207678_101255192 | 209 |
| 392 | 3300026078 | Ga0207702_10005433 | Ga0207702_100054337 | 209 |
| 393 | 3300026078 | Ga0207702_10016316 | Ga0207702_100163165 | 209 |
| 394 | 3300026078 | Ga0207702_10613363 | Ga0207702_106133631 | 209 |
| 395 | 3300026116 | Ga0207674_10018087 | Ga0207674_100180874 | 209 |
| 396 | 3300026116 | Ga0207674_10018959 | Ga0207674_100189594 | 209 |
| 397 | 3300026116 | Ga0207674_10038080 | Ga0207674_100380804 | 209 |
| 398 | 3300026116 | Ga0207674_10040967 | Ga0207674_100409676 | 209 |
| 399 | 3300026116 | Ga0207674_10237670 | Ga0207674_102376702 | 209 |
| 400 | 3300026121 | Ga0207683_10027978 | Ga0207683_100279783 | 209 |
| 401 | 3300026121 | Ga0207683_10096611 | Ga0207683_100966112 | 209 |
| 402 | 3300026142 | Ga0207698_10000506 | Ga0207698_100005062 | 209 |
| 403 | 3300026142 | Ga0207698_10002967 | Ga0207698_1000296710 | 209 |
| 404 | 3300026142 | Ga0207698_10010590 | Ga0207698_100105904 | 209 |
| 405 | 3300026142 | Ga0207698_10345253 | Ga0207698_103452532 | 209 |
| 406 | 3300028379 | Ga0268266_10683160 | Ga0268266_106831601 | 209 |
| 407 | 3300028381 | Ga0268264_10376019 | Ga0268264_103760192 | 209 |
| 408 | 3300031235 | Ga0265330_10008931 | Ga0265330_100089313 | 209 |
| 409 | 3300031240 | Ga0265320_10053712 | Ga0265320_100537122 | 209 |
| 410 | 3300031242 | Ga0265329_10001600 | Ga0265329_100016002 | 209 |
| 411 | 3300031249 | Ga0265339_10005817 | Ga0265339_100058174 | 209 |
| 412 | 3300031344 | Ga0265316_10000203 | Ga0265316_1000020331 | 209 |
| 413 | 3300031548 | Ga0307408_100609602 | Ga0307408_1006096022 | 209 |
| 414 | 3300031711 | Ga0265314_10029023 | Ga0265314_100290234 | 209 |
| 415 | 3300031712 | Ga0265342_10000221 | Ga0265342_1000022135 | 209 |
| 416 | 3300032126 | Ga0307415_101157536 | Ga0307415_1011575361 | 209 |
| 417 | 3300033180 | Ga0307510_10000164 | Ga0307510_1000016439 | 209 |
| 418 | 3300033180 | Ga0307510_10046569 | Ga0307510_100465695 | 209 |
| 419 | 3300035117 | Ga0373953_0236075 | Ga0373953_0236075_81_752 | 209 |
| 420 | 3300035119 | Ga0373956_0117423 | Ga0373956_0117423_557_1228 | 209 |
| 421 | 3300035120 | Ga0373957_0120440 | Ga0373957_0120440_324_995 | 209 |
| 422 | 3300035170 | Ga0373943_0034559 | Ga0373943_0034559_342_1013 | 209 |
| 423 | 3300035172 | Ga0373955_0125170 | Ga0373955_0125170_109_786 | 209 |
| 424 | 3300035691 | Ga0373931_0449046 | Ga0373931_0449046_22_699 | 209 |
| 425 | 3300035695 | Ga0373927_0069172 | Ga0373927_0069172_641_1312 | 209 |
| 426 | 3300035725 | Ga0373947_0204717 | Ga0373947_0204717_150_821 | 209 |
| 427 | 3300036401 | Ga0373937_0013933 | Ga0373937_0013933_949_1620 | 209 |
| 428 | 3300036712 | Ga0316584_0321335 | Ga0316584_0321335_346_1014 | 209 |
| 429 | 3300037068 | Ga0373925_0025732 | Ga0373925_0025732_1937_2608 | 209 |
| 430 | 3300037068 | Ga0373925_0415187 | Ga0373925_0415187_77_754 | 209 |
| 431 | 3300037312 | Ga0395899_0015110 | Ga0395899_0015110_145_819 | 209 |
| 432 | 3300037312 | Ga0395899_0126232 | Ga0395899_0126232_700_1368 | 209 |
| 433 | 3300037418 | Ga0395900_0094482 | Ga0395900_0094482_1260_1934 | 209 |
| 434 | 3300037418 | Ga0395900_0558630 | Ga0395900_0558630_241_909 | 209 |
| 435 | 3300037466 | Ga0395898_0134465 | Ga0395898_0134465_434_1108 | 209 |
| 436 | 3300037466 | Ga0395898_0207152 | Ga0395898_0207152_1074_1742 | 209 |
| 437 | 3300038443 | Ga0395901_0022931 | Ga0395901_0022931_2799_3467 | 209 |
| 438 | 3300039438 | Ga0436360_1053742 | Ga0436360_1053742_215_883 | 209 |
| 439 | 3300039447 | Ga0436361_0282143 | Ga0436361_0282143_608_1285 | 209 |
| 440 | 3300042439 | Ga0439464_0078814 | Ga0439464_0078814_82_756 | 209 |
| 441 | 3300045051 | Ga0451576_0205524 | Ga0451576_0205524_1130_1771 | 209 |
| 442 | 3300045976 | Ga0466967_1008736 | Ga0466967_1008736_108_770 | 209 |
| 443 | 3300046471 | Ga0495650_0000345 | Ga0495650_0000345_42436_43104 | 209 |
| 444 | 3300046477 | Ga0495664_0203653 | Ga0495664_0203653_110_781 | 209 |
| 445 | 3300046507 | Ga0495606_0312053 | Ga0495606_0312053_163_831 | 209 |
| 446 | 3300046511 | Ga0495608_0199974 | Ga0495608_0199974_355_1092 | 209 |
| 447 | 3300046513 | Ga0495616_0022804 | Ga0495616_0022804_527_1264 | 209 |
| 448 | 3300046516 | Ga0495628_0213846 | Ga0495628_0213846_768_1439 | 209 |
| 449 | 3300046519 | Ga0495632_0047640 | Ga0495632_0047640_957_1694 | 209 |
| 450 | 3300046522 | Ga0495643_0016911 | Ga0495643_0016911_280_1017 | 209 |
| 451 | 3300046529 | Ga0495652_0082658 | Ga0495652_0082658_886_1557 | 209 |
| 452 | 3300046533 | Ga0495640_0086184 | Ga0495640_0086184_322_1059 | 209 |
| 453 | 3300046533 | Ga0495640_0184823 | Ga0495640_0184823_179_850 | 209 |
| 454 | 3300046543 | Ga0495645_0310906 | Ga0495645_0310906_121_792 | 209 |
| 455 | 3300046559 | Ga0495667_0077662 | Ga0495667_0077662_81_752 | 209 |
| 456 | 3300046660 | Ga0495625_0013865 | Ga0495625_0013865_937_1605 | 209 |
| 457 | 3300046663 | Ga0495635_0021684 | Ga0495635_0021684_3664_4401 | 209 |
| 458 | 3300046675 | Ga0495657_0010621 | Ga0495657_0010621_3305_4042 | 209 |
| 459 | 3300046680 | Ga0495646_0149837 | Ga0495646_0149837_229_966 | 209 |
| 460 | 3300046689 | Ga0495613_0016833 | Ga0495613_0016833_689_1426 | 209 |
| 461 | 3300046694 | Ga0495649_0071044 | Ga0495649_0071044_289_1026 | 209 |
| 462 | 3300046809 | Ga0495600_0047099 | Ga0495600_0047099_2024_2761 | 209 |
| 463 | 3300046810 | Ga0495660_0062291 | Ga0495660_0062291_667_1404 | 209 |
| 464 | 3300047319 | Ga0495674_0329783 | Ga0495674_0329783_489_1166 | 209 |
| 465 | 3300047321 | Ga0495676_0167043 | Ga0495676_0167043_442_1179 | 209 |
| 466 | 3300047322 | Ga0495680_0210505 | Ga0495680_0210505_696_1367 | 209 |
| 467 | 3300047323 | Ga0495683_0029465 | Ga0495683_0029465_995_1732 | 209 |
| 468 | 3300047443 | Ga0495687_010327 | Ga0495687_010327_3578_4315 | 209 |
| 469 | 3300047469 | Ga0495673_0084838 | Ga0495673_0084838_14_751 | 209 |
| 470 | 3300047471 | Ga0495684_0149015 | Ga0495684_0149015_1029_1700 | 209 |
| 471 | 3300047471 | Ga0495684_0227616 | Ga0495684_0227616_506_1183 | 209 |
| 472 | 3300048088 | Ga0495602_0097429 | Ga0495602_0097429_142_813 | 209 |
| 473 | 3300048903 | Ga0496100_0057306 | Ga0496100_0057306_1087_1824 | 209 |
| 474 | 3300048904 | Ga0496101_0176843 | Ga0496101_0176843_120_857 | 209 |
| 475 | 3300048905 | Ga0496102_0192024 | Ga0496102_0192024_481_1218 | 209 |
| 476 | 3300048905 | Ga0496102_0762140 | Ga0496102_0762140_17_691 | 209 |
| 477 | 3300048906 | Ga0496103_0010626 | Ga0496103_0010626_366_1103 | 209 |
| 478 | 3300048906 | Ga0496103_0322149 | Ga0496103_0322149_17_691 | 209 |
| 479 | 3300048907 | Ga0496104_0007046 | Ga0496104_0007046_3852_4589 | 209 |
| 480 | 3300048907 | Ga0496104_0065930 | Ga0496104_0065930_2499_3236 | 209 |
| 481 | 3300048908 | Ga0496105_0036422 | Ga0496105_0036422_2289_3026 | 209 |
| 482 | 3300048909 | Ga0496106_0120985 | Ga0496106_0120985_263_937 | 209 |
| 483 | 3300048910 | Ga0496107_0033786 | Ga0496107_0033786_669_1343 | 209 |
| 484 | 3300048911 | Ga0496108_0016114 | Ga0496108_0016114_4763_5500 | 209 |
| 485 | 3300048911 | Ga0496108_0144852 | Ga0496108_0144852_22_696 | 209 |
| 486 | 3300048913 | Ga0496110_0351660 | Ga0496110_0351660_292_1029 | 209 |
| 487 | 3300048915 | Ga0496112_0002373 | Ga0496112_0002373_3973_4710 | 209 |
| 488 | 3300048916 | Ga0496113_0020912 | Ga0496113_0020912_2196_2933 | 209 |
| 489 | 3300048916 | Ga0496113_0199527 | Ga0496113_0199527_206_943 | 209 |
| 490 | 3300048916 | Ga0496113_0367327 | Ga0496113_0367327_188_862 | 209 |
| 491 | 3300048917 | Ga0496114_0386199 | Ga0496114_0386199_463_1200 | 209 |
| 492 | 3300048918 | Ga0496115_0129572 | Ga0496115_0129572_565_1302 | 209 |
| 493 | 3300048921 | Ga0496118_0012072 | Ga0496118_0012072_4843_5580 | 209 |
| 494 | 3300048921 | Ga0496118_0197443 | Ga0496118_0197443_395_1063 | 209 |
| 495 | 3300048922 | Ga0496119_0026724 | Ga0496119_0026724_950_1621 | 209 |
| 496 | 3300048922 | Ga0496119_0039745 | Ga0496119_0039745_206_943 | 209 |
| 497 | 3300048923 | Ga0496120_0000916 | Ga0496120_0000916_28184_28855 | 209 |
| 498 | 3300048924 | Ga0496121_0072782 | Ga0496121_0072782_811_1548 | 209 |
| 499 | 3300048925 | Ga0496122_0137941 | Ga0496122_0137941_445_1182 | 209 |
| 500 | 3300048927 | Ga0496124_0019770 | Ga0496124_0019770_346_1083 | 209 |
| 501 | 3300048928 | Ga0496125_0014710 | Ga0496125_0014710_5583_6251 | 209 |
| 502 | 3300048928 | Ga0496125_0033784 | Ga0496125_0033784_3496_4233 | 209 |
| 503 | 3300048929 | Ga0496126_0016188 | Ga0496126_0016188_5439_6110 | 209 |
| 504 | 3300048929 | Ga0496126_0016541 | Ga0496126_0016541_2695_3363 | 209 |
| 505 | 3300048929 | Ga0496126_0172050 | Ga0496126_0172050_295_1032 | 209 |
| 506 | 3300049573 | Ga0501037_0022763 | Ga0501037_0022763_3516_4184 | 209 |
| 507 | 3300049581 | Ga0501047_0010031 | Ga0501047_0010031_5672_6478 | 209 |
| 508 | 3300049581 | Ga0501047_0018738 | Ga0501047_0018738_4149_4817 | 209 |
| 509 | 3300049583 | Ga0501067_0071905 | Ga0501067_0071905_788_1462 | 209 |
| 510 | 3300049583 | Ga0501067_0183855 | Ga0501067_0183855_50_718 | 209 |
| 511 | 3300049585 | Ga0501069_0006085 | Ga0501069_0006085_5192_5860 | 209 |
| 512 | 3300049585 | Ga0501069_0093871 | Ga0501069_0093871_984_1649 | 209 |
| 513 | 3300049585 | Ga0501069_0164499 | Ga0501069_0164499_137_805 | 209 |
| 514 | 3300049586 | Ga0501070_0000303 | Ga0501070_0000303_43577_44242 | 209 |
| 515 | 3300049586 | Ga0501070_0003662 | Ga0501070_0003662_11060_11728 | 209 |
| 516 | 3300049586 | Ga0501070_0016136 | Ga0501070_0016136_3778_4446 | 209 |
| 517 | 3300049586 | Ga0501070_0025376 | Ga0501070_0025376_570_1238 | 209 |
| 518 | 3300049586 | Ga0501070_0038282 | Ga0501070_0038282_2397_3065 | 209 |
| 519 | 3300049586 | Ga0501070_0166202 | Ga0501070_0166202_40_708 | 209 |
| 520 | 3300049586 | Ga0501070_0221578 | Ga0501070_0221578_238_906 | 209 |
| 521 | 3300049587 | Ga0501071_0024633 | Ga0501071_0024633_2228_2896 | 209 |
| 522 | 3300049589 | Ga0501073_0009019 | Ga0501073_0009019_4760_5428 | 209 |
| 523 | 3300049589 | Ga0501073_0060865 | Ga0501073_0060865_1548_2216 | 209 |
| 524 | 3300049589 | Ga0501073_0064940 | Ga0501073_0064940_1625_2293 | 209 |
| 525 | 3300049590 | Ga0501074_0008058 | Ga0501074_0008058_5296_5964 | 209 |
| 526 | 3300049590 | Ga0501074_0025665 | Ga0501074_0025665_156_824 | 209 |
| 527 | 3300049590 | Ga0501074_0033086 | Ga0501074_0033086_948_1616 | 209 |
| 528 | 3300049742 | Ga0501080_0008404 | Ga0501080_0008404_6158_6826 | 209 |
| 529 | 3300049742 | Ga0501080_0010871 | Ga0501080_0010871_6100_6768 | 209 |
| 530 | 3300049742 | Ga0501080_0033617 | Ga0501080_0033617_2423_3091 | 209 |
| 531 | 3300049744 | Ga0501083_0005937 | Ga0501083_0005937_3331_4011 | 209 |
| 532 | 3300049744 | Ga0501083_0014713 | Ga0501083_0014713_429_1097 | 209 |
| 533 | 3300049822 | Ga0501035_0000967 | Ga0501035_0000967_24992_25660 | 209 |
| 534 | 3300049822 | Ga0501035_0005003 | Ga0501035_0005003_9366_10034 | 209 |
| 535 | 3300049822 | Ga0501035_0040699 | Ga0501035_0040699_1183_1851 | 209 |
| 536 | 3300049822 | Ga0501035_0131818 | Ga0501035_0131818_1486_2154 | 209 |
| 537 | 3300049823 | Ga0501044_0019704 | Ga0501044_0019704_3955_4623 | 209 |
| 538 | 3300049823 | Ga0501044_0161471 | Ga0501044_0161471_823_1491 | 209 |
| 539 | 3300049823 | Ga0501044_0211561 | Ga0501044_0211561_814_1482 | 209 |
| 540 | 3300049823 | Ga0501044_0386404 | Ga0501044_0386404_493_1173 | 209 |
| 541 | 3300050493 | nmdc:mga0k408_38374_c1 | nmdc:mga0k408_38374_c1_1480_2217 | 209 |
| 542 | 3300050495 | nmdc:mga04h51_34720_c1 | nmdc:mga04h51_34720_c1_819_1556 | 209 |
| 543 | 3300050507 | nmdc:mga05p37_515375_c1 | nmdc:mga05p37_515375_c1_587_1261 | 209 |
| 544 | 3300053084 | Ga0495595_0383060 | Ga0495595_0383060_14_685 | 209 |
| 545 | 3300053085 | Ga0495619_0372368 | Ga0495619_0372368_98_769 | 209 |
| 546 | 3300053086 | Ga0500578_0209025 | Ga0500578_0209025_345_1082 | 209 |
| 547 | 3300053090 | Ga0500646_0001896 | Ga0500646_0001896_2312_2980 | 209 |
| 548 | 3300060353 | Ga0501082_0023882 | Ga0501082_0023882_1135_1803 | 209 |
| 549 | iso_pu_bacteria | 2517093001 | 2517104755 | 209 |
| 550 | iso_pu_bacteria | 2842775625 | 2842780271 | 209 |
| 551 | iso_pu_bacteria | 2883577096 | 2883579057 | 209 |
| 552 | 3300003214 | JGI25165J46597_1003063 | JGI25165J46597_10030634 | 210 |
| 553 | 3300005336 | Ga0070680_100117031 | Ga0070680_1001170311 | 210 |
| 554 | 3300005436 | Ga0070713_100986314 | Ga0070713_1009863141 | 210 |
| 555 | 3300005437 | Ga0070710_10045605 | Ga0070710_100456052 | 210 |
| 556 | 3300005937 | Ga0081455_10153294 | Ga0081455_101532943 | 210 |
| 557 | 3300005937 | Ga0081455_10168830 | Ga0081455_101688302 | 210 |
| 558 | 3300006028 | Ga0070717_10227032 | Ga0070717_102270322 | 210 |
| 559 | 3300013105 | Ga0157369_10478004 | Ga0157369_104780042 | 210 |
| 560 | 3300021441 | Ga0213871_10042191 | Ga0213871_100421912 | 210 |
| 561 | 3300025231 | Ga0207427_104998 | Ga0207427_1049981 | 210 |
| 562 | 3300025261 | Ga0209233_1000411 | Ga0209233_100041116 | 210 |
| 563 | 3300031507 | Ga0307509_10218896 | Ga0307509_102188962 | 210 |
| 564 | 3300035083 | Ga0373926_0043068 | Ga0373926_0043068_624_1304 | 210 |
| 565 | 3300035086 | Ga0373934_0012539 | Ga0373934_0012539_2377_3093 | 210 |
| 566 | 3300035086 | Ga0373934_0077165 | Ga0373934_0077165_405_1085 | 210 |
| 567 | 3300035113 | Ga0373936_0042290 | Ga0373936_0042290_1020_1736 | 210 |
| 568 | 3300035117 | Ga0373953_0043558 | Ga0373953_0043558_828_1544 | 210 |
| 569 | 3300035118 | Ga0373954_0050713 | Ga0373954_0050713_530_1246 | 210 |
| 570 | 3300035170 | Ga0373943_0092378 | Ga0373943_0092378_349_1029 | 210 |
| 571 | 3300035170 | Ga0373943_0100701 | Ga0373943_0100701_89_805 | 210 |
| 572 | 3300035171 | Ga0373946_0021523 | Ga0373946_0021523_1134_1850 | 210 |
| 573 | 3300035171 | Ga0373946_0226058 | Ga0373946_0226058_179_859 | 210 |
| 574 | 3300035410 | Ga0373924_0007147 | Ga0373924_0007147_1290_2006 | 210 |
| 575 | 3300035692 | Ga0373935_0038791 | Ga0373935_0038791_618_1298 | 210 |
| 576 | 3300035692 | Ga0373935_0063540 | Ga0373935_0063540_793_1509 | 210 |
| 577 | 3300035692 | Ga0373935_0106066 | Ga0373935_0106066_588_1268 | 210 |
| 578 | 3300035695 | Ga0373927_0072265 | Ga0373927_0072265_1411_2091 | 210 |
| 579 | 3300035724 | Ga0373933_0001978 | Ga0373933_0001978_6030_6746 | 210 |
| 580 | 3300035724 | Ga0373933_0069550 | Ga0373933_0069550_921_1601 | 210 |
| 581 | 3300035725 | Ga0373947_0021275 | Ga0373947_0021275_2282_2962 | 210 |
| 582 | 3300036401 | Ga0373937_0050840 | Ga0373937_0050840_1608_2288 | 210 |
| 583 | 3300036401 | Ga0373937_0448340 | Ga0373937_0448340_221_901 | 210 |
| 584 | 3300037068 | Ga0373925_0005605 | Ga0373925_0005605_1080_1760 | 210 |
| 585 | 3300037068 | Ga0373925_0512330 | Ga0373925_0512330_90_770 | 210 |
| 586 | 3300037068 | Ga0373925_0910391 | Ga0373925_0910391_38_706 | 210 |
| 587 | 3300037853 | Ga0436364_0242530 | Ga0436364_0242530_552_1232 | 210 |
| 588 | 3300037853 | Ga0436364_1298093 | Ga0436364_1298093_2821_3510 | 210 |
| 589 | 3300039437 | Ga0436365_1252050 | Ga0436365_1252050_569_1249 | 210 |
| 590 | 3300039438 | Ga0436360_0471757 | Ga0436360_0471757_184_864 | 210 |
| 591 | 3300042876 | Ga0451577_0001586 | Ga0451577_0001586_7736_8416 | 210 |
| 592 | 3300044673 | Ga0453683_0207064 | Ga0453683_0207064_400_1080 | 210 |
| 593 | 3300044712 | Ga0453684_0000374 | Ga0453684_0000374_123406_124086 | 210 |
| 594 | 3300044712 | Ga0453684_0086229 | Ga0453684_0086229_1683_2363 | 210 |
| 595 | 3300045051 | Ga0451576_0001603 | Ga0451576_0001603_32988_33668 | 210 |
| 596 | 3300045051 | Ga0451576_0029780 | Ga0451576_0029780_1479_2159 | 210 |
| 597 | 3300046455 | Ga0495603_0385842 | Ga0495603_0385842_98_778 | 210 |
| 598 | 3300046459 | Ga0495629_0181557 | Ga0495629_0181557_271_951 | 210 |
| 599 | 3300046462 | Ga0495651_0025267 | Ga0495651_0025267_2140_2856 | 210 |
| 600 | 3300046463 | Ga0495653_0123957 | Ga0495653_0123957_826_1542 | 210 |
| 601 | 3300046477 | Ga0495664_0010209 | Ga0495664_0010209_2492_3208 | 210 |
| 602 | 3300046511 | Ga0495608_0025784 | Ga0495608_0025784_1531_2247 | 210 |
| 603 | 3300046514 | Ga0495618_0127207 | Ga0495618_0127207_87_803 | 210 |
| 604 | 3300046529 | Ga0495652_0051987 | Ga0495652_0051987_875_1591 | 210 |
| 605 | 3300046536 | Ga0495587_0007000 | Ga0495587_0007000_3892_4608 | 210 |
| 606 | 3300046543 | Ga0495645_0006870 | Ga0495645_0006870_4836_5552 | 210 |
| 607 | 3300046559 | Ga0495667_0097084 | Ga0495667_0097084_55_771 | 210 |
| 608 | 3300046663 | Ga0495635_0126640 | Ga0495635_0126640_284_964 | 210 |
| 609 | 3300046675 | Ga0495657_0015043 | Ga0495657_0015043_2586_3302 | 210 |
| 610 | 3300046678 | Ga0495599_0006872 | Ga0495599_0006872_5936_6652 | 210 |
| 611 | 3300046679 | Ga0495623_0018805 | Ga0495623_0018805_3111_3827 | 210 |
| 612 | 3300046680 | Ga0495646_0016845 | Ga0495646_0016845_671_1387 | 210 |
| 613 | 3300046809 | Ga0495600_0065746 | Ga0495600_0065746_362_1078 | 210 |
| 614 | 3300047317 | Ga0495604_0096772 | Ga0495604_0096772_639_1355 | 210 |
| 615 | 3300047319 | Ga0495674_0013405 | Ga0495674_0013405_5987_6703 | 210 |
| 616 | 3300047319 | Ga0495674_0462697 | Ga0495674_0462697_155_835 | 210 |
| 617 | 3300047322 | Ga0495680_0021973 | Ga0495680_0021973_740_1456 | 210 |
| 618 | 3300047444 | Ga0495675_0049058 | Ga0495675_0049058_406_1122 | 210 |
| 619 | 3300047471 | Ga0495684_0121074 | Ga0495684_0121074_946_1626 | 210 |
| 620 | 3300047471 | Ga0495684_0207408 | Ga0495684_0207408_78_794 | 210 |
| 621 | 3300048088 | Ga0495602_0028107 | Ga0495602_0028107_3585_4301 | 210 |
| 622 | 3300049586 | Ga0501070_0000863 | Ga0501070_0000863_3719_4393 | 210 |
| 623 | 3300053084 | Ga0495595_0012714 | Ga0495595_0012714_90_806 | 210 |
| 624 | 3300053093 | Ga0500651_0003060 | Ga0500651_0003060_264_938 | 210 |
| 625 | 3300002774 | JGI25150J39212_1000032 | JGI25150J39212_100003258 | 211 |
| 626 | 3300003187 | JGI25151J46595_10000010 | JGI25151J46595_10000010230 | 211 |
| 627 | 3300003215 | JGI25153J46596_10000013 | JGI25153J46596_10000013230 | 211 |
| 628 | 3300005331 | Ga0070670_100961896 | Ga0070670_1009618961 | 211 |
| 629 | 3300005333 | Ga0070677_10009295 | Ga0070677_100092954 | 211 |
| 630 | 3300005337 | Ga0070682_100132106 | Ga0070682_1001321062 | 211 |
| 631 | 3300005340 | Ga0070689_100228815 | Ga0070689_1002288152 | 211 |
| 632 | 3300005353 | Ga0070669_100041926 | Ga0070669_1000419263 | 211 |
| 633 | 3300005354 | Ga0070675_100111468 | Ga0070675_1001114681 | 211 |
| 634 | 3300005356 | Ga0070674_100036125 | Ga0070674_1000361254 | 211 |
| 635 | 3300005356 | Ga0070674_100076735 | Ga0070674_1000767352 | 211 |
| 636 | 3300005356 | Ga0070674_100222311 | Ga0070674_1002223112 | 211 |
| 637 | 3300005364 | Ga0070673_100134200 | Ga0070673_1001342002 | 211 |
| 638 | 3300005364 | Ga0070673_100343246 | Ga0070673_1003432462 | 211 |
| 639 | 3300005367 | Ga0070667_100685241 | Ga0070667_1006852412 | 211 |
| 640 | 3300005438 | Ga0070701_10164164 | Ga0070701_101641642 | 211 |
| 641 | 3300005456 | Ga0070678_100022127 | Ga0070678_1000221274 | 211 |
| 642 | 3300005456 | Ga0070678_100060385 | Ga0070678_1000603853 | 211 |
| 643 | 3300005543 | Ga0070672_100025661 | Ga0070672_1000256612 | 211 |
| 644 | 3300005548 | Ga0070665_100271255 | Ga0070665_1002712552 | 211 |
| 645 | 3300005840 | Ga0068870_10004675 | Ga0068870_100046758 | 211 |
| 646 | 3300005841 | Ga0068863_100215634 | Ga0068863_1002156342 | 211 |
| 647 | 3300005937 | Ga0081455_10143128 | Ga0081455_101431282 | 211 |
| 648 | 3300006237 | Ga0097621_100065001 | Ga0097621_1000650012 | 211 |
| 649 | 3300006237 | Ga0097621_100145380 | Ga0097621_1001453802 | 211 |
| 650 | 3300006358 | Ga0068871_100052960 | Ga0068871_1000529603 | 211 |
| 651 | 3300006358 | Ga0068871_100198657 | Ga0068871_1001986572 | 211 |
| 652 | 3300006881 | Ga0068865_100063201 | Ga0068865_1000632013 | 211 |
| 653 | 3300006881 | Ga0068865_100416581 | Ga0068865_1004165811 | 211 |
| 654 | 3300009094 | Ga0111539_10057730 | Ga0111539_100577303 | 211 |
| 655 | 3300009176 | Ga0105242_10328124 | Ga0105242_103281242 | 211 |
| 656 | 3300009177 | Ga0105248_10176839 | Ga0105248_101768392 | 211 |
| 657 | 3300009553 | Ga0105249_11016791 | Ga0105249_110167911 | 211 |
| 658 | 3300013296 | Ga0157374_10404451 | Ga0157374_104044512 | 211 |
| 659 | 3300014325 | Ga0163163_10258025 | Ga0163163_102580252 | 211 |
| 660 | 3300014326 | Ga0157380_10028522 | Ga0157380_100285223 | 211 |
| 661 | 3300014326 | Ga0157380_10135749 | Ga0157380_101357493 | 211 |
| 662 | 3300014326 | Ga0157380_10498600 | Ga0157380_104986002 | 211 |
| 663 | 3300014745 | Ga0157377_10163989 | Ga0157377_101639892 | 211 |
| 664 | 3300014969 | Ga0157376_10168196 | Ga0157376_101681962 | 211 |
| 665 | 3300025245 | Ga0207425_1000015 | Ga0207425_100001562 | 211 |
| 666 | 3300025258 | Ga0209129_1000126 | Ga0209129_100012658 | 211 |
| 667 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002960 | 211 |
| 668 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003967 | 211 |
| 669 | 3300025893 | Ga0207682_10011592 | Ga0207682_100115923 | 211 |
| 670 | 3300025893 | Ga0207682_10012266 | Ga0207682_100122662 | 211 |
| 671 | 3300025907 | Ga0207645_10185183 | Ga0207645_101851831 | 211 |
| 672 | 3300025908 | Ga0207643_10016764 | Ga0207643_100167643 | 211 |
| 673 | 3300025923 | Ga0207681_10079662 | Ga0207681_100796623 | 211 |
| 674 | 3300025936 | Ga0207670_10224482 | Ga0207670_102244822 | 211 |
| 675 | 3300025937 | Ga0207669_10210538 | Ga0207669_102105382 | 211 |
| 676 | 3300025940 | Ga0207691_10017495 | Ga0207691_100174952 | 211 |
| 677 | 3300025941 | Ga0207711_10119661 | Ga0207711_101196613 | 211 |
| 678 | 3300025960 | Ga0207651_10165679 | Ga0207651_101656792 | 211 |
| 679 | 3300025986 | Ga0207658_10234846 | Ga0207658_102348462 | 211 |
| 680 | 3300026075 | Ga0207708_10014979 | Ga0207708_100149795 | 211 |
| 681 | 3300026088 | Ga0207641_10223705 | Ga0207641_102237052 | 211 |
| 682 | 3300026118 | Ga0207675_100342464 | Ga0207675_1003424642 | 211 |
| 683 | 3300026121 | Ga0207683_10050516 | Ga0207683_100505163 | 211 |
| 684 | 3300026121 | Ga0207683_10071833 | Ga0207683_100718332 | 211 |
| 685 | 3300028379 | Ga0268266_10149473 | Ga0268266_101494732 | 211 |
| 686 | 3300039062 | Ga0400483_129729 | Ga0400483_129729_2786_3457 | 211 |
| 687 | 3300039062 | Ga0400483_257754 | Ga0400483_257754_3111_3782 | 211 |
| 688 | 3300046474 | Ga0495605_0074461 | Ga0495605_0074461_295_966 | 211 |
| 689 | 3300046501 | Ga0495607_0017440 | Ga0495607_0017440_1662_2333 | 211 |
| 690 | 3300046507 | Ga0495606_0040103 | Ga0495606_0040103_1090_1761 | 211 |
| 691 | 3300046512 | Ga0495610_0064100 | Ga0495610_0064100_80_751 | 211 |
| 692 | 3300046615 | Ga0495656_0125549 | Ga0495656_0125549_41_718 | 211 |
| 693 | 3300047470 | Ga0495681_0078036 | Ga0495681_0078036_218_895 | 211 |
| 694 | 3300047472 | Ga0495686_0140108 | Ga0495686_0140108_441_1112 | 211 |
| 695 | 3300048927 | Ga0496124_0000034 | Ga0496124_0000034_226333_227004 | 211 |
| 696 | 3300049568 | Ga0501031_0573022 | Ga0501031_0573022_31_702 | 211 |
| 697 | 3300049574 | Ga0501038_0696976 | Ga0501038_0696976_78_749 | 211 |
| 698 | 3300049586 | Ga0501070_0027609 | Ga0501070_0027609_201_884 | 211 |
| 699 | 3300049586 | Ga0501070_0677498 | Ga0501070_0677498_39_710 | 211 |
| 700 | 3300049742 | Ga0501080_0012404 | Ga0501080_0012404_3463_4146 | 211 |
| 701 | 2162886007 | SwRhRL2b_contig_2903557 | SwRhRL2b_0434.00007260 | 212 |
| 702 | 3300003187 | JGI25151J46595_10001571 | JGI25151J46595_1000157119 | 212 |
| 703 | 3300004799 | Ga0058863_11530858 | Ga0058863_115308582 | 212 |
| 704 | 3300004800 | Ga0058861_11853254 | Ga0058861_118532542 | 212 |
| 705 | 3300004803 | Ga0058862_12563802 | Ga0058862_125638022 | 212 |
| 706 | 3300005289 | Ga0065704_10013744 | Ga0065704_100137441 | 212 |
| 707 | 3300005289 | Ga0065704_10114139 | Ga0065704_101141393 | 212 |
| 708 | 3300005289 | Ga0065704_10178728 | Ga0065704_101787281 | 212 |
| 709 | 3300005543 | Ga0070672_100052932 | Ga0070672_1000529323 | 212 |
| 710 | 3300005548 | Ga0070665_100827597 | Ga0070665_1008275972 | 212 |
| 711 | 3300005841 | Ga0068863_100686681 | Ga0068863_1006866812 | 212 |
| 712 | 3300006881 | Ga0068865_100171550 | Ga0068865_1001715502 | 212 |
| 713 | 3300009093 | Ga0105240_10005743 | Ga0105240_1000574317 | 212 |
| 714 | 3300009094 | Ga0111539_10489632 | Ga0111539_104896322 | 212 |
| 715 | 3300009174 | Ga0105241_10546756 | Ga0105241_105467561 | 212 |
| 716 | 3300013105 | Ga0157369_10228483 | Ga0157369_102284832 | 212 |
| 717 | 3300013105 | Ga0157369_10331781 | Ga0157369_103317812 | 212 |
| 718 | 3300013308 | Ga0157375_10001924 | Ga0157375_100019245 | 212 |
| 719 | 3300013308 | Ga0157375_10012821 | Ga0157375_100128218 | 212 |
| 720 | 3300014497 | Ga0182008_10043776 | Ga0182008_100437763 | 212 |
| 721 | 3300014969 | Ga0157376_10292583 | Ga0157376_102925832 | 212 |
| 722 | 3300015689 | Ga0183360_10001 | Ga0183360_100013227 | 212 |
| 723 | 3300017792 | Ga0163161_10403638 | Ga0163161_104036382 | 212 |
| 724 | 3300025263 | Ga0209565_1011175 | Ga0209565_10111752 | 212 |
| 725 | 3300025292 | Ga0209676_1000052 | Ga0209676_100005293 | 212 |
| 726 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006466 | 212 |
| 727 | 3300025297 | Ga0209758_1010914 | Ga0209758_10109144 | 212 |
| 728 | 3300025940 | Ga0207691_10010224 | Ga0207691_100102243 | 212 |
| 729 | 3300025942 | Ga0207689_10213293 | Ga0207689_102132932 | 212 |
| 730 | 3300026088 | Ga0207641_10284921 | Ga0207641_102849212 | 212 |
| 731 | 3300026118 | Ga0207675_100035406 | Ga0207675_1000354065 | 212 |
| 732 | 3300031090 | Ga0265760_10024309 | Ga0265760_100243091 | 212 |
| 733 | 3300031251 | Ga0265327_10003819 | Ga0265327_100038192 | 212 |
| 734 | 3300031344 | Ga0265316_10098488 | Ga0265316_100984882 | 212 |
| 735 | 3300031665 | Ga0316575_10006188 | Ga0316575_100061882 | 212 |
| 736 | 3300031727 | Ga0316576_10003250 | Ga0316576_100032508 | 212 |
| 737 | 3300032002 | Ga0307416_101334465 | Ga0307416_1013344651 | 212 |
| 738 | 3300032126 | Ga0307415_100102862 | Ga0307415_1001028621 | 212 |
| 739 | 3300041404 | Ga0439436_0079888 | Ga0439436_0079888_203_877 | 212 |
| 740 | 3300041407 | Ga0439447_035762 | Ga0439447_035762_87_782 | 212 |
| 741 | 3300041413 | Ga0439465_0021787 | Ga0439465_0021787_1123_1800 | 212 |
| 742 | 3300042007 | Ga0439449_0000008 | Ga0439449_0000008_45415_46089 | 212 |
| 743 | 3300042007 | Ga0439449_0009302 | Ga0439449_0009302_2325_3014 | 212 |
| 744 | 3300042007 | Ga0439449_0012567 | Ga0439449_0012567_834_1511 | 212 |
| 745 | 3300045051 | Ga0451576_0064226 | Ga0451576_0064226_2303_2983 | 212 |
| 746 | 3300045976 | Ga0466967_0269442 | Ga0466967_0269442_324_1025 | 212 |
| 747 | 3300046525 | Ga0495663_0133587 | Ga0495663_0133587_78_773 | 212 |
| 748 | 3300046616 | Ga0495668_0001101 | Ga0495668_0001101_815_1510 | 212 |
| 749 | 3300047319 | Ga0495674_0123162 | Ga0495674_0123162_486_1229 | 212 |
| 750 | 3300048917 | Ga0496114_0040228 | Ga0496114_0040228_2328_3002 | 212 |
| 751 | 3300048922 | Ga0496119_0006959 | Ga0496119_0006959_6839_7534 | 212 |
| 752 | 3300048925 | Ga0496122_0003953 | Ga0496122_0003953_13236_13910 | 212 |
| 753 | 3300048926 | Ga0496123_0003147 | Ga0496123_0003147_5050_5724 | 212 |
| 754 | 3300048928 | Ga0496125_0116963 | Ga0496125_0116963_677_1351 | 212 |
| 755 | 3300049571 | Ga0501034_0000263 | Ga0501034_0000263_30761_31438 | 212 |
| 756 | 3300049571 | Ga0501034_0102152 | Ga0501034_0102152_1161_1835 | 212 |
| 757 | 3300049705 | Ga0501225_0000850 | Ga0501225_0000850_7885_8559 | 212 |
| 758 | iso_pu_bacteria | 2643221593 | 2643973177 | 212 |
| 759 | iso_pu_bacteria | 8055878733 | 8055880398 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fli-assembly1.cif.gz_E | the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate | 0.9857 | 2 | 207 |
| 7sbj-assembly1.cif.gz_C | crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a | 0.9828 | 2 | 207 |
| 7u5y-assembly1.cif.gz_E | crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa | 0.9753 | 2 | 207 |
| 3inp-assembly1.cif.gz_A | 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. | 0.9733 | 2 | 207 |
| 1tqj-assembly1.cif.gz_B | crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution | 0.9704 | 2 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fliC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9862 | 2 | 207 | 3.20.20.70 |
| af_P0AG07_1_223_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9813 | 2 | 207 | 3.20.20.70 |
| af_Q58093_1_217_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9726 | 2 | 207 | 3.20.20.70 |
| 1tqjD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9685 | 2 | 209 | 3.20.20.70 |
| af_A0A1D6PJ99_41_293_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9672 | 2 | 201 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T5V3H4-F1-model_v4 | deleted | 0.9949 | 2 | 207 |
|
| AF-A0A2C7ADH0-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.993 | 2 | 207 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A813A470-F1-model_v4 | ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.993 | 2 | 167 |
GO:0004750
GO:0005975 GO:0006098 |
| AF-A0A661NUS9-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.9924 | 2 | 207 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
| AF-A0A0U4W401-F1-model_v4 | Ribulose-phosphate 3-epimerase (EC 5.1.3.1) | 0.992 | 2 | 205 |
GO:0004750
GO:0006098 GO:0019323 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar