F479487

General Info

Members Datasets Scaffolds Average Seq Length
759 392 754 227

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10096785|Ga0307516_100967852
Length 277
Sequence MIFTQVSRDDRTQASTRECRGGAESPESRANPGNRARADCLVTGGDGTGNAAAMQQPTRIAPSILSADFARLGAEVEAIDAAGADYIHVDVMDGHFVPNLTIGPVVVRALRPHSNKTFDVHLMIAPVDPYVPEFAEAGADILTFHPEAGPHAHRTVQLIRSHGKKAGISLNPGTPIDFIDHLLPELDLVLIMSVNPGFGGQKFLPLALDKIQAVRRKINQVAESQNGRPIDLEVDGGITADNAASVIKAGADVLVAGTASFTGGAKRYADNIARLRG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
3 2643221593 Lysobacter sp. Root690 Isolate Unclassified
4 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
5 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
6 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
7 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
204 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
260 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
312 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
313 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
331 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
370 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
377 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
378 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
381 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
382 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
383 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
388 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
389 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 2.11
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.77
Nodule 0.13
Rhizoplane 2.77
Rhizosphere 84.98
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2903557 2162886007 Bacteria 1012
2 JGI24736J21556_1007878 3300001904 Bacteria 1782
3 JGI24741J21665_1001461 3300001915 Bacteria 6768
4 JGI24741J21665_1001635 3300001915 Bacteria 6242
5 JGI24741J21665_1018071 3300001915 Bacteria 1130
6 JGI24740J21852_10000218 3300001979 Bacteria 24225
7 JGI24740J21852_10000952 3300001979 Bacteria 12863
8 JGI24740J21852_10042802 3300001979 Bacteria 1354
9 JGI25150J39212_1000032 3300002774 Bacteria 99615
10 JGI25151J46595_10000010 3300003187 Bacteria 277507
11 JGI25151J46595_10001571 3300003187 Bacteria 15244
12 JGI25165J46597_1003063 3300003214 Bacteria 4534
13 JGI25153J46596_10000013 3300003215 Bacteria 303690
14 JGI25153J46596_10001011 3300003215 Bacteria 17119
15 Ga0055542_1007844 3300003762 Bacteria 2130
16 Ga0055526_1029522 3300003771 Bacteria 1625
17 Ga0055531_10011784 3300003794 Bacteria 4177
18 Ga0055531_10012303 3300003794 Bacteria 4037
19 Ga0058863_11530858 3300004799 Bacteria 910
20 Ga0058861_11853254 3300004800 Bacteria 1340
21 Ga0058862_12563802 3300004803 Bacteria 988
22 Ga0058862_12839795 3300004803 Bacteria 1097
23 Ga0065704_10013744 3300005289 Bacteria 1832
24 Ga0065704_10114139 3300005289 Bacteria 1897
25 Ga0065704_10178728 3300005289 Bacteria 1249
26 Ga0070658_10005847 3300005327 Bacteria 9974
27 Ga0070683_100059060 3300005329 Bacteria 3563
28 Ga0070683_100090405 3300005329 Bacteria 2874
29 Ga0070670_100961896 3300005331 Bacteria 776
30 Ga0070677_10009295 3300005333 Bacteria 3329
31 Ga0070680_100002370 3300005336 Bacteria 13928
32 Ga0070680_100006137 3300005336 Bacteria 9111
33 Ga0070680_100117031 3300005336 Bacteria 2222
34 Ga0070682_100012978 3300005337 Bacteria 4782
35 Ga0070682_100030283 3300005337 Bacteria 3265
36 Ga0070682_100132106 3300005337 Bacteria 1691
37 Ga0070660_100105114 3300005339 Bacteria 2240
38 Ga0070660_100153544 3300005339 Bacteria 1852
39 Ga0070689_100228815 3300005340 Bacteria 1528
40 Ga0070691_10000192 3300005341 Bacteria 20485
41 Ga0070691_10105392 3300005341 Bacteria 1405
42 Ga0070661_100008590 3300005344 Bacteria 7062
43 Ga0070661_100062142 3300005344 Bacteria 2742
44 Ga0070661_100062792 3300005344 Bacteria 2727
45 Ga0070692_10000140 3300005345 Bacteria 17499
46 Ga0070692_10075286 3300005345 Bacteria 1807
47 Ga0070668_100013534 3300005347 Bacteria 6090
48 Ga0070669_100041926 3300005353 Bacteria 3330
49 Ga0070675_100111468 3300005354 Bacteria 2315
50 Ga0070671_100012619 3300005355 Bacteria 6809
51 Ga0070674_100036125 3300005356 Bacteria 3314
52 Ga0070674_100076735 3300005356 Bacteria 2376
53 Ga0070674_100222311 3300005356 Bacteria 1469
54 Ga0070673_100134200 3300005364 Bacteria 2081
55 Ga0070673_100343246 3300005364 Bacteria 1324
56 Ga0070667_100071236 3300005367 Bacteria 2960
57 Ga0070667_100685241 3300005367 Bacteria 948
58 Ga0070709_10337142 3300005434 Bacteria 1111
59 Ga0070714_100027224 3300005435 Bacteria 4731
60 Ga0070713_100008932 3300005436 Bacteria 7139
61 Ga0070713_100337264 3300005436 Bacteria 1396
62 Ga0070713_100928042 3300005436 Bacteria 838
63 Ga0070713_100986314 3300005436 Bacteria 812
64 Ga0070710_10045605 3300005437 Bacteria 2438
65 Ga0070710_10115171 3300005437 Bacteria 1620
66 Ga0070701_10164164 3300005438 Bacteria 1289
67 Ga0070705_100236541 3300005440 Bacteria 1274
68 Ga0070700_100264326 3300005441 Bacteria 1240
69 Ga0070708_100004705 3300005445 Bacteria 10757
70 Ga0070663_100051357 3300005455 Bacteria 2937
71 Ga0070663_100205801 3300005455 Bacteria 1538
72 Ga0070678_100021861 3300005456 Bacteria 4228
73 Ga0070678_100022127 3300005456 Bacteria 4204
74 Ga0070678_100060385 3300005456 Bacteria 2790
75 Ga0070662_100049987 3300005457 Bacteria 3016
76 Ga0070681_10002172 3300005458 Bacteria 17847
77 Ga0070681_10003218 3300005458 Bacteria 15216
78 Ga0070681_10026450 3300005458 Bacteria 5830
79 Ga0070681_10065692 3300005458 Bacteria 3596
80 Ga0068867_100048884 3300005459 Bacteria 3113
81 Ga0070706_100000078 3300005467 Bacteria 112530
82 Ga0070706_100093691 3300005467 Bacteria 2787
83 Ga0070706_100241398 3300005467 Bacteria 1687
84 Ga0070707_100407371 3300005468 Bacteria 1320
85 Ga0070698_100099465 3300005471 Bacteria 2882
86 Ga0070699_100019801 3300005518 Bacteria 5800
87 Ga0070699_100135906 3300005518 Bacteria 2169
88 Ga0070699_100169212 3300005518 Bacteria 1936
89 Ga0070679_100000921 3300005530 Bacteria 25586
90 Ga0070679_100001059 3300005530 Bacteria 23994
91 Ga0070679_100031516 3300005530 Bacteria 5238
92 Ga0070679_100119971 3300005530 Bacteria 2615
93 Ga0070684_100080002 3300005535 Bacteria 2890
94 Ga0070684_100083930 3300005535 Bacteria 2823
95 Ga0070684_100200333 3300005535 Bacteria 1818
96 Ga0070697_100009172 3300005536 Bacteria 7730
97 Ga0068853_100018102 3300005539 Bacteria 5826
98 Ga0068853_100089986 3300005539 Bacteria 2696
99 Ga0068853_100114077 3300005539 Bacteria 2403
100 Ga0070672_100025661 3300005543 Bacteria 4374
101 Ga0070672_100052932 3300005543 Bacteria 3172
102 Ga0070696_100060833 3300005546 Bacteria 2641
103 Ga0070693_100074101 3300005547 Bacteria 2013
104 Ga0070665_100013951 3300005548 Bacteria 8082
105 Ga0070665_100271255 3300005548 Bacteria 1698
106 Ga0070665_100394469 3300005548 Bacteria 1392
107 Ga0070665_100827597 3300005548 Bacteria 939
108 Ga0068855_100005890 3300005563 Bacteria 14942
109 Ga0068855_100425079 3300005563 Bacteria 1453
110 Ga0068855_100481229 3300005563 Bacteria 1351
111 Ga0070664_100068179 3300005564 Bacteria 3041
112 Ga0070664_100187272 3300005564 Bacteria 1843
113 Ga0068857_100060138 3300005577 Bacteria 3375
114 Ga0068857_100111168 3300005577 Bacteria 2463
115 Ga0068854_100015268 3300005578 Bacteria 5083
116 Ga0068854_100022402 3300005578 Bacteria 4303
117 Ga0068854_100077711 3300005578 Bacteria 2443
118 Ga0068854_100113938 3300005578 Bacteria 2043
119 Ga0068856_100020297 3300005614 Bacteria 6454
120 Ga0068856_100180940 3300005614 Bacteria 2121
121 Ga0068852_100003635 3300005616 Bacteria 10800
122 Ga0068852_100018449 3300005616 Bacteria 5497
123 Ga0068852_100022939 3300005616 Bacteria 5015
124 Ga0068866_10067273 3300005718 Bacteria 1880
125 Ga0068870_10004675 3300005840 Bacteria 5914
126 Ga0068863_100215634 3300005841 Bacteria 1848
127 Ga0068863_100686681 3300005841 Bacteria 1017
128 Ga0068858_100190109 3300005842 Bacteria 1940
129 Ga0068860_100426764 3300005843 Bacteria 1315
130 Ga0068862_100010966 3300005844 Bacteria 7483
131 Ga0068862_100045989 3300005844 Bacteria 3725
132 Ga0081455_10143128 3300005937 Bacteria 1854
133 Ga0081455_10153294 3300005937 Bacteria 1774
134 Ga0081455_10168830 3300005937 Bacteria 1669
135 Ga0081538_10009218 3300005981 Bacteria 8268
136 Ga0081539_10147125 3300005985 Bacteria 1138
137 Ga0070717_10058335 3300006028 Bacteria 3192
138 Ga0070717_10227032 3300006028 Bacteria 1643
139 Ga0075368_10079823 3300006042 Bacteria 1330
140 Ga0075363_100005558 3300006048 Bacteria 5622
141 Ga0070716_100247244 3300006173 Bacteria 1213
142 Ga0070712_100116737 3300006175 Bacteria 2002
143 Ga0070712_100120344 3300006175 Bacteria 1974
144 Ga0097621_100065001 3300006237 Bacteria 3001
145 Ga0097621_100145380 3300006237 Bacteria 2029
146 Ga0097621_100374135 3300006237 Bacteria 1271
147 Ga0075370_10009559 3300006353 Bacteria 5040
148 Ga0068871_100052960 3300006358 Bacteria 3288
149 Ga0068871_100198657 3300006358 Bacteria 1730
150 Ga0075430_100361430 3300006846 Bacteria 1199
151 Ga0075431_100209105 3300006847 Bacteria 1994
152 Ga0075433_10117007 3300006852 Bacteria 2365
153 Ga0068865_100063201 3300006881 Bacteria 2601
154 Ga0068865_100064415 3300006881 Bacteria 2580
155 Ga0068865_100171550 3300006881 Bacteria 1663
156 Ga0068865_100416581 3300006881 Bacteria 1103
157 Ga0105240_10001510 3300009093 Bacteria 39587
158 Ga0105240_10005743 3300009093 Bacteria 18404
159 Ga0105240_10197172 3300009093 Bacteria 2363
160 Ga0105240_10580077 3300009093 Bacteria 1237
161 Ga0105240_10884576 3300009093 Bacteria 962
162 Ga0111539_10057730 3300009094 Bacteria 4608
163 Ga0111539_10085414 3300009094 Bacteria 3709
164 Ga0111539_10213592 3300009094 Bacteria 2247
165 Ga0111539_10270444 3300009094 Bacteria 1978
166 Ga0111539_10489632 3300009094 Bacteria 1432
167 Ga0105245_10043644 3300009098 Bacteria 3999
168 Ga0105245_10188069 3300009098 Bacteria 1976
169 Ga0105247_10037319 3300009101 Bacteria 2965
170 Ga0105247_10549251 3300009101 Bacteria 849
171 Ga0114129_10154214 3300009147 Bacteria 3142
172 Ga0114129_10259074 3300009147 Bacteria 2332
173 Ga0105243_10558462 3300009148 Bacteria 1095
174 Ga0105241_10054323 3300009174 Bacteria 3066
175 Ga0105241_10155914 3300009174 Bacteria 1872
176 Ga0105241_10546756 3300009174 Bacteria 1039
177 Ga0105242_10126845 3300009176 Bacteria 2197
178 Ga0105242_10328124 3300009176 Bacteria 1406
179 Ga0105248_10007217 3300009177 Bacteria 12191
180 Ga0105248_10176839 3300009177 Bacteria 2405
181 Ga0105248_11143780 3300009177 Bacteria 880
182 Ga0105248_11353140 3300009177 Bacteria 805
183 Ga0105237_10001757 3300009545 Bacteria 28033
184 Ga0105237_10798105 3300009545 Bacteria 951
185 Ga0105238_10001945 3300009551 Bacteria 20780
186 Ga0105238_10064580 3300009551 Bacteria 3660
187 Ga0105249_11016791 3300009553 Bacteria 898
188 Ga0099796_10084291 3300010159 Bacteria 1171
189 Ga0105239_10048904 3300010375 Bacteria 4636
190 Ga0105239_10205533 3300010375 Bacteria 2207
191 Ga0105239_10746415 3300010375 Bacteria 1120
192 Ga0105246_10003166 3300011119 Bacteria 9996
193 Ga0105246_10076483 3300011119 Bacteria 2372
194 Ga0157371_10066479 3300013102 Bacteria 2552
195 Ga0157371_10081128 3300013102 Bacteria 2296
196 Ga0157371_10207666 3300013102 Bacteria 1405
197 Ga0157370_10002287 3300013104 Bacteria 23214
198 Ga0157370_10051198 3300013104 Bacteria 3945
199 Ga0157370_10172926 3300013104 Bacteria 2008
200 Ga0157369_10012731 3300013105 Bacteria 9538
201 Ga0157369_10152727 3300013105 Bacteria 2440
202 Ga0157369_10228483 3300013105 Bacteria 1946
203 Ga0157369_10285615 3300013105 Bacteria 1718
204 Ga0157369_10331781 3300013105 Bacteria 1580
205 Ga0157369_10478004 3300013105 Bacteria 1289
206 Ga0157369_10487804 3300013105 Bacteria 1275
207 Ga0157374_10404451 3300013296 Bacteria 1362
208 Ga0157378_10694609 3300013297 Bacteria 1036
209 Ga0157378_10889484 3300013297 Bacteria 921
210 Ga0163162_10318699 3300013306 Bacteria 1687
211 Ga0157372_10006467 3300013307 Bacteria 12478
212 Ga0157372_10016224 3300013307 Bacteria 7992
213 Ga0157372_10040855 3300013307 Bacteria 5126
214 Ga0157375_10001924 3300013308 Bacteria 17865
215 Ga0157375_10012821 3300013308 Bacteria 7444
216 Ga0163163_10004832 3300014325 Bacteria 11577
217 Ga0163163_10041829 3300014325 Bacteria 4484
218 Ga0163163_10258025 3300014325 Bacteria 1794
219 Ga0157380_10028522 3300014326 Bacteria 4256
220 Ga0157380_10135749 3300014326 Bacteria 2105
221 Ga0157380_10498600 3300014326 Bacteria 1182
222 Ga0157380_10521437 3300014326 Bacteria 1159
223 Ga0182008_10043776 3300014497 Bacteria 2228
224 Ga0157377_10163989 3300014745 Bacteria 1384
225 Ga0157377_10370863 3300014745 Bacteria 966
226 Ga0157379_10669230 3300014968 Bacteria 973
227 Ga0157376_10168196 3300014969 Bacteria 1994
228 Ga0157376_10292583 3300014969 Bacteria 1538
229 Ga0157376_10946608 3300014969 Bacteria 882
230 Ga0183360_10001 3300015689 Bacteria 3943671
231 Ga0163161_10403638 3300017792 Bacteria 1096
232 Ga0197907_10554686 3300020069 Bacteria 2038
233 Ga0206356_10126730 3300020070 Bacteria 6649
234 Ga0206356_11225299 3300020070 Bacteria 1481
235 Ga0206355_1250981 3300020076 Bacteria 1233
236 Ga0206351_10305709 3300020077 Bacteria 2908
237 Ga0206350_10835923 3300020080 Bacteria 1396
238 Ga0206354_10204110 3300020081 Bacteria 3221
239 Ga0206354_10880630 3300020081 Bacteria 3745
240 Ga0206353_10150174 3300020082 Bacteria 6346
241 Ga0206353_10254288 3300020082 Bacteria 3215
242 Ga0154015_1491307 3300020610 Bacteria 1307
243 Ga0213871_10042191 3300021441 Bacteria 1228
244 Ga0207427_104998 3300025231 Bacteria 1997
245 Ga0207425_1000015 3300025245 Bacteria 466368
246 Ga0209148_1000723 3300025254 Bacteria 26037
247 Ga0209129_1000126 3300025258 Bacteria 133335
248 Ga0209233_1000411 3300025261 Bacteria 33377
249 Ga0209565_1011175 3300025263 Bacteria 2195
250 Ga0209455_1000401 3300025272 Bacteria 36831
251 Ga0209675_1004324 3300025291 Bacteria 6366
252 Ga0209676_1000052 3300025292 Bacteria 371539
253 Ga0209025_1000002 3300025294 Bacteria 1393142
254 Ga0209025_1000006 3300025294 Bacteria 1153444
255 Ga0209564_1016660 3300025295 Bacteria 2908
256 Ga0209758_1000003 3300025297 Bacteria 1398533
257 Ga0209758_1000011 3300025297 Bacteria 1049685
258 Ga0209758_1000029 3300025297 Bacteria 520787
259 Ga0209758_1010914 3300025297 Bacteria 5352
260 Ga0209758_1020203 3300025297 Bacteria 3165
261 Ga0209050_1009108 3300025298 Bacteria 5149
262 Ga0209256_1035608 3300025299 Bacteria 1313
263 Ga0209051_1030515 3300025303 Bacteria 2091
264 Ga0209257_1000549 3300025304 Bacteria 64410
265 Ga0209257_1001093 3300025304 Bacteria 35344
266 Ga0209257_1011604 3300025304 Bacteria 4216
267 Ga0209257_1026999 3300025304 Bacteria 1920
268 Ga0207697_10149171 3300025315 Bacteria 1017
269 Ga0207656_10006407 3300025321 Bacteria 4228
270 Ga0207682_10011592 3300025893 Bacteria 3443
271 Ga0207682_10012266 3300025893 Bacteria 3346
272 Ga0207710_10084974 3300025900 Bacteria 1473
273 Ga0207680_10000001 3300025903 Bacteria 1091453
274 Ga0207647_10000224 3300025904 Bacteria 46793
275 Ga0207647_10001467 3300025904 Bacteria 18124
276 Ga0207647_10002765 3300025904 Bacteria 13242
277 Ga0207647_10144961 3300025904 Bacteria 1390
278 Ga0207699_10031276 3300025906 Bacteria 2987
279 Ga0207645_10185183 3300025907 Bacteria 1367
280 Ga0207645_10234916 3300025907 Bacteria 1211
281 Ga0207643_10016764 3300025908 Bacteria 3998
282 Ga0207705_10000198 3300025909 Bacteria 61005
283 Ga0207705_10009476 3300025909 Bacteria 7084
284 Ga0207705_10027594 3300025909 Bacteria 4049
285 Ga0207684_10000157 3300025910 Bacteria 115860
286 Ga0207684_10094538 3300025910 Bacteria 2550
287 Ga0207684_10188705 3300025910 Bacteria 1778
288 Ga0207654_10167856 3300025911 Bacteria 1423
289 Ga0207707_10000001 3300025912 Bacteria 1212482
290 Ga0207707_10000020 3300025912 Bacteria 205480
291 Ga0207707_10000319 3300025912 Bacteria 50819
292 Ga0207707_10000512 3300025912 Bacteria 39777
293 Ga0207707_10000792 3300025912 Bacteria 30994
294 Ga0207707_10000976 3300025912 Bacteria 27495
295 Ga0207707_10010022 3300025912 Bacteria 8223
296 Ga0207707_10081753 3300025912 Bacteria 2820
297 Ga0207695_10000163 3300025913 Bacteria 197030
298 Ga0207695_10003007 3300025913 Bacteria 24236
299 Ga0207695_10077679 3300025913 Bacteria 3371
300 Ga0207695_10110662 3300025913 Bacteria 2727
301 Ga0207695_10578113 3300025913 Bacteria 1005
302 Ga0207671_10001718 3300025914 Bacteria 24713
303 Ga0207693_10013217 3300025915 Bacteria 6661
304 Ga0207660_10001995 3300025917 Bacteria 13594
305 Ga0207660_10005591 3300025917 Bacteria 8162
306 Ga0207660_10006586 3300025917 Bacteria 7540
307 Ga0207660_10011098 3300025917 Bacteria 5856
308 Ga0207660_10042529 3300025917 Bacteria 3190
309 Ga0207660_10046282 3300025917 Bacteria 3069
310 Ga0207657_10014555 3300025919 Bacteria 7669
311 Ga0207657_10016071 3300025919 Bacteria 7225
312 Ga0207657_10058709 3300025919 Bacteria 3309
313 Ga0207657_10068787 3300025919 Bacteria 3007
314 Ga0207657_10196848 3300025919 Bacteria 1623
315 Ga0207649_10002249 3300025920 Bacteria 10901
316 Ga0207649_10008623 3300025920 Bacteria 5566
317 Ga0207649_10028900 3300025920 Bacteria 3269
318 Ga0207649_10059101 3300025920 Bacteria 2404
319 Ga0207649_10085744 3300025920 Bacteria 2050
320 Ga0207652_10000037 3300025921 Bacteria 134369
321 Ga0207652_10000490 3300025921 Bacteria 40239
322 Ga0207652_10000548 3300025921 Bacteria 38056
323 Ga0207652_10000879 3300025921 Bacteria 28409
324 Ga0207652_10011649 3300025921 Bacteria 7094
325 Ga0207652_10016592 3300025921 Bacteria 6016
326 Ga0207652_10064934 3300025921 Bacteria 3159
327 Ga0207646_10036689 3300025922 Bacteria 4424
328 Ga0207681_10079662 3300025923 Bacteria 2308
329 Ga0207687_10247901 3300025927 Bacteria 1414
330 Ga0207700_10052055 3300025928 Bacteria 3059
331 Ga0207700_10335155 3300025928 Bacteria 1314
332 Ga0207664_10237495 3300025929 Bacteria 1586
333 Ga0207690_10017142 3300025932 Bacteria 4418
334 Ga0207690_10040891 3300025932 Bacteria 3034
335 Ga0207690_10112866 3300025932 Bacteria 1960
336 Ga0207706_10064955 3300025933 Bacteria 3213
337 Ga0207709_10403152 3300025935 Bacteria 1046
338 Ga0207670_10224482 3300025936 Bacteria 1440
339 Ga0207669_10210538 3300025937 Bacteria 1418
340 Ga0207704_10106974 3300025938 Bacteria 1880
341 Ga0207691_10010224 3300025940 Bacteria 9002
342 Ga0207691_10017495 3300025940 Bacteria 6797
343 Ga0207711_10119661 3300025941 Bacteria 2350
344 Ga0207711_10525427 3300025941 Bacteria 1103
345 Ga0207689_10213293 3300025942 Bacteria 1595
346 Ga0207661_10045493 3300025944 Bacteria 3474
347 Ga0207661_10052825 3300025944 Bacteria 3248
348 Ga0207679_10127387 3300025945 Bacteria 2037
349 Ga0207667_10003741 3300025949 Bacteria 18770
350 Ga0207667_10004107 3300025949 Bacteria 17890
351 Ga0207667_10004852 3300025949 Bacteria 16442
352 Ga0207667_10006666 3300025949 Bacteria 13959
353 Ga0207667_10013127 3300025949 Bacteria 9503
354 Ga0207667_10663099 3300025949 Bacteria 1048
355 Ga0207651_10165679 3300025960 Bacteria 1737
356 Ga0207668_10041421 3300025972 Bacteria 3113
357 Ga0207640_10001250 3300025981 Bacteria 13851
358 Ga0207640_10028897 3300025981 Bacteria 3396
359 Ga0207640_10072442 3300025981 Bacteria 2324
360 Ga0207640_10075251 3300025981 Bacteria 2288
361 Ga0207640_10107066 3300025981 Bacteria 1973
362 Ga0207658_10125426 3300025986 Bacteria 2054
363 Ga0207658_10234846 3300025986 Bacteria 1550
364 Ga0207703_10283482 3300026035 Bacteria 1506
365 Ga0207639_10000562 3300026041 Bacteria 25536
366 Ga0207639_10018506 3300026041 Bacteria 4952
367 Ga0207639_10031301 3300026041 Bacteria 3909
368 Ga0207639_10766995 3300026041 Bacteria 897
369 Ga0207678_10011828 3300026067 Bacteria 7663
370 Ga0207678_10022764 3300026067 Bacteria 5487
371 Ga0207678_10036855 3300026067 Bacteria 4257
372 Ga0207678_10054937 3300026067 Bacteria 3430
373 Ga0207678_10125519 3300026067 Bacteria 2189
374 Ga0207708_10014979 3300026075 Bacteria 5810
375 Ga0207708_10562110 3300026075 Bacteria 963
376 Ga0207702_10005433 3300026078 Bacteria 11150
377 Ga0207702_10016316 3300026078 Bacteria 6148
378 Ga0207702_10613363 3300026078 Bacteria 1068
379 Ga0207641_10223705 3300026088 Bacteria 1746
380 Ga0207641_10284921 3300026088 Bacteria 1555
381 Ga0207648_10267351 3300026089 Bacteria 1527
382 Ga0207674_10018087 3300026116 Bacteria 7672
383 Ga0207674_10018959 3300026116 Bacteria 7459
384 Ga0207674_10038080 3300026116 Bacteria 4997
385 Ga0207674_10040967 3300026116 Bacteria 4793
386 Ga0207674_10237670 3300026116 Bacteria 1769
387 Ga0207675_100035406 3300026118 Bacteria 4656
388 Ga0207675_100065106 3300026118 Bacteria 3407
389 Ga0207675_100342464 3300026118 Bacteria 1464
390 Ga0207683_10027978 3300026121 Bacteria 4872
391 Ga0207683_10050516 3300026121 Bacteria 3642
392 Ga0207683_10071833 3300026121 Bacteria 3060
393 Ga0207683_10096611 3300026121 Bacteria 2634
394 Ga0207698_10000506 3300026142 Bacteria 22646
395 Ga0207698_10002967 3300026142 Bacteria 10165
396 Ga0207698_10010590 3300026142 Bacteria 5937
397 Ga0207698_10345253 3300026142 Bacteria 1404
398 Ga0207428_10001290 3300027907 Bacteria 26731
399 Ga0268266_10149473 3300028379 Bacteria 2104
400 Ga0268266_10683160 3300028379 Bacteria 989
401 Ga0268265_10009019 3300028380 Bacteria 6746
402 Ga0268265_10019872 3300028380 Bacteria 4678
403 Ga0268264_10376019 3300028381 Bacteria 1359
404 Ga0265338_10047890 3300028800 Bacteria 3897
405 Ga0307512_10244802 3300030522 Bacteria 902
406 Ga0265760_10024309 3300031090 Bacteria 1765
407 Ga0265330_10008931 3300031235 Bacteria 4786
408 Ga0265320_10053712 3300031240 Bacteria 1946
409 Ga0265325_10047319 3300031241 Bacteria 2226
410 Ga0265329_10001600 3300031242 Bacteria 10849
411 Ga0265339_10000008 3300031249 Bacteria 239647
412 Ga0265339_10005817 3300031249 Bacteria 8180
413 Ga0265339_10015834 3300031249 Bacteria 4511
414 Ga0265339_10062706 3300031249 Bacteria 1998
415 Ga0265327_10003819 3300031251 Bacteria 13924
416 Ga0265327_10059902 3300031251 Bacteria 1948
417 Ga0265327_10082102 3300031251 Bacteria 1589
418 Ga0265316_10000203 3300031344 Bacteria 69095
419 Ga0265316_10098488 3300031344 Bacteria 2225
420 Ga0307513_10156721 3300031456 Bacteria 2176
421 Ga0307509_10218896 3300031507 Bacteria 1720
422 Ga0307408_100609602 3300031548 Bacteria 971
423 Ga0265313_10057889 3300031595 Bacteria 1828
424 Ga0307508_10111953 3300031616 Bacteria 2330
425 Ga0316575_10006188 3300031665 Bacteria 4294
426 Ga0265314_10029023 3300031711 Bacteria 4116
427 Ga0265314_10045935 3300031711 Bacteria 3084
428 Ga0265342_10000221 3300031712 Bacteria 64721
429 Ga0265342_10006958 3300031712 Bacteria 8359
430 Ga0265342_10027877 3300031712 Bacteria 3523
431 Ga0316576_10003250 3300031727 Bacteria 9481
432 Ga0307516_10096785 3300031730 Bacteria 2772
433 Ga0307413_10018790 3300031824 Bacteria 3635
434 Ga0307406_10377367 3300031901 Bacteria 1117
435 Ga0307412_10169580 3300031911 Bacteria 1631
436 Ga0307416_100275195 3300032002 Bacteria 1656
437 Ga0307416_101334465 3300032002 Bacteria 823
438 Ga0307411_10111274 3300032005 Bacteria 1960
439 Ga0307415_100102862 3300032126 Bacteria 2100
440 Ga0307415_100799185 3300032126 Bacteria 861
441 Ga0307415_101157536 3300032126 Bacteria 727
442 Ga0316585_10023767 3300032137 Bacteria 1892
443 Ga0307510_10000164 3300033180 Bacteria 56009
444 Ga0307510_10046569 3300033180 Bacteria 4660
445 Ga0373926_0043068 3300035083 Bacteria 1615
446 Ga0373934_0012539 3300035086 Bacteria 3199
447 Ga0373934_0077165 3300035086 Bacteria 1336
448 Ga0373936_0042290 3300035113 Bacteria 1829
449 Ga0373939_0123995 3300035114 Bacteria 915
450 Ga0373953_0043558 3300035117 Bacteria 1792
451 Ga0373953_0236075 3300035117 Bacteria 793
452 Ga0373954_0050713 3300035118 Bacteria 1947
453 Ga0373956_0117423 3300035119 Bacteria 1241
454 Ga0373957_0120440 3300035120 Bacteria 1062
455 Ga0373943_0034559 3300035170 Bacteria 2412
456 Ga0373943_0092378 3300035170 Bacteria 1569
457 Ga0373943_0100701 3300035170 Bacteria 1511
458 Ga0373946_0021523 3300035171 Bacteria 2501
459 Ga0373946_0226058 3300035171 Bacteria 905
460 Ga0373955_0036950 3300035172 Bacteria 2595
461 Ga0373955_0125170 3300035172 Bacteria 1497
462 Ga0373924_0007147 3300035410 Bacteria 4024
463 Ga0373931_0449046 3300035691 Bacteria 824
464 Ga0373935_0038791 3300035692 Bacteria 2984
465 Ga0373935_0063540 3300035692 Bacteria 2366
466 Ga0373935_0106066 3300035692 Bacteria 1859
467 Ga0373935_0583530 3300035692 Bacteria 817
468 Ga0373927_0069172 3300035695 Bacteria 2285
469 Ga0373927_0072265 3300035695 Bacteria 2232
470 Ga0373933_0001978 3300035724 Bacteria 11812
471 Ga0373933_0069550 3300035724 Bacteria 2140
472 Ga0373947_0021275 3300035725 Bacteria 3753
473 Ga0373947_0184747 3300035725 Bacteria 1359
474 Ga0373947_0204717 3300035725 Bacteria 1292
475 Ga0373937_0013933 3300036401 Bacteria 7089
476 Ga0373937_0050840 3300036401 Bacteria 3798
477 Ga0373937_0448340 3300036401 Bacteria 1225
478 Ga0316584_0115833 3300036712 Bacteria 2005
479 Ga0316584_0321335 3300036712 Bacteria 1117
480 Ga0373925_0005605 3300037068 Bacteria 9347
481 Ga0373925_0025732 3300037068 Bacteria 4303
482 Ga0373925_0106863 3300037068 Bacteria 2158
483 Ga0373925_0415187 3300037068 Bacteria 1099
484 Ga0373925_0512330 3300037068 Bacteria 985
485 Ga0373925_0910391 3300037068 Bacteria 725
486 Ga0395899_0015110 3300037312 Bacteria 5885
487 Ga0395899_0126232 3300037312 Bacteria 1830
488 Ga0395900_0094482 3300037418 Bacteria 3071
489 Ga0395900_0558630 3300037418 Bacteria 1088
490 Ga0395898_0134465 3300037466 Bacteria 2367
491 Ga0395898_0207152 3300037466 Bacteria 1871
492 Ga0436364_0242530 3300037853 Bacteria 1780
493 Ga0436364_1298093 3300037853 Bacteria 3643
494 Ga0395901_0022931 3300038443 Bacteria 6399
495 Ga0400483_129729 3300039062 Bacteria 8364
496 Ga0400483_257754 3300039062 Bacteria 8883
497 Ga0436365_1252050 3300039437 Bacteria 1347
498 Ga0436365_1605027 3300039437 Bacteria 2107
499 Ga0436360_0120062 3300039438 Bacteria 763
500 Ga0436360_0471757 3300039438 Bacteria 1210
501 Ga0436360_0495490 3300039438 Bacteria 2204
502 Ga0436360_0527097 3300039438 Bacteria 2477
503 Ga0436360_1053742 3300039438 Bacteria 1320
504 Ga0436361_0282143 3300039447 Bacteria 1491
505 Ga0439436_0079888 3300041404 Bacteria 910
506 Ga0439447_035762 3300041407 Bacteria 1229
507 Ga0439465_0021787 3300041413 Bacteria 2011
508 Ga0439441_048167 3300042001 Bacteria 871
509 Ga0439449_0000008 3300042007 Bacteria 62060
510 Ga0439449_0009302 3300042007 Bacteria 3725
511 Ga0439449_0012567 3300042007 Bacteria 3184
512 Ga0439464_0078814 3300042439 Bacteria 982
513 Ga0451577_0001586 3300042876 Bacteria 29663
514 Ga0453683_0207064 3300044673 Bacteria 1246
515 Ga0453684_0000374 3300044712 Bacteria 183743
516 Ga0453684_0086229 3300044712 Bacteria 3897
517 Ga0451576_0001603 3300045051 Bacteria 38023
518 Ga0451576_0029780 3300045051 Bacteria 5840
519 Ga0451576_0064226 3300045051 Bacteria 3824
520 Ga0451576_0205524 3300045051 Bacteria 2056
521 Ga0451576_0512494 3300045051 Bacteria 1260
522 Ga0466967_0269442 3300045976 Bacteria 1631
523 Ga0466967_1008736 3300045976 Bacteria 829
524 Ga0495592_0264513 3300046454 Bacteria 1131
525 Ga0495603_0385842 3300046455 Bacteria 803
526 Ga0495629_0181557 3300046459 Bacteria 1458
527 Ga0495651_0025267 3300046462 Bacteria 4623
528 Ga0495653_0123957 3300046463 Bacteria 1837
529 Ga0495650_0000345 3300046471 Bacteria 82674
530 Ga0495605_0074461 3300046474 Bacteria 1598
531 Ga0495639_0394796 3300046475 Bacteria 698
532 Ga0495664_0010209 3300046477 Bacteria 5269
533 Ga0495664_0203653 3300046477 Bacteria 1199
534 Ga0495607_0017440 3300046501 Bacteria 4608
535 Ga0495606_0040103 3300046507 Bacteria 3149
536 Ga0495606_0312053 3300046507 Bacteria 848
537 Ga0495608_0025784 3300046511 Bacteria 4012
538 Ga0495608_0199974 3300046511 Bacteria 1259
539 Ga0495610_0064100 3300046512 Bacteria 1738
540 Ga0495616_0022804 3300046513 Bacteria 3376
541 Ga0495618_0127207 3300046514 Bacteria 1631
542 Ga0495628_0213846 3300046516 Bacteria 1449
543 Ga0495632_0047640 3300046519 Bacteria 2125
544 Ga0495643_0016911 3300046522 Bacteria 4276
545 Ga0495663_0133587 3300046525 Bacteria 838
546 Ga0495652_0051987 3300046529 Bacteria 3496
547 Ga0495652_0082658 3300046529 Bacteria 2646
548 Ga0495665_0040266 3300046531 Bacteria 2488
549 Ga0495640_0086184 3300046533 Bacteria 2080
550 Ga0495640_0184823 3300046533 Bacteria 1327
551 Ga0495587_0007000 3300046536 Bacteria 7324
552 Ga0495645_0006870 3300046543 Bacteria 7914
553 Ga0495645_0310906 3300046543 Bacteria 1026
554 Ga0495667_0077662 3300046559 Bacteria 2159
555 Ga0495667_0097084 3300046559 Bacteria 1907
556 Ga0495656_0125549 3300046615 Bacteria 1216
557 Ga0495668_0001101 3300046616 Bacteria 27963
558 Ga0495625_0013865 3300046660 Bacteria 6454
559 Ga0495635_0021684 3300046663 Bacteria 4477
560 Ga0495635_0126640 3300046663 Bacteria 1742
561 Ga0495657_0010621 3300046675 Bacteria 6923
562 Ga0495657_0015043 3300046675 Bacteria 5673
563 Ga0495599_0006872 3300046678 Bacteria 6878
564 Ga0495623_0018805 3300046679 Bacteria 4461
565 Ga0495646_0016845 3300046680 Bacteria 4642
566 Ga0495646_0149837 3300046680 Bacteria 1298
567 Ga0495613_0016833 3300046689 Bacteria 5444
568 Ga0495649_0071044 3300046694 Bacteria 1866
569 Ga0495600_0047099 3300046809 Bacteria 2812
570 Ga0495600_0065746 3300046809 Bacteria 2371
571 Ga0495660_0062291 3300046810 Bacteria 2000
572 Ga0495604_0096772 3300047317 Bacteria 2177
573 Ga0495674_0013405 3300047319 Bacteria 7708
574 Ga0495674_0123162 3300047319 Bacteria 2189
575 Ga0495674_0329783 3300047319 Bacteria 1242
576 Ga0495674_0462697 3300047319 Bacteria 1018
577 Ga0495672_0075268 3300047320 Bacteria 1899
578 Ga0495676_0167043 3300047321 Bacteria 1551
579 Ga0495680_0021973 3300047322 Bacteria 5331
580 Ga0495680_0210505 3300047322 Bacteria 1392
581 Ga0495683_0029465 3300047323 Bacteria 2805
582 Ga0495687_010327 3300047443 Bacteria 5127
583 Ga0495675_0049058 3300047444 Bacteria 2684
584 Ga0495673_0084838 3300047469 Bacteria 1305
585 Ga0495681_0078036 3300047470 Bacteria 1485
586 Ga0495684_0121074 3300047471 Bacteria 1971
587 Ga0495684_0149015 3300047471 Bacteria 1750
588 Ga0495684_0207408 3300047471 Bacteria 1442
589 Ga0495684_0227616 3300047471 Bacteria 1365
590 Ga0495686_0140108 3300047472 Bacteria 1427
591 Ga0495686_0215674 3300047472 Bacteria 1094
592 Ga0495602_0028107 3300048088 Bacteria 5388
593 Ga0495602_0097429 3300048088 Bacteria 2423
594 Ga0496100_0057306 3300048903 Bacteria 2552
595 Ga0496101_0176843 3300048904 Bacteria 1642
596 Ga0496102_0192024 3300048905 Bacteria 1924
597 Ga0496102_0762140 3300048905 Bacteria 890
598 Ga0496103_0010626 3300048906 Bacteria 5447
599 Ga0496103_0322149 3300048906 Bacteria 994
600 Ga0496104_0007046 3300048907 Bacteria 9917
601 Ga0496104_0065930 3300048907 Bacteria 3437
602 Ga0496105_0036422 3300048908 Bacteria 4053
603 Ga0496106_0120985 3300048909 Bacteria 2046
604 Ga0496107_0033786 3300048910 Bacteria 3661
605 Ga0496108_0016114 3300048911 Bacteria 6093
606 Ga0496108_0144852 3300048911 Bacteria 2048
607 Ga0496110_0351660 3300048913 Bacteria 1342
608 Ga0496112_0002373 3300048915 Bacteria 15134
609 Ga0496113_0020912 3300048916 Bacteria 4609
610 Ga0496113_0199527 3300048916 Bacteria 1590
611 Ga0496113_0367327 3300048916 Bacteria 1155
612 Ga0496114_0040228 3300048917 Bacteria 3869
613 Ga0496114_0386199 3300048917 Bacteria 1240
614 Ga0496115_0129572 3300048918 Bacteria 2079
615 Ga0496118_0012072 3300048921 Bacteria 8339
616 Ga0496118_0197443 3300048921 Bacteria 1196
617 Ga0496119_0006959 3300048922 Bacteria 10317
618 Ga0496119_0026724 3300048922 Bacteria 3992
619 Ga0496119_0039745 3300048922 Bacteria 3020
620 Ga0496120_0000916 3300048923 Bacteria 41045
621 Ga0496121_0072782 3300048924 Bacteria 2758
622 Ga0496122_0003953 3300048925 Bacteria 18940
623 Ga0496122_0137941 3300048925 Bacteria 1533
624 Ga0496123_0003147 3300048926 Bacteria 18908
625 Ga0496124_0000034 3300048927 Bacteria 325332
626 Ga0496124_0019770 3300048927 Bacteria 6251
627 Ga0496125_0014710 3300048928 Bacteria 7605
628 Ga0496125_0033784 3300048928 Bacteria 4519
629 Ga0496125_0116963 3300048928 Bacteria 1913
630 Ga0496126_0016188 3300048929 Bacteria 7469
631 Ga0496126_0016541 3300048929 Bacteria 7373
632 Ga0496126_0172050 3300048929 Bacteria 1844
633 Ga0501031_0573022 3300049568 Bacteria 727
634 Ga0501033_0002244 3300049570 Bacteria 16561
635 Ga0501034_0000263 3300049571 Bacteria 95188
636 Ga0501034_0007533 3300049571 Bacteria 11582
637 Ga0501034_0037555 3300049571 Bacteria 4904
638 Ga0501034_0102152 3300049571 Bacteria 2860
639 Ga0501034_0116035 3300049571 Bacteria 2666
640 Ga0501034_0616297 3300049571 Bacteria 989
641 Ga0501036_0014560 3300049572 Bacteria 6549
642 Ga0501037_0008717 3300049573 Bacteria 7434
643 Ga0501037_0022763 3300049573 Bacteria 4633
644 Ga0501038_0003645 3300049574 Bacteria 14346
645 Ga0501038_0028147 3300049574 Bacteria 4993
646 Ga0501038_0696976 3300049574 Bacteria 761
647 Ga0501039_0008739 3300049575 Bacteria 7715
648 Ga0501043_0000689 3300049579 Bacteria 29829
649 Ga0501043_0073269 3300049579 Bacteria 2690
650 Ga0501046_0001447 3300049580 Bacteria 22837
651 Ga0501047_0007684 3300049581 Bacteria 10156
652 Ga0501047_0010031 3300049581 Bacteria 8955
653 Ga0501047_0018738 3300049581 Bacteria 6637
654 Ga0501047_0409890 3300049581 Bacteria 1188
655 Ga0501048_0077439 3300049582 Bacteria 2347
656 Ga0501067_0007614 3300049583 Bacteria 6021
657 Ga0501067_0071905 3300049583 Bacteria 1916
658 Ga0501067_0074445 3300049583 Bacteria 1882
659 Ga0501067_0183855 3300049583 Bacteria 1164
660 Ga0501068_0123383 3300049584 Bacteria 1616
661 Ga0501069_0003590 3300049585 Bacteria 7992
662 Ga0501069_0006085 3300049585 Bacteria 6297
663 Ga0501069_0093871 3300049585 Bacteria 1698
664 Ga0501069_0164499 3300049585 Bacteria 1278
665 Ga0501069_0186929 3300049585 Bacteria 1198
666 Ga0501070_0000303 3300049586 Bacteria 45531
667 Ga0501070_0000863 3300049586 Bacteria 27570
668 Ga0501070_0003662 3300049586 Bacteria 13287
669 Ga0501070_0016136 3300049586 Bacteria 6278
670 Ga0501070_0025376 3300049586 Bacteria 4971
671 Ga0501070_0027609 3300049586 Bacteria 4761
672 Ga0501070_0038282 3300049586 Bacteria 4001
673 Ga0501070_0166202 3300049586 Bacteria 1818
674 Ga0501070_0221578 3300049586 Bacteria 1551
675 Ga0501070_0677498 3300049586 Bacteria 817
676 Ga0501071_0024633 3300049587 Bacteria 4209
677 Ga0501071_0604631 3300049587 Bacteria 843
678 Ga0501072_0031522 3300049588 Bacteria 4151
679 Ga0501072_0420950 3300049588 Bacteria 1059
680 Ga0501073_0009019 3300049589 Bacteria 7364
681 Ga0501073_0020690 3300049589 Bacteria 4745
682 Ga0501073_0035055 3300049589 Bacteria 3567
683 Ga0501073_0059897 3300049589 Bacteria 2658
684 Ga0501073_0060865 3300049589 Bacteria 2635
685 Ga0501073_0064940 3300049589 Bacteria 2545
686 Ga0501074_0005155 3300049590 Bacteria 9391
687 Ga0501074_0008058 3300049590 Bacteria 7631
688 Ga0501074_0025665 3300049590 Bacteria 4276
689 Ga0501074_0033086 3300049590 Bacteria 3747
690 Ga0501076_0350172 3300049592 Bacteria 1213
691 Ga0501225_0000850 3300049705 Bacteria 9490
692 Ga0501080_0008404 3300049742 Bacteria 9350
693 Ga0501080_0010871 3300049742 Bacteria 8330
694 Ga0501080_0012404 3300049742 Bacteria 7814
695 Ga0501080_0033617 3300049742 Bacteria 4786
696 Ga0501080_0048684 3300049742 Bacteria 3944
697 Ga0501080_0076514 3300049742 Bacteria 3112
698 Ga0501080_0076953 3300049742 Bacteria 3102
699 Ga0501080_0103490 3300049742 Bacteria 2640
700 Ga0501083_0005937 3300049744 Bacteria 8643
701 Ga0501083_0014713 3300049744 Bacteria 5470
702 Ga0501083_0023242 3300049744 Bacteria 4301
703 Ga0501083_0046820 3300049744 Bacteria 2924
704 Ga0501083_0391063 3300049744 Bacteria 904
705 Ga0501035_0000967 3300049822 Bacteria 30354
706 Ga0501035_0005003 3300049822 Bacteria 12557
707 Ga0501035_0012944 3300049822 Bacteria 7700
708 Ga0501035_0040699 3300049822 Bacteria 4198
709 Ga0501035_0075613 3300049822 Bacteria 2979
710 Ga0501035_0098427 3300049822 Bacteria 2568
711 Ga0501035_0131818 3300049822 Bacteria 2178
712 Ga0501044_0010926 3300049823 Bacteria 9854
713 Ga0501044_0019704 3300049823 Bacteria 7209
714 Ga0501044_0078886 3300049823 Bacteria 3337
715 Ga0501044_0161471 3300049823 Bacteria 2217
716 Ga0501044_0211561 3300049823 Bacteria 1893
717 Ga0501044_0386404 3300049823 Bacteria 1314
718 nmdc:mga0k408_38374_c1 3300050493 Bacteria 2749
719 nmdc:mga04h51_34720_c1 3300050495 Bacteria 1613
720 nmdc:mga05p37_515375_c1 3300050507 Bacteria 1369
721 nmdc:mga08y16_1076_c1 3300050511 Bacteria 26887
722 nmdc:mga08y16_334440_c1 3300050511 Bacteria 1557
723 nmdc:mga0sz30_281768_c1 3300050516 Bacteria 741
724 Ga0495612_0078046 3300053078 Bacteria 1388
725 Ga0495595_0012714 3300053084 Bacteria 3545
726 Ga0495595_0383060 3300053084 Bacteria 712
727 Ga0495619_0372368 3300053085 Bacteria 987
728 Ga0500578_0209025 3300053086 Bacteria 1191
729 Ga0500578_0423188 3300053086 Bacteria 763
730 Ga0500646_0001896 3300053090 Bacteria 5476
731 Ga0500646_0076553 3300053090 Bacteria 1013
732 Ga0500651_0003060 3300053093 Bacteria 9046
733 Ga0500651_0132163 3300053093 Bacteria 1509
734 Ga0500641_0069236 3300053096 Bacteria 1482
735 Ga0500555_007058 3300053103 Bacteria 3194
736 Ga0500562_074214 3300053108 Bacteria 919
737 Ga0500595_004492 3300053119 Bacteria 6247
738 Ga0500642_0001139 3300053130 Bacteria 7620
739 Ga0500642_0037482 3300053130 Bacteria 2072
740 Ga0500568_0002440 3300053139 Bacteria 10940
741 Ga0500588_0001056 3300053146 Bacteria 5003
742 Ga0500616_0001156 3300053153 Bacteria 26962
743 Ga0500622_0181043 3300053156 Bacteria 974
744 Ga0500633_0103679 3300053160 Bacteria 1049
745 Ga0500609_001594 3300053731 Bacteria 3309
746 Ga0500609_009033 3300053731 Bacteria 1344
747 Ga0501084_0237376 3300054114 Bacteria 1539
748 Ga0501084_0315616 3300054114 Bacteria 1320
749 Ga0501084_0433291 3300054114 Bacteria 1111
750 Ga0501084_0847234 3300054114 Bacteria 769
751 Ga0501082_0023882 3300060353 Bacteria 5272
752 Ga0501082_0042504 3300060353 Bacteria 3918
753 Ga0501082_0390347 3300060353 Bacteria 1214
754 Ga0501082_0941721 3300060353 Bacteria 755

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_281768_c1 nmdc:mga0sz30_281768_c1_100_723 181
2 3300039438 Ga0436360_0527097 Ga0436360_0527097_1700_2386 188
3 3300039438 Ga0436360_0495490 Ga0436360_0495490_810_1472 192
4 3300054114 Ga0501084_0847234 Ga0501084_0847234_110_736 193
5 3300005434 Ga0070709_10337142 Ga0070709_103371421 198
6 3300005435 Ga0070714_100027224 Ga0070714_1000272243 198
7 3300006028 Ga0070717_10058335 Ga0070717_100583353 198
8 3300006173 Ga0070716_100247244 Ga0070716_1002472442 198
9 3300006175 Ga0070712_100120344 Ga0070712_1001203442 198
10 3300025906 Ga0207699_10031276 Ga0207699_100312763 198
11 3300025915 Ga0207693_10013217 Ga0207693_100132172 198
12 3300025929 Ga0207664_10237495 Ga0207664_102374952 198
13 3300035172 Ga0373955_0036950 Ga0373955_0036950_1976_2578 198
14 3300053078 Ga0495612_0078046 Ga0495612_0078046_44_646 198
15 3300036712 Ga0316584_0115833 Ga0316584_0115833_295_960 199
16 3300031712 Ga0265342_10006958 Ga0265342_100069582 200
17 3300046475 Ga0495639_0394796 Ga0495639_0394796_12_626 202
18 3300025907 Ga0207645_10234916 Ga0207645_102349162 205
19 3300025927 Ga0207687_10247901 Ga0207687_102479012 205
20 3300031711 Ga0265314_10045935 Ga0265314_100459352 205
21 3300039437 Ga0436365_1605027 Ga0436365_1605027_381_1073 206
22 3300049574 Ga0501038_0028147 Ga0501038_0028147_785_1456 206
23 3300003762 Ga0055542_1007844 Ga0055542_10078442 207
24 3300003794 Ga0055531_10011784 Ga0055531_100117842 207
25 3300005441 Ga0070700_100264326 Ga0070700_1002643261 207
26 3300005445 Ga0070708_100004705 Ga0070708_1000047053 207
27 3300005459 Ga0068867_100048884 Ga0068867_1000488843 207
28 3300005467 Ga0070706_100000078 Ga0070706_10000007899 207
29 3300005518 Ga0070699_100019801 Ga0070699_1000198012 207
30 3300005536 Ga0070697_100009172 Ga0070697_1000091722 207
31 3300005718 Ga0068866_10067273 Ga0068866_100672732 207
32 3300005844 Ga0068862_100010966 Ga0068862_1000109662 207
33 3300005844 Ga0068862_100045989 Ga0068862_1000459894 207
34 3300005981 Ga0081538_10009218 Ga0081538_100092186 207
35 3300005985 Ga0081539_10147125 Ga0081539_101471252 207
36 3300006237 Ga0097621_100374135 Ga0097621_1003741352 207
37 3300006852 Ga0075433_10117007 Ga0075433_101170073 207
38 3300006881 Ga0068865_100064415 Ga0068865_1000644153 207
39 3300009094 Ga0111539_10085414 Ga0111539_100854143 207
40 3300009094 Ga0111539_10213592 Ga0111539_102135922 207
41 3300009101 Ga0105247_10549251 Ga0105247_105492511 207
42 3300009147 Ga0114129_10154214 Ga0114129_101542143 207
43 3300009177 Ga0105248_11143780 Ga0105248_111437801 207
44 3300010159 Ga0099796_10084291 Ga0099796_100842911 207
45 3300014326 Ga0157380_10521437 Ga0157380_105214371 207
46 3300014969 Ga0157376_10946608 Ga0157376_109466082 207
47 3300025254 Ga0209148_1000723 Ga0209148_100072320 207
48 3300025272 Ga0209455_1000401 Ga0209455_10004012 207
49 3300025297 Ga0209758_1000029 Ga0209758_10000298 207
50 3300025297 Ga0209758_1020203 Ga0209758_10202032 207
51 3300025298 Ga0209050_1009108 Ga0209050_10091084 207
52 3300025299 Ga0209256_1035608 Ga0209256_10356082 207
53 3300025303 Ga0209051_1030515 Ga0209051_10305152 207
54 3300025304 Ga0209257_1000549 Ga0209257_100054963 207
55 3300025304 Ga0209257_1026999 Ga0209257_10269992 207
56 3300025910 Ga0207684_10000157 Ga0207684_1000015798 207
57 3300025912 Ga0207707_10000001 Ga0207707_10000001254 207
58 3300025921 Ga0207652_10000879 Ga0207652_1000087920 207
59 3300025922 Ga0207646_10036689 Ga0207646_100366892 207
60 3300025928 Ga0207700_10052055 Ga0207700_100520554 207
61 3300025938 Ga0207704_10106974 Ga0207704_101069743 207
62 3300026075 Ga0207708_10562110 Ga0207708_105621102 207
63 3300026089 Ga0207648_10267351 Ga0207648_102673512 207
64 3300026118 Ga0207675_100065106 Ga0207675_1000651062 207
65 3300027907 Ga0207428_10001290 Ga0207428_1000129021 207
66 3300028380 Ga0268265_10009019 Ga0268265_100090193 207
67 3300028380 Ga0268265_10019872 Ga0268265_100198724 207
68 3300028800 Ga0265338_10047890 Ga0265338_100478901 207
69 3300031241 Ga0265325_10047319 Ga0265325_100473192 207
70 3300031249 Ga0265339_10000008 Ga0265339_1000000852 207
71 3300031249 Ga0265339_10015834 Ga0265339_100158343 207
72 3300031249 Ga0265339_10062706 Ga0265339_100627062 207
73 3300031251 Ga0265327_10059902 Ga0265327_100599021 207
74 3300031251 Ga0265327_10082102 Ga0265327_100821022 207
75 3300031456 Ga0307513_10156721 Ga0307513_101567212 207
76 3300031595 Ga0265313_10057889 Ga0265313_100578892 207
77 3300031616 Ga0307508_10111953 Ga0307508_101119532 207
78 3300031712 Ga0265342_10027877 Ga0265342_100278773 207
79 3300031730 Ga0307516_10096785 Ga0307516_100967852 207
80 3300031824 Ga0307413_10018790 Ga0307413_100187902 207
81 3300031911 Ga0307412_10169580 Ga0307412_101695802 207
82 3300032002 Ga0307416_100275195 Ga0307416_1002751952 207
83 3300032005 Ga0307411_10111274 Ga0307411_101112743 207
84 3300032126 Ga0307415_100799185 Ga0307415_1007991852 207
85 3300032137 Ga0316585_10023767 Ga0316585_100237672 207
86 3300035114 Ga0373939_0123995 Ga0373939_0123995_239_901 207
87 3300035692 Ga0373935_0583530 Ga0373935_0583530_98_769 207
88 3300035725 Ga0373947_0184747 Ga0373947_0184747_455_1126 207
89 3300037068 Ga0373925_0106863 Ga0373925_0106863_640_1311 207
90 3300039438 Ga0436360_0120062 Ga0436360_0120062_42_713 207
91 3300042001 Ga0439441_048167 Ga0439441_048167_163_837 207
92 3300046454 Ga0495592_0264513 Ga0495592_0264513_290_961 207
93 3300046531 Ga0495665_0040266 Ga0495665_0040266_1666_2337 207
94 3300047320 Ga0495672_0075268 Ga0495672_0075268_142_816 207
95 3300047472 Ga0495686_0215674 Ga0495686_0215674_34_708 207
96 3300049570 Ga0501033_0002244 Ga0501033_0002244_518_1192 207
97 3300049571 Ga0501034_0007533 Ga0501034_0007533_3310_3972 207
98 3300049571 Ga0501034_0037555 Ga0501034_0037555_494_1168 207
99 3300049571 Ga0501034_0116035 Ga0501034_0116035_1318_1992 207
100 3300049571 Ga0501034_0616297 Ga0501034_0616297_165_959 207
101 3300049572 Ga0501036_0014560 Ga0501036_0014560_2190_2864 207
102 3300049573 Ga0501037_0008717 Ga0501037_0008717_6531_7205 207
103 3300049574 Ga0501038_0003645 Ga0501038_0003645_9097_9771 207
104 3300049575 Ga0501039_0008739 Ga0501039_0008739_3080_3754 207
105 3300049579 Ga0501043_0000689 Ga0501043_0000689_20126_20800 207
106 3300049579 Ga0501043_0073269 Ga0501043_0073269_1432_2106 207
107 3300049580 Ga0501046_0001447 Ga0501046_0001447_3839_4513 207
108 3300049581 Ga0501047_0007684 Ga0501047_0007684_5370_6203 207
109 3300049581 Ga0501047_0409890 Ga0501047_0409890_35_709 207
110 3300049582 Ga0501048_0077439 Ga0501048_0077439_1062_1736 207
111 3300049583 Ga0501067_0007614 Ga0501067_0007614_1107_1781 207
112 3300049583 Ga0501067_0074445 Ga0501067_0074445_375_1208 207
113 3300049584 Ga0501068_0123383 Ga0501068_0123383_684_1358 207
114 3300049585 Ga0501069_0003590 Ga0501069_0003590_5951_6625 207
115 3300049585 Ga0501069_0186929 Ga0501069_0186929_63_737 207
116 3300049587 Ga0501071_0604631 Ga0501071_0604631_76_750 207
117 3300049588 Ga0501072_0031522 Ga0501072_0031522_3372_4046 207
118 3300049588 Ga0501072_0420950 Ga0501072_0420950_329_991 207
119 3300049589 Ga0501073_0020690 Ga0501073_0020690_3971_4645 207
120 3300049589 Ga0501073_0035055 Ga0501073_0035055_2399_3232 207
121 3300049589 Ga0501073_0059897 Ga0501073_0059897_565_1239 207
122 3300049590 Ga0501074_0005155 Ga0501074_0005155_2196_2870 207
123 3300049592 Ga0501076_0350172 Ga0501076_0350172_277_951 207
124 3300049742 Ga0501080_0048684 Ga0501080_0048684_1408_2082 207
125 3300049742 Ga0501080_0076514 Ga0501080_0076514_2074_2907 207
126 3300049742 Ga0501080_0076953 Ga0501080_0076953_1060_1734 207
127 3300049742 Ga0501080_0103490 Ga0501080_0103490_274_1074 207
128 3300049744 Ga0501083_0023242 Ga0501083_0023242_186_1019 207
129 3300049744 Ga0501083_0046820 Ga0501083_0046820_220_894 207
130 3300049744 Ga0501083_0391063 Ga0501083_0391063_212_886 207
131 3300049822 Ga0501035_0012944 Ga0501035_0012944_3059_3733 207
132 3300049822 Ga0501035_0075613 Ga0501035_0075613_402_1076 207
133 3300049822 Ga0501035_0098427 Ga0501035_0098427_1419_2174 207
134 3300049823 Ga0501044_0010926 Ga0501044_0010926_2731_3405 207
135 3300049823 Ga0501044_0078886 Ga0501044_0078886_1726_2400 207
136 3300050511 nmdc:mga08y16_1076_c1 nmdc:mga08y16_1076_c1_20195_20869 207
137 3300050511 nmdc:mga08y16_334440_c1 nmdc:mga08y16_334440_c1_214_888 207
138 3300053086 Ga0500578_0423188 Ga0500578_0423188_72_746 207
139 3300053093 Ga0500651_0132163 Ga0500651_0132163_763_1437 207
140 3300053096 Ga0500641_0069236 Ga0500641_0069236_64_738 207
141 3300053103 Ga0500555_007058 Ga0500555_007058_391_1083 207
142 3300053119 Ga0500595_004492 Ga0500595_004492_4727_5401 207
143 3300053146 Ga0500588_0001056 Ga0500588_0001056_2084_2758 207
144 3300053153 Ga0500616_0001156 Ga0500616_0001156_2080_2754 207
145 3300053156 Ga0500622_0181043 Ga0500622_0181043_107_781 207
146 3300053731 Ga0500609_009033 Ga0500609_009033_40_714 207
147 3300054114 Ga0501084_0237376 Ga0501084_0237376_101_934 207
148 3300054114 Ga0501084_0315616 Ga0501084_0315616_546_1220 207
149 3300054114 Ga0501084_0433291 Ga0501084_0433291_79_753 207
150 3300060353 Ga0501082_0042504 Ga0501082_0042504_2207_3040 207
151 3300060353 Ga0501082_0390347 Ga0501082_0390347_181_855 207
152 3300060353 Ga0501082_0941721 Ga0501082_0941721_50_712 207
153 3300006846 Ga0075430_100361430 Ga0075430_1003614302 208
154 3300006847 Ga0075431_100209105 Ga0075431_1002091052 208
155 3300030522 Ga0307512_10244802 Ga0307512_102448021 208
156 3300031901 Ga0307406_10377367 Ga0307406_103773672 208
157 3300045051 Ga0451576_0512494 Ga0451576_0512494_93_755 208
158 3300053090 Ga0500646_0076553 Ga0500646_0076553_310_987 208
159 3300053108 Ga0500562_074214 Ga0500562_074214_47_724 208
160 3300053130 Ga0500642_0001139 Ga0500642_0001139_5577_6254 208
161 3300053130 Ga0500642_0037482 Ga0500642_0037482_188_865 208
162 3300053139 Ga0500568_0002440 Ga0500568_0002440_8775_9452 208
163 3300053160 Ga0500633_0103679 Ga0500633_0103679_261_938 208
164 3300053731 Ga0500609_001594 Ga0500609_001594_2426_3103 208
165 3300001904 JGI24736J21556_1007878 JGI24736J21556_10078783 209
166 3300001915 JGI24741J21665_1001461 JGI24741J21665_10014612 209
167 3300001915 JGI24741J21665_1001635 JGI24741J21665_10016354 209
168 3300001915 JGI24741J21665_1018071 JGI24741J21665_10180712 209
169 3300001979 JGI24740J21852_10000218 JGI24740J21852_1000021823 209
170 3300001979 JGI24740J21852_10000952 JGI24740J21852_100009522 209
171 3300001979 JGI24740J21852_10042802 JGI24740J21852_100428021 209
172 3300003215 JGI25153J46596_10001011 JGI25153J46596_1000101117 209
173 3300003771 Ga0055526_1029522 Ga0055526_10295221 209
174 3300003794 Ga0055531_10012303 Ga0055531_100123034 209
175 3300004803 Ga0058862_12839795 Ga0058862_128397952 209
176 3300005327 Ga0070658_10005847 Ga0070658_100058479 209
177 3300005329 Ga0070683_100059060 Ga0070683_1000590602 209
178 3300005329 Ga0070683_100090405 Ga0070683_1000904053 209
179 3300005336 Ga0070680_100002370 Ga0070680_10000237010 209
180 3300005336 Ga0070680_100006137 Ga0070680_1000061378 209
181 3300005337 Ga0070682_100012978 Ga0070682_1000129783 209
182 3300005337 Ga0070682_100030283 Ga0070682_1000302831 209
183 3300005339 Ga0070660_100105114 Ga0070660_1001051142 209
184 3300005339 Ga0070660_100153544 Ga0070660_1001535442 209
185 3300005341 Ga0070691_10000192 Ga0070691_1000019211 209
186 3300005341 Ga0070691_10105392 Ga0070691_101053922 209
187 3300005344 Ga0070661_100008590 Ga0070661_1000085905 209
188 3300005344 Ga0070661_100062142 Ga0070661_1000621423 209
189 3300005344 Ga0070661_100062792 Ga0070661_1000627923 209
190 3300005345 Ga0070692_10000140 Ga0070692_1000014011 209
191 3300005345 Ga0070692_10075286 Ga0070692_100752861 209
192 3300005347 Ga0070668_100013534 Ga0070668_1000135344 209
193 3300005355 Ga0070671_100012619 Ga0070671_1000126191 209
194 3300005367 Ga0070667_100071236 Ga0070667_1000712364 209
195 3300005436 Ga0070713_100008932 Ga0070713_1000089324 209
196 3300005436 Ga0070713_100337264 Ga0070713_1003372641 209
197 3300005436 Ga0070713_100928042 Ga0070713_1009280421 209
198 3300005437 Ga0070710_10115171 Ga0070710_101151712 209
199 3300005440 Ga0070705_100236541 Ga0070705_1002365412 209
200 3300005455 Ga0070663_100051357 Ga0070663_1000513572 209
201 3300005455 Ga0070663_100205801 Ga0070663_1002058011 209
202 3300005456 Ga0070678_100021861 Ga0070678_1000218612 209
203 3300005457 Ga0070662_100049987 Ga0070662_1000499873 209
204 3300005458 Ga0070681_10002172 Ga0070681_1000217213 209
205 3300005458 Ga0070681_10003218 Ga0070681_100032189 209
206 3300005458 Ga0070681_10026450 Ga0070681_100264504 209
207 3300005458 Ga0070681_10065692 Ga0070681_100656922 209
208 3300005467 Ga0070706_100093691 Ga0070706_1000936913 209
209 3300005467 Ga0070706_100241398 Ga0070706_1002413982 209
210 3300005468 Ga0070707_100407371 Ga0070707_1004073712 209
211 3300005471 Ga0070698_100099465 Ga0070698_1000994654 209
212 3300005518 Ga0070699_100135906 Ga0070699_1001359062 209
213 3300005518 Ga0070699_100169212 Ga0070699_1001692122 209
214 3300005530 Ga0070679_100000921 Ga0070679_10000092116 209
215 3300005530 Ga0070679_100001059 Ga0070679_10000105914 209
216 3300005530 Ga0070679_100031516 Ga0070679_1000315163 209
217 3300005530 Ga0070679_100119971 Ga0070679_1001199711 209
218 3300005535 Ga0070684_100080002 Ga0070684_1000800024 209
219 3300005535 Ga0070684_100083930 Ga0070684_1000839304 209
220 3300005535 Ga0070684_100200333 Ga0070684_1002003332 209
221 3300005539 Ga0068853_100018102 Ga0068853_1000181024 209
222 3300005539 Ga0068853_100089986 Ga0068853_1000899862 209
223 3300005539 Ga0068853_100114077 Ga0068853_1001140772 209
224 3300005546 Ga0070696_100060833 Ga0070696_1000608334 209
225 3300005547 Ga0070693_100074101 Ga0070693_1000741012 209
226 3300005548 Ga0070665_100013951 Ga0070665_1000139513 209
227 3300005548 Ga0070665_100394469 Ga0070665_1003944692 209
228 3300005563 Ga0068855_100005890 Ga0068855_1000058904 209
229 3300005563 Ga0068855_100425079 Ga0068855_1004250791 209
230 3300005563 Ga0068855_100481229 Ga0068855_1004812292 209
231 3300005564 Ga0070664_100068179 Ga0070664_1000681791 209
232 3300005564 Ga0070664_100187272 Ga0070664_1001872722 209
233 3300005577 Ga0068857_100060138 Ga0068857_1000601382 209
234 3300005577 Ga0068857_100111168 Ga0068857_1001111682 209
235 3300005578 Ga0068854_100015268 Ga0068854_1000152682 209
236 3300005578 Ga0068854_100022402 Ga0068854_1000224024 209
237 3300005578 Ga0068854_100077711 Ga0068854_1000777112 209
238 3300005578 Ga0068854_100113938 Ga0068854_1001139382 209
239 3300005614 Ga0068856_100020297 Ga0068856_1000202975 209
240 3300005614 Ga0068856_100180940 Ga0068856_1001809402 209
241 3300005616 Ga0068852_100003635 Ga0068852_1000036359 209
242 3300005616 Ga0068852_100018449 Ga0068852_1000184491 209
243 3300005616 Ga0068852_100022939 Ga0068852_1000229396 209
244 3300005842 Ga0068858_100190109 Ga0068858_1001901092 209
245 3300005843 Ga0068860_100426764 Ga0068860_1004267641 209
246 3300006042 Ga0075368_10079823 Ga0075368_100798231 209
247 3300006048 Ga0075363_100005558 Ga0075363_1000055582 209
248 3300006175 Ga0070712_100116737 Ga0070712_1001167372 209
249 3300006353 Ga0075370_10009559 Ga0075370_100095595 209
250 3300009093 Ga0105240_10001510 Ga0105240_100015106 209
251 3300009093 Ga0105240_10197172 Ga0105240_101971724 209
252 3300009093 Ga0105240_10580077 Ga0105240_105800772 209
253 3300009093 Ga0105240_10884576 Ga0105240_108845762 209
254 3300009094 Ga0111539_10270444 Ga0111539_102704442 209
255 3300009098 Ga0105245_10043644 Ga0105245_100436442 209
256 3300009098 Ga0105245_10188069 Ga0105245_101880692 209
257 3300009101 Ga0105247_10037319 Ga0105247_100373192 209
258 3300009147 Ga0114129_10259074 Ga0114129_102590742 209
259 3300009148 Ga0105243_10558462 Ga0105243_105584621 209
260 3300009174 Ga0105241_10054323 Ga0105241_100543234 209
261 3300009174 Ga0105241_10155914 Ga0105241_101559142 209
262 3300009176 Ga0105242_10126845 Ga0105242_101268452 209
263 3300009177 Ga0105248_10007217 Ga0105248_1000721714 209
264 3300009177 Ga0105248_11353140 Ga0105248_113531401 209
265 3300009545 Ga0105237_10001757 Ga0105237_1000175722 209
266 3300009545 Ga0105237_10798105 Ga0105237_107981052 209
267 3300009551 Ga0105238_10001945 Ga0105238_100019457 209
268 3300009551 Ga0105238_10064580 Ga0105238_100645805 209
269 3300010375 Ga0105239_10048904 Ga0105239_100489041 209
270 3300010375 Ga0105239_10205533 Ga0105239_102055332 209
271 3300010375 Ga0105239_10746415 Ga0105239_107464152 209
272 3300011119 Ga0105246_10003166 Ga0105246_100031669 209
273 3300011119 Ga0105246_10076483 Ga0105246_100764832 209
274 3300013102 Ga0157371_10066479 Ga0157371_100664792 209
275 3300013102 Ga0157371_10081128 Ga0157371_100811282 209
276 3300013102 Ga0157371_10207666 Ga0157371_102076662 209
277 3300013104 Ga0157370_10002287 Ga0157370_1000228711 209
278 3300013104 Ga0157370_10051198 Ga0157370_100511982 209
279 3300013104 Ga0157370_10172926 Ga0157370_101729262 209
280 3300013105 Ga0157369_10012731 Ga0157369_100127316 209
281 3300013105 Ga0157369_10152727 Ga0157369_101527274 209
282 3300013105 Ga0157369_10285615 Ga0157369_102856153 209
283 3300013105 Ga0157369_10487804 Ga0157369_104878042 209
284 3300013297 Ga0157378_10694609 Ga0157378_106946092 209
285 3300013297 Ga0157378_10889484 Ga0157378_108894841 209
286 3300013306 Ga0163162_10318699 Ga0163162_103186993 209
287 3300013307 Ga0157372_10006467 Ga0157372_100064672 209
288 3300013307 Ga0157372_10016224 Ga0157372_100162242 209
289 3300013307 Ga0157372_10040855 Ga0157372_100408551 209
290 3300014325 Ga0163163_10004832 Ga0163163_100048324 209
291 3300014325 Ga0163163_10041829 Ga0163163_100418296 209
292 3300014745 Ga0157377_10370863 Ga0157377_103708632 209
293 3300014968 Ga0157379_10669230 Ga0157379_106692302 209
294 3300020069 Ga0197907_10554686 Ga0197907_105546862 209
295 3300020070 Ga0206356_10126730 Ga0206356_101267302 209
296 3300020070 Ga0206356_11225299 Ga0206356_112252992 209
297 3300020076 Ga0206355_1250981 Ga0206355_12509812 209
298 3300020077 Ga0206351_10305709 Ga0206351_103057093 209
299 3300020080 Ga0206350_10835923 Ga0206350_108359232 209
300 3300020081 Ga0206354_10204110 Ga0206354_102041104 209
301 3300020081 Ga0206354_10880630 Ga0206354_108806302 209
302 3300020082 Ga0206353_10150174 Ga0206353_101501746 209
303 3300020082 Ga0206353_10254288 Ga0206353_102542882 209
304 3300020610 Ga0154015_1491307 Ga0154015_14913072 209
305 3300025291 Ga0209675_1004324 Ga0209675_10043242 209
306 3300025295 Ga0209564_1016660 Ga0209564_10166603 209
307 3300025297 Ga0209758_1000011 Ga0209758_1000011723 209
308 3300025304 Ga0209257_1001093 Ga0209257_100109341 209
309 3300025304 Ga0209257_1011604 Ga0209257_10116044 209
310 3300025315 Ga0207697_10149171 Ga0207697_101491711 209
311 3300025321 Ga0207656_10006407 Ga0207656_100064072 209
312 3300025900 Ga0207710_10084974 Ga0207710_100849742 209
313 3300025903 Ga0207680_10000001 Ga0207680_10000001624 209
314 3300025904 Ga0207647_10000224 Ga0207647_1000022425 209
315 3300025904 Ga0207647_10001467 Ga0207647_100014679 209
316 3300025904 Ga0207647_10002765 Ga0207647_100027654 209
317 3300025904 Ga0207647_10144961 Ga0207647_101449613 209
318 3300025909 Ga0207705_10000198 Ga0207705_1000019813 209
319 3300025909 Ga0207705_10009476 Ga0207705_100094764 209
320 3300025909 Ga0207705_10027594 Ga0207705_100275944 209
321 3300025910 Ga0207684_10094538 Ga0207684_100945383 209
322 3300025910 Ga0207684_10188705 Ga0207684_101887052 209
323 3300025911 Ga0207654_10167856 Ga0207654_101678562 209
324 3300025912 Ga0207707_10000020 Ga0207707_1000002087 209
325 3300025912 Ga0207707_10000319 Ga0207707_1000031913 209
326 3300025912 Ga0207707_10000512 Ga0207707_1000051224 209
327 3300025912 Ga0207707_10000792 Ga0207707_1000079232 209
328 3300025912 Ga0207707_10000976 Ga0207707_1000097622 209
329 3300025912 Ga0207707_10010022 Ga0207707_100100224 209
330 3300025912 Ga0207707_10081753 Ga0207707_100817534 209
331 3300025913 Ga0207695_10000163 Ga0207695_10000163139 209
332 3300025913 Ga0207695_10003007 Ga0207695_1000300710 209
333 3300025913 Ga0207695_10077679 Ga0207695_100776795 209
334 3300025913 Ga0207695_10110662 Ga0207695_101106623 209
335 3300025913 Ga0207695_10578113 Ga0207695_105781131 209
336 3300025914 Ga0207671_10001718 Ga0207671_100017189 209
337 3300025917 Ga0207660_10001995 Ga0207660_100019955 209
338 3300025917 Ga0207660_10005591 Ga0207660_100055917 209
339 3300025917 Ga0207660_10006586 Ga0207660_100065865 209
340 3300025917 Ga0207660_10011098 Ga0207660_100110984 209
341 3300025917 Ga0207660_10042529 Ga0207660_100425292 209
342 3300025917 Ga0207660_10046282 Ga0207660_100462822 209
343 3300025919 Ga0207657_10014555 Ga0207657_100145554 209
344 3300025919 Ga0207657_10016071 Ga0207657_100160714 209
345 3300025919 Ga0207657_10058709 Ga0207657_100587094 209
346 3300025919 Ga0207657_10068787 Ga0207657_100687874 209
347 3300025919 Ga0207657_10196848 Ga0207657_101968482 209
348 3300025920 Ga0207649_10002249 Ga0207649_1000224911 209
349 3300025920 Ga0207649_10008623 Ga0207649_100086237 209
350 3300025920 Ga0207649_10028900 Ga0207649_100289004 209
351 3300025920 Ga0207649_10059101 Ga0207649_100591013 209
352 3300025920 Ga0207649_10085744 Ga0207649_100857442 209
353 3300025921 Ga0207652_10000037 Ga0207652_1000003738 209
354 3300025921 Ga0207652_10000490 Ga0207652_1000049014 209
355 3300025921 Ga0207652_10000548 Ga0207652_1000054812 209
356 3300025921 Ga0207652_10011649 Ga0207652_100116494 209
357 3300025921 Ga0207652_10016592 Ga0207652_100165923 209
358 3300025921 Ga0207652_10064934 Ga0207652_100649345 209
359 3300025928 Ga0207700_10335155 Ga0207700_103351552 209
360 3300025932 Ga0207690_10017142 Ga0207690_100171422 209
361 3300025932 Ga0207690_10040891 Ga0207690_100408912 209
362 3300025932 Ga0207690_10112866 Ga0207690_101128662 209
363 3300025933 Ga0207706_10064955 Ga0207706_100649551 209
364 3300025935 Ga0207709_10403152 Ga0207709_104031522 209
365 3300025941 Ga0207711_10525427 Ga0207711_105254272 209
366 3300025944 Ga0207661_10045493 Ga0207661_100454934 209
367 3300025944 Ga0207661_10052825 Ga0207661_100528251 209
368 3300025945 Ga0207679_10127387 Ga0207679_101273872 209
369 3300025949 Ga0207667_10003741 Ga0207667_1000374120 209
370 3300025949 Ga0207667_10004107 Ga0207667_100041074 209
371 3300025949 Ga0207667_10004852 Ga0207667_1000485216 209
372 3300025949 Ga0207667_10006666 Ga0207667_100066663 209
373 3300025949 Ga0207667_10013127 Ga0207667_100131276 209
374 3300025949 Ga0207667_10663099 Ga0207667_106630992 209
375 3300025972 Ga0207668_10041421 Ga0207668_100414211 209
376 3300025981 Ga0207640_10001250 Ga0207640_1000125010 209
377 3300025981 Ga0207640_10028897 Ga0207640_100288974 209
378 3300025981 Ga0207640_10072442 Ga0207640_100724424 209
379 3300025981 Ga0207640_10075251 Ga0207640_100752512 209
380 3300025981 Ga0207640_10107066 Ga0207640_101070661 209
381 3300025986 Ga0207658_10125426 Ga0207658_101254262 209
382 3300026035 Ga0207703_10283482 Ga0207703_102834822 209
383 3300026041 Ga0207639_10000562 Ga0207639_1000056213 209
384 3300026041 Ga0207639_10018506 Ga0207639_100185066 209
385 3300026041 Ga0207639_10031301 Ga0207639_100313012 209
386 3300026041 Ga0207639_10766995 Ga0207639_107669952 209
387 3300026067 Ga0207678_10011828 Ga0207678_100118284 209
388 3300026067 Ga0207678_10022764 Ga0207678_100227642 209
389 3300026067 Ga0207678_10036855 Ga0207678_100368554 209
390 3300026067 Ga0207678_10054937 Ga0207678_100549374 209
391 3300026067 Ga0207678_10125519 Ga0207678_101255192 209
392 3300026078 Ga0207702_10005433 Ga0207702_100054337 209
393 3300026078 Ga0207702_10016316 Ga0207702_100163165 209
394 3300026078 Ga0207702_10613363 Ga0207702_106133631 209
395 3300026116 Ga0207674_10018087 Ga0207674_100180874 209
396 3300026116 Ga0207674_10018959 Ga0207674_100189594 209
397 3300026116 Ga0207674_10038080 Ga0207674_100380804 209
398 3300026116 Ga0207674_10040967 Ga0207674_100409676 209
399 3300026116 Ga0207674_10237670 Ga0207674_102376702 209
400 3300026121 Ga0207683_10027978 Ga0207683_100279783 209
401 3300026121 Ga0207683_10096611 Ga0207683_100966112 209
402 3300026142 Ga0207698_10000506 Ga0207698_100005062 209
403 3300026142 Ga0207698_10002967 Ga0207698_1000296710 209
404 3300026142 Ga0207698_10010590 Ga0207698_100105904 209
405 3300026142 Ga0207698_10345253 Ga0207698_103452532 209
406 3300028379 Ga0268266_10683160 Ga0268266_106831601 209
407 3300028381 Ga0268264_10376019 Ga0268264_103760192 209
408 3300031235 Ga0265330_10008931 Ga0265330_100089313 209
409 3300031240 Ga0265320_10053712 Ga0265320_100537122 209
410 3300031242 Ga0265329_10001600 Ga0265329_100016002 209
411 3300031249 Ga0265339_10005817 Ga0265339_100058174 209
412 3300031344 Ga0265316_10000203 Ga0265316_1000020331 209
413 3300031548 Ga0307408_100609602 Ga0307408_1006096022 209
414 3300031711 Ga0265314_10029023 Ga0265314_100290234 209
415 3300031712 Ga0265342_10000221 Ga0265342_1000022135 209
416 3300032126 Ga0307415_101157536 Ga0307415_1011575361 209
417 3300033180 Ga0307510_10000164 Ga0307510_1000016439 209
418 3300033180 Ga0307510_10046569 Ga0307510_100465695 209
419 3300035117 Ga0373953_0236075 Ga0373953_0236075_81_752 209
420 3300035119 Ga0373956_0117423 Ga0373956_0117423_557_1228 209
421 3300035120 Ga0373957_0120440 Ga0373957_0120440_324_995 209
422 3300035170 Ga0373943_0034559 Ga0373943_0034559_342_1013 209
423 3300035172 Ga0373955_0125170 Ga0373955_0125170_109_786 209
424 3300035691 Ga0373931_0449046 Ga0373931_0449046_22_699 209
425 3300035695 Ga0373927_0069172 Ga0373927_0069172_641_1312 209
426 3300035725 Ga0373947_0204717 Ga0373947_0204717_150_821 209
427 3300036401 Ga0373937_0013933 Ga0373937_0013933_949_1620 209
428 3300036712 Ga0316584_0321335 Ga0316584_0321335_346_1014 209
429 3300037068 Ga0373925_0025732 Ga0373925_0025732_1937_2608 209
430 3300037068 Ga0373925_0415187 Ga0373925_0415187_77_754 209
431 3300037312 Ga0395899_0015110 Ga0395899_0015110_145_819 209
432 3300037312 Ga0395899_0126232 Ga0395899_0126232_700_1368 209
433 3300037418 Ga0395900_0094482 Ga0395900_0094482_1260_1934 209
434 3300037418 Ga0395900_0558630 Ga0395900_0558630_241_909 209
435 3300037466 Ga0395898_0134465 Ga0395898_0134465_434_1108 209
436 3300037466 Ga0395898_0207152 Ga0395898_0207152_1074_1742 209
437 3300038443 Ga0395901_0022931 Ga0395901_0022931_2799_3467 209
438 3300039438 Ga0436360_1053742 Ga0436360_1053742_215_883 209
439 3300039447 Ga0436361_0282143 Ga0436361_0282143_608_1285 209
440 3300042439 Ga0439464_0078814 Ga0439464_0078814_82_756 209
441 3300045051 Ga0451576_0205524 Ga0451576_0205524_1130_1771 209
442 3300045976 Ga0466967_1008736 Ga0466967_1008736_108_770 209
443 3300046471 Ga0495650_0000345 Ga0495650_0000345_42436_43104 209
444 3300046477 Ga0495664_0203653 Ga0495664_0203653_110_781 209
445 3300046507 Ga0495606_0312053 Ga0495606_0312053_163_831 209
446 3300046511 Ga0495608_0199974 Ga0495608_0199974_355_1092 209
447 3300046513 Ga0495616_0022804 Ga0495616_0022804_527_1264 209
448 3300046516 Ga0495628_0213846 Ga0495628_0213846_768_1439 209
449 3300046519 Ga0495632_0047640 Ga0495632_0047640_957_1694 209
450 3300046522 Ga0495643_0016911 Ga0495643_0016911_280_1017 209
451 3300046529 Ga0495652_0082658 Ga0495652_0082658_886_1557 209
452 3300046533 Ga0495640_0086184 Ga0495640_0086184_322_1059 209
453 3300046533 Ga0495640_0184823 Ga0495640_0184823_179_850 209
454 3300046543 Ga0495645_0310906 Ga0495645_0310906_121_792 209
455 3300046559 Ga0495667_0077662 Ga0495667_0077662_81_752 209
456 3300046660 Ga0495625_0013865 Ga0495625_0013865_937_1605 209
457 3300046663 Ga0495635_0021684 Ga0495635_0021684_3664_4401 209
458 3300046675 Ga0495657_0010621 Ga0495657_0010621_3305_4042 209
459 3300046680 Ga0495646_0149837 Ga0495646_0149837_229_966 209
460 3300046689 Ga0495613_0016833 Ga0495613_0016833_689_1426 209
461 3300046694 Ga0495649_0071044 Ga0495649_0071044_289_1026 209
462 3300046809 Ga0495600_0047099 Ga0495600_0047099_2024_2761 209
463 3300046810 Ga0495660_0062291 Ga0495660_0062291_667_1404 209
464 3300047319 Ga0495674_0329783 Ga0495674_0329783_489_1166 209
465 3300047321 Ga0495676_0167043 Ga0495676_0167043_442_1179 209
466 3300047322 Ga0495680_0210505 Ga0495680_0210505_696_1367 209
467 3300047323 Ga0495683_0029465 Ga0495683_0029465_995_1732 209
468 3300047443 Ga0495687_010327 Ga0495687_010327_3578_4315 209
469 3300047469 Ga0495673_0084838 Ga0495673_0084838_14_751 209
470 3300047471 Ga0495684_0149015 Ga0495684_0149015_1029_1700 209
471 3300047471 Ga0495684_0227616 Ga0495684_0227616_506_1183 209
472 3300048088 Ga0495602_0097429 Ga0495602_0097429_142_813 209
473 3300048903 Ga0496100_0057306 Ga0496100_0057306_1087_1824 209
474 3300048904 Ga0496101_0176843 Ga0496101_0176843_120_857 209
475 3300048905 Ga0496102_0192024 Ga0496102_0192024_481_1218 209
476 3300048905 Ga0496102_0762140 Ga0496102_0762140_17_691 209
477 3300048906 Ga0496103_0010626 Ga0496103_0010626_366_1103 209
478 3300048906 Ga0496103_0322149 Ga0496103_0322149_17_691 209
479 3300048907 Ga0496104_0007046 Ga0496104_0007046_3852_4589 209
480 3300048907 Ga0496104_0065930 Ga0496104_0065930_2499_3236 209
481 3300048908 Ga0496105_0036422 Ga0496105_0036422_2289_3026 209
482 3300048909 Ga0496106_0120985 Ga0496106_0120985_263_937 209
483 3300048910 Ga0496107_0033786 Ga0496107_0033786_669_1343 209
484 3300048911 Ga0496108_0016114 Ga0496108_0016114_4763_5500 209
485 3300048911 Ga0496108_0144852 Ga0496108_0144852_22_696 209
486 3300048913 Ga0496110_0351660 Ga0496110_0351660_292_1029 209
487 3300048915 Ga0496112_0002373 Ga0496112_0002373_3973_4710 209
488 3300048916 Ga0496113_0020912 Ga0496113_0020912_2196_2933 209
489 3300048916 Ga0496113_0199527 Ga0496113_0199527_206_943 209
490 3300048916 Ga0496113_0367327 Ga0496113_0367327_188_862 209
491 3300048917 Ga0496114_0386199 Ga0496114_0386199_463_1200 209
492 3300048918 Ga0496115_0129572 Ga0496115_0129572_565_1302 209
493 3300048921 Ga0496118_0012072 Ga0496118_0012072_4843_5580 209
494 3300048921 Ga0496118_0197443 Ga0496118_0197443_395_1063 209
495 3300048922 Ga0496119_0026724 Ga0496119_0026724_950_1621 209
496 3300048922 Ga0496119_0039745 Ga0496119_0039745_206_943 209
497 3300048923 Ga0496120_0000916 Ga0496120_0000916_28184_28855 209
498 3300048924 Ga0496121_0072782 Ga0496121_0072782_811_1548 209
499 3300048925 Ga0496122_0137941 Ga0496122_0137941_445_1182 209
500 3300048927 Ga0496124_0019770 Ga0496124_0019770_346_1083 209
501 3300048928 Ga0496125_0014710 Ga0496125_0014710_5583_6251 209
502 3300048928 Ga0496125_0033784 Ga0496125_0033784_3496_4233 209
503 3300048929 Ga0496126_0016188 Ga0496126_0016188_5439_6110 209
504 3300048929 Ga0496126_0016541 Ga0496126_0016541_2695_3363 209
505 3300048929 Ga0496126_0172050 Ga0496126_0172050_295_1032 209
506 3300049573 Ga0501037_0022763 Ga0501037_0022763_3516_4184 209
507 3300049581 Ga0501047_0010031 Ga0501047_0010031_5672_6478 209
508 3300049581 Ga0501047_0018738 Ga0501047_0018738_4149_4817 209
509 3300049583 Ga0501067_0071905 Ga0501067_0071905_788_1462 209
510 3300049583 Ga0501067_0183855 Ga0501067_0183855_50_718 209
511 3300049585 Ga0501069_0006085 Ga0501069_0006085_5192_5860 209
512 3300049585 Ga0501069_0093871 Ga0501069_0093871_984_1649 209
513 3300049585 Ga0501069_0164499 Ga0501069_0164499_137_805 209
514 3300049586 Ga0501070_0000303 Ga0501070_0000303_43577_44242 209
515 3300049586 Ga0501070_0003662 Ga0501070_0003662_11060_11728 209
516 3300049586 Ga0501070_0016136 Ga0501070_0016136_3778_4446 209
517 3300049586 Ga0501070_0025376 Ga0501070_0025376_570_1238 209
518 3300049586 Ga0501070_0038282 Ga0501070_0038282_2397_3065 209
519 3300049586 Ga0501070_0166202 Ga0501070_0166202_40_708 209
520 3300049586 Ga0501070_0221578 Ga0501070_0221578_238_906 209
521 3300049587 Ga0501071_0024633 Ga0501071_0024633_2228_2896 209
522 3300049589 Ga0501073_0009019 Ga0501073_0009019_4760_5428 209
523 3300049589 Ga0501073_0060865 Ga0501073_0060865_1548_2216 209
524 3300049589 Ga0501073_0064940 Ga0501073_0064940_1625_2293 209
525 3300049590 Ga0501074_0008058 Ga0501074_0008058_5296_5964 209
526 3300049590 Ga0501074_0025665 Ga0501074_0025665_156_824 209
527 3300049590 Ga0501074_0033086 Ga0501074_0033086_948_1616 209
528 3300049742 Ga0501080_0008404 Ga0501080_0008404_6158_6826 209
529 3300049742 Ga0501080_0010871 Ga0501080_0010871_6100_6768 209
530 3300049742 Ga0501080_0033617 Ga0501080_0033617_2423_3091 209
531 3300049744 Ga0501083_0005937 Ga0501083_0005937_3331_4011 209
532 3300049744 Ga0501083_0014713 Ga0501083_0014713_429_1097 209
533 3300049822 Ga0501035_0000967 Ga0501035_0000967_24992_25660 209
534 3300049822 Ga0501035_0005003 Ga0501035_0005003_9366_10034 209
535 3300049822 Ga0501035_0040699 Ga0501035_0040699_1183_1851 209
536 3300049822 Ga0501035_0131818 Ga0501035_0131818_1486_2154 209
537 3300049823 Ga0501044_0019704 Ga0501044_0019704_3955_4623 209
538 3300049823 Ga0501044_0161471 Ga0501044_0161471_823_1491 209
539 3300049823 Ga0501044_0211561 Ga0501044_0211561_814_1482 209
540 3300049823 Ga0501044_0386404 Ga0501044_0386404_493_1173 209
541 3300050493 nmdc:mga0k408_38374_c1 nmdc:mga0k408_38374_c1_1480_2217 209
542 3300050495 nmdc:mga04h51_34720_c1 nmdc:mga04h51_34720_c1_819_1556 209
543 3300050507 nmdc:mga05p37_515375_c1 nmdc:mga05p37_515375_c1_587_1261 209
544 3300053084 Ga0495595_0383060 Ga0495595_0383060_14_685 209
545 3300053085 Ga0495619_0372368 Ga0495619_0372368_98_769 209
546 3300053086 Ga0500578_0209025 Ga0500578_0209025_345_1082 209
547 3300053090 Ga0500646_0001896 Ga0500646_0001896_2312_2980 209
548 3300060353 Ga0501082_0023882 Ga0501082_0023882_1135_1803 209
549 iso_pu_bacteria 2517093001 2517104755 209
550 iso_pu_bacteria 2842775625 2842780271 209
551 iso_pu_bacteria 2883577096 2883579057 209
552 3300003214 JGI25165J46597_1003063 JGI25165J46597_10030634 210
553 3300005336 Ga0070680_100117031 Ga0070680_1001170311 210
554 3300005436 Ga0070713_100986314 Ga0070713_1009863141 210
555 3300005437 Ga0070710_10045605 Ga0070710_100456052 210
556 3300005937 Ga0081455_10153294 Ga0081455_101532943 210
557 3300005937 Ga0081455_10168830 Ga0081455_101688302 210
558 3300006028 Ga0070717_10227032 Ga0070717_102270322 210
559 3300013105 Ga0157369_10478004 Ga0157369_104780042 210
560 3300021441 Ga0213871_10042191 Ga0213871_100421912 210
561 3300025231 Ga0207427_104998 Ga0207427_1049981 210
562 3300025261 Ga0209233_1000411 Ga0209233_100041116 210
563 3300031507 Ga0307509_10218896 Ga0307509_102188962 210
564 3300035083 Ga0373926_0043068 Ga0373926_0043068_624_1304 210
565 3300035086 Ga0373934_0012539 Ga0373934_0012539_2377_3093 210
566 3300035086 Ga0373934_0077165 Ga0373934_0077165_405_1085 210
567 3300035113 Ga0373936_0042290 Ga0373936_0042290_1020_1736 210
568 3300035117 Ga0373953_0043558 Ga0373953_0043558_828_1544 210
569 3300035118 Ga0373954_0050713 Ga0373954_0050713_530_1246 210
570 3300035170 Ga0373943_0092378 Ga0373943_0092378_349_1029 210
571 3300035170 Ga0373943_0100701 Ga0373943_0100701_89_805 210
572 3300035171 Ga0373946_0021523 Ga0373946_0021523_1134_1850 210
573 3300035171 Ga0373946_0226058 Ga0373946_0226058_179_859 210
574 3300035410 Ga0373924_0007147 Ga0373924_0007147_1290_2006 210
575 3300035692 Ga0373935_0038791 Ga0373935_0038791_618_1298 210
576 3300035692 Ga0373935_0063540 Ga0373935_0063540_793_1509 210
577 3300035692 Ga0373935_0106066 Ga0373935_0106066_588_1268 210
578 3300035695 Ga0373927_0072265 Ga0373927_0072265_1411_2091 210
579 3300035724 Ga0373933_0001978 Ga0373933_0001978_6030_6746 210
580 3300035724 Ga0373933_0069550 Ga0373933_0069550_921_1601 210
581 3300035725 Ga0373947_0021275 Ga0373947_0021275_2282_2962 210
582 3300036401 Ga0373937_0050840 Ga0373937_0050840_1608_2288 210
583 3300036401 Ga0373937_0448340 Ga0373937_0448340_221_901 210
584 3300037068 Ga0373925_0005605 Ga0373925_0005605_1080_1760 210
585 3300037068 Ga0373925_0512330 Ga0373925_0512330_90_770 210
586 3300037068 Ga0373925_0910391 Ga0373925_0910391_38_706 210
587 3300037853 Ga0436364_0242530 Ga0436364_0242530_552_1232 210
588 3300037853 Ga0436364_1298093 Ga0436364_1298093_2821_3510 210
589 3300039437 Ga0436365_1252050 Ga0436365_1252050_569_1249 210
590 3300039438 Ga0436360_0471757 Ga0436360_0471757_184_864 210
591 3300042876 Ga0451577_0001586 Ga0451577_0001586_7736_8416 210
592 3300044673 Ga0453683_0207064 Ga0453683_0207064_400_1080 210
593 3300044712 Ga0453684_0000374 Ga0453684_0000374_123406_124086 210
594 3300044712 Ga0453684_0086229 Ga0453684_0086229_1683_2363 210
595 3300045051 Ga0451576_0001603 Ga0451576_0001603_32988_33668 210
596 3300045051 Ga0451576_0029780 Ga0451576_0029780_1479_2159 210
597 3300046455 Ga0495603_0385842 Ga0495603_0385842_98_778 210
598 3300046459 Ga0495629_0181557 Ga0495629_0181557_271_951 210
599 3300046462 Ga0495651_0025267 Ga0495651_0025267_2140_2856 210
600 3300046463 Ga0495653_0123957 Ga0495653_0123957_826_1542 210
601 3300046477 Ga0495664_0010209 Ga0495664_0010209_2492_3208 210
602 3300046511 Ga0495608_0025784 Ga0495608_0025784_1531_2247 210
603 3300046514 Ga0495618_0127207 Ga0495618_0127207_87_803 210
604 3300046529 Ga0495652_0051987 Ga0495652_0051987_875_1591 210
605 3300046536 Ga0495587_0007000 Ga0495587_0007000_3892_4608 210
606 3300046543 Ga0495645_0006870 Ga0495645_0006870_4836_5552 210
607 3300046559 Ga0495667_0097084 Ga0495667_0097084_55_771 210
608 3300046663 Ga0495635_0126640 Ga0495635_0126640_284_964 210
609 3300046675 Ga0495657_0015043 Ga0495657_0015043_2586_3302 210
610 3300046678 Ga0495599_0006872 Ga0495599_0006872_5936_6652 210
611 3300046679 Ga0495623_0018805 Ga0495623_0018805_3111_3827 210
612 3300046680 Ga0495646_0016845 Ga0495646_0016845_671_1387 210
613 3300046809 Ga0495600_0065746 Ga0495600_0065746_362_1078 210
614 3300047317 Ga0495604_0096772 Ga0495604_0096772_639_1355 210
615 3300047319 Ga0495674_0013405 Ga0495674_0013405_5987_6703 210
616 3300047319 Ga0495674_0462697 Ga0495674_0462697_155_835 210
617 3300047322 Ga0495680_0021973 Ga0495680_0021973_740_1456 210
618 3300047444 Ga0495675_0049058 Ga0495675_0049058_406_1122 210
619 3300047471 Ga0495684_0121074 Ga0495684_0121074_946_1626 210
620 3300047471 Ga0495684_0207408 Ga0495684_0207408_78_794 210
621 3300048088 Ga0495602_0028107 Ga0495602_0028107_3585_4301 210
622 3300049586 Ga0501070_0000863 Ga0501070_0000863_3719_4393 210
623 3300053084 Ga0495595_0012714 Ga0495595_0012714_90_806 210
624 3300053093 Ga0500651_0003060 Ga0500651_0003060_264_938 210
625 3300002774 JGI25150J39212_1000032 JGI25150J39212_100003258 211
626 3300003187 JGI25151J46595_10000010 JGI25151J46595_10000010230 211
627 3300003215 JGI25153J46596_10000013 JGI25153J46596_10000013230 211
628 3300005331 Ga0070670_100961896 Ga0070670_1009618961 211
629 3300005333 Ga0070677_10009295 Ga0070677_100092954 211
630 3300005337 Ga0070682_100132106 Ga0070682_1001321062 211
631 3300005340 Ga0070689_100228815 Ga0070689_1002288152 211
632 3300005353 Ga0070669_100041926 Ga0070669_1000419263 211
633 3300005354 Ga0070675_100111468 Ga0070675_1001114681 211
634 3300005356 Ga0070674_100036125 Ga0070674_1000361254 211
635 3300005356 Ga0070674_100076735 Ga0070674_1000767352 211
636 3300005356 Ga0070674_100222311 Ga0070674_1002223112 211
637 3300005364 Ga0070673_100134200 Ga0070673_1001342002 211
638 3300005364 Ga0070673_100343246 Ga0070673_1003432462 211
639 3300005367 Ga0070667_100685241 Ga0070667_1006852412 211
640 3300005438 Ga0070701_10164164 Ga0070701_101641642 211
641 3300005456 Ga0070678_100022127 Ga0070678_1000221274 211
642 3300005456 Ga0070678_100060385 Ga0070678_1000603853 211
643 3300005543 Ga0070672_100025661 Ga0070672_1000256612 211
644 3300005548 Ga0070665_100271255 Ga0070665_1002712552 211
645 3300005840 Ga0068870_10004675 Ga0068870_100046758 211
646 3300005841 Ga0068863_100215634 Ga0068863_1002156342 211
647 3300005937 Ga0081455_10143128 Ga0081455_101431282 211
648 3300006237 Ga0097621_100065001 Ga0097621_1000650012 211
649 3300006237 Ga0097621_100145380 Ga0097621_1001453802 211
650 3300006358 Ga0068871_100052960 Ga0068871_1000529603 211
651 3300006358 Ga0068871_100198657 Ga0068871_1001986572 211
652 3300006881 Ga0068865_100063201 Ga0068865_1000632013 211
653 3300006881 Ga0068865_100416581 Ga0068865_1004165811 211
654 3300009094 Ga0111539_10057730 Ga0111539_100577303 211
655 3300009176 Ga0105242_10328124 Ga0105242_103281242 211
656 3300009177 Ga0105248_10176839 Ga0105248_101768392 211
657 3300009553 Ga0105249_11016791 Ga0105249_110167911 211
658 3300013296 Ga0157374_10404451 Ga0157374_104044512 211
659 3300014325 Ga0163163_10258025 Ga0163163_102580252 211
660 3300014326 Ga0157380_10028522 Ga0157380_100285223 211
661 3300014326 Ga0157380_10135749 Ga0157380_101357493 211
662 3300014326 Ga0157380_10498600 Ga0157380_104986002 211
663 3300014745 Ga0157377_10163989 Ga0157377_101639892 211
664 3300014969 Ga0157376_10168196 Ga0157376_101681962 211
665 3300025245 Ga0207425_1000015 Ga0207425_100001562 211
666 3300025258 Ga0209129_1000126 Ga0209129_100012658 211
667 3300025294 Ga0209025_1000002 Ga0209025_1000002960 211
668 3300025297 Ga0209758_1000003 Ga0209758_1000003967 211
669 3300025893 Ga0207682_10011592 Ga0207682_100115923 211
670 3300025893 Ga0207682_10012266 Ga0207682_100122662 211
671 3300025907 Ga0207645_10185183 Ga0207645_101851831 211
672 3300025908 Ga0207643_10016764 Ga0207643_100167643 211
673 3300025923 Ga0207681_10079662 Ga0207681_100796623 211
674 3300025936 Ga0207670_10224482 Ga0207670_102244822 211
675 3300025937 Ga0207669_10210538 Ga0207669_102105382 211
676 3300025940 Ga0207691_10017495 Ga0207691_100174952 211
677 3300025941 Ga0207711_10119661 Ga0207711_101196613 211
678 3300025960 Ga0207651_10165679 Ga0207651_101656792 211
679 3300025986 Ga0207658_10234846 Ga0207658_102348462 211
680 3300026075 Ga0207708_10014979 Ga0207708_100149795 211
681 3300026088 Ga0207641_10223705 Ga0207641_102237052 211
682 3300026118 Ga0207675_100342464 Ga0207675_1003424642 211
683 3300026121 Ga0207683_10050516 Ga0207683_100505163 211
684 3300026121 Ga0207683_10071833 Ga0207683_100718332 211
685 3300028379 Ga0268266_10149473 Ga0268266_101494732 211
686 3300039062 Ga0400483_129729 Ga0400483_129729_2786_3457 211
687 3300039062 Ga0400483_257754 Ga0400483_257754_3111_3782 211
688 3300046474 Ga0495605_0074461 Ga0495605_0074461_295_966 211
689 3300046501 Ga0495607_0017440 Ga0495607_0017440_1662_2333 211
690 3300046507 Ga0495606_0040103 Ga0495606_0040103_1090_1761 211
691 3300046512 Ga0495610_0064100 Ga0495610_0064100_80_751 211
692 3300046615 Ga0495656_0125549 Ga0495656_0125549_41_718 211
693 3300047470 Ga0495681_0078036 Ga0495681_0078036_218_895 211
694 3300047472 Ga0495686_0140108 Ga0495686_0140108_441_1112 211
695 3300048927 Ga0496124_0000034 Ga0496124_0000034_226333_227004 211
696 3300049568 Ga0501031_0573022 Ga0501031_0573022_31_702 211
697 3300049574 Ga0501038_0696976 Ga0501038_0696976_78_749 211
698 3300049586 Ga0501070_0027609 Ga0501070_0027609_201_884 211
699 3300049586 Ga0501070_0677498 Ga0501070_0677498_39_710 211
700 3300049742 Ga0501080_0012404 Ga0501080_0012404_3463_4146 211
701 2162886007 SwRhRL2b_contig_2903557 SwRhRL2b_0434.00007260 212
702 3300003187 JGI25151J46595_10001571 JGI25151J46595_1000157119 212
703 3300004799 Ga0058863_11530858 Ga0058863_115308582 212
704 3300004800 Ga0058861_11853254 Ga0058861_118532542 212
705 3300004803 Ga0058862_12563802 Ga0058862_125638022 212
706 3300005289 Ga0065704_10013744 Ga0065704_100137441 212
707 3300005289 Ga0065704_10114139 Ga0065704_101141393 212
708 3300005289 Ga0065704_10178728 Ga0065704_101787281 212
709 3300005543 Ga0070672_100052932 Ga0070672_1000529323 212
710 3300005548 Ga0070665_100827597 Ga0070665_1008275972 212
711 3300005841 Ga0068863_100686681 Ga0068863_1006866812 212
712 3300006881 Ga0068865_100171550 Ga0068865_1001715502 212
713 3300009093 Ga0105240_10005743 Ga0105240_1000574317 212
714 3300009094 Ga0111539_10489632 Ga0111539_104896322 212
715 3300009174 Ga0105241_10546756 Ga0105241_105467561 212
716 3300013105 Ga0157369_10228483 Ga0157369_102284832 212
717 3300013105 Ga0157369_10331781 Ga0157369_103317812 212
718 3300013308 Ga0157375_10001924 Ga0157375_100019245 212
719 3300013308 Ga0157375_10012821 Ga0157375_100128218 212
720 3300014497 Ga0182008_10043776 Ga0182008_100437763 212
721 3300014969 Ga0157376_10292583 Ga0157376_102925832 212
722 3300015689 Ga0183360_10001 Ga0183360_100013227 212
723 3300017792 Ga0163161_10403638 Ga0163161_104036382 212
724 3300025263 Ga0209565_1011175 Ga0209565_10111752 212
725 3300025292 Ga0209676_1000052 Ga0209676_100005293 212
726 3300025294 Ga0209025_1000006 Ga0209025_1000006466 212
727 3300025297 Ga0209758_1010914 Ga0209758_10109144 212
728 3300025940 Ga0207691_10010224 Ga0207691_100102243 212
729 3300025942 Ga0207689_10213293 Ga0207689_102132932 212
730 3300026088 Ga0207641_10284921 Ga0207641_102849212 212
731 3300026118 Ga0207675_100035406 Ga0207675_1000354065 212
732 3300031090 Ga0265760_10024309 Ga0265760_100243091 212
733 3300031251 Ga0265327_10003819 Ga0265327_100038192 212
734 3300031344 Ga0265316_10098488 Ga0265316_100984882 212
735 3300031665 Ga0316575_10006188 Ga0316575_100061882 212
736 3300031727 Ga0316576_10003250 Ga0316576_100032508 212
737 3300032002 Ga0307416_101334465 Ga0307416_1013344651 212
738 3300032126 Ga0307415_100102862 Ga0307415_1001028621 212
739 3300041404 Ga0439436_0079888 Ga0439436_0079888_203_877 212
740 3300041407 Ga0439447_035762 Ga0439447_035762_87_782 212
741 3300041413 Ga0439465_0021787 Ga0439465_0021787_1123_1800 212
742 3300042007 Ga0439449_0000008 Ga0439449_0000008_45415_46089 212
743 3300042007 Ga0439449_0009302 Ga0439449_0009302_2325_3014 212
744 3300042007 Ga0439449_0012567 Ga0439449_0012567_834_1511 212
745 3300045051 Ga0451576_0064226 Ga0451576_0064226_2303_2983 212
746 3300045976 Ga0466967_0269442 Ga0466967_0269442_324_1025 212
747 3300046525 Ga0495663_0133587 Ga0495663_0133587_78_773 212
748 3300046616 Ga0495668_0001101 Ga0495668_0001101_815_1510 212
749 3300047319 Ga0495674_0123162 Ga0495674_0123162_486_1229 212
750 3300048917 Ga0496114_0040228 Ga0496114_0040228_2328_3002 212
751 3300048922 Ga0496119_0006959 Ga0496119_0006959_6839_7534 212
752 3300048925 Ga0496122_0003953 Ga0496122_0003953_13236_13910 212
753 3300048926 Ga0496123_0003147 Ga0496123_0003147_5050_5724 212
754 3300048928 Ga0496125_0116963 Ga0496125_0116963_677_1351 212
755 3300049571 Ga0501034_0000263 Ga0501034_0000263_30761_31438 212
756 3300049571 Ga0501034_0102152 Ga0501034_0102152_1161_1835 212
757 3300049705 Ga0501225_0000850 Ga0501225_0000850_7885_8559 212
758 iso_pu_bacteria 2643221593 2643973177 212
759 iso_pu_bacteria 8055878733 8055880398 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

59

261

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9857 2 207
7sbj-assembly1.cif.gz_C crystal structure of ribulose-phosphate 3-epimerase from stenotrophomonas maltophilia k279a 0.9828 2 207
7u5y-assembly1.cif.gz_E crystal structure of ribulose-phosphate 3-epimerase from pseudomonas aeruginosa 0.9753 2 207
3inp-assembly1.cif.gz_A 2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis. 0.9733 2 207
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9704 2 209
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9862 2 207 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9813 2 207 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9726 2 207 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9685 2 209 3.20.20.70
af_A0A1D6PJ99_41_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9672 2 201 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2T5V3H4-F1-model_v4 deleted 0.9949 2 207
AF-A0A2C7ADH0-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.993 2 207 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A813A470-F1-model_v4 ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.993 2 167 GO:0004750
GO:0005975
GO:0006098
AF-A0A661NUS9-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9924 2 207 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A0U4W401-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.992 2 205 GO:0004750
GO:0006098
GO:0019323
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.66 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map