F479479

General Info

Members Datasets Scaffolds Average Seq Length
759 317 1518 90

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10288780|Ga0075433_102887802
Length 103
Sequence MRTINMTDGARVVLDGDLLALLETLYRELTARRELERTFEDTVREIHHVIEQMTDEERRQYLSESLFLNFVSYENERLGAYLRKITDEKGKGKREKGHGRALR

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
187 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
188 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
189 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
190 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
191 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
194 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
197 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
198 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
199 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
200 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
201 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
205 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
250 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
251 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
264 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
274 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
275 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
276 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
277 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
278 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
279 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
280 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
281 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
282 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
283 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
284 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
290 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
291 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
292 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.24
Nodule 0
Rhizoplane 5.8
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 23.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10288780 3300006852 Bacteria 1453
2 CNBas_1003843 3300000531 Unclassified 843
3 JGI24743J22301_10007403 3300001991 Bacteria 1903
4 Ga0065712_10078115 3300005290 Bacteria 3392
5 Ga0065715_10114194 3300005293 Bacteria 2459
6 Ga0065715_10352863 3300005293 Bacteria 948
7 Ga0065715_10370516 3300005293 Bacteria 922
8 Ga0065715_10823409 3300005293 Unclassified 601
9 Ga0065707_10159632 3300005295 Bacteria 1575
10 Ga0065707_10847010 3300005295 Unclassified 583
11 Ga0065707_10873261 3300005295 Bacteria 575
12 Ga0065707_11120632 3300005295 Unclassified 511
13 Ga0065707_11120890 3300005295 Bacteria 511
14 Ga0070683_100000326 3300005329 Bacteria 32914
15 Ga0070683_100684382 3300005329 Bacteria 982
16 Ga0070683_100691064 3300005329 Bacteria 977
17 Ga0070690_100105546 3300005330 Bacteria 1873
18 Ga0070670_100015796 3300005331 Bacteria 6481
19 Ga0070670_100134948 3300005331 Bacteria 2132
20 Ga0070670_101135722 3300005331 Bacteria 713
21 Ga0070670_102124806 3300005331 Bacteria 517
22 Ga0070677_10110193 3300005333 Bacteria 1228
23 Ga0070677_10812037 3300005333 Unclassified 535
24 Ga0068869_100328065 3300005334 Bacteria 1243
25 Ga0070666_10226993 3300005335 Bacteria 1318
26 Ga0070666_11294679 3300005335 Unclassified 544
27 Ga0068868_100069374 3300005338 Bacteria 2809
28 Ga0068868_100398212 3300005338 Unclassified 1188
29 Ga0068868_100409156 3300005338 Bacteria 1172
30 Ga0068868_100654630 3300005338 Bacteria 936
31 Ga0070660_100010623 3300005339 Bacteria 6508
32 Ga0070689_100147713 3300005340 Bacteria 1894
33 Ga0070689_100764070 3300005340 Bacteria 848
34 Ga0070689_101891483 3300005340 Bacteria 545
35 Ga0070661_100118749 3300005344 Bacteria 1979
36 Ga0070692_10687619 3300005345 Unclassified 687
37 Ga0070692_10960327 3300005345 Bacteria 595
38 Ga0070668_100035387 3300005347 Bacteria 3808
39 Ga0070668_100689685 3300005347 Bacteria 900
40 Ga0070668_101187153 3300005347 Bacteria 691
41 Ga0070669_100346036 3300005353 Bacteria 1206
42 Ga0070669_100436878 3300005353 Bacteria 1076
43 Ga0070675_100093178 3300005354 Unclassified 2526
44 Ga0070675_100096084 3300005354 Bacteria 2489
45 Ga0070675_100191156 3300005354 Bacteria 1774
46 Ga0070675_100569030 3300005354 Bacteria 1026
47 Ga0070675_101883273 3300005354 Bacteria 552
48 Ga0070671_100045359 3300005355 Bacteria 3654
49 Ga0070671_100166192 3300005355 Bacteria 1866
50 Ga0070671_101889175 3300005355 Bacteria 531
51 Ga0070674_100056212 3300005356 Bacteria 2728
52 Ga0070674_101039372 3300005356 Bacteria 721
53 Ga0070674_101133389 3300005356 Unclassified 692
54 Ga0070673_100179151 3300005364 Bacteria 1813
55 Ga0070673_100252368 3300005364 Unclassified 1538
56 Ga0070659_100102874 3300005366 Bacteria 2300
57 Ga0070659_100404460 3300005366 Bacteria 1153
58 Ga0070667_100392490 3300005367 Bacteria 1262
59 Ga0070667_101111488 3300005367 Bacteria 739
60 Ga0070667_101120405 3300005367 Bacteria 736
61 Ga0070709_11046852 3300005434 Bacteria 651
62 Ga0070711_100765433 3300005439 Unclassified 817
63 Ga0070705_100195965 3300005440 Bacteria 1381
64 Ga0070700_100048761 3300005441 Bacteria 2626
65 Ga0070700_100473916 3300005441 Bacteria 957
66 Ga0070700_100652604 3300005441 Bacteria 831
67 Ga0070694_100295569 3300005444 Bacteria 1239
68 Ga0070694_100509917 3300005444 Unclassified 958
69 Ga0070708_102205048 3300005445 Bacteria 509
70 Ga0070663_100009370 3300005455 Bacteria 6061
71 Ga0070663_100094814 3300005455 Bacteria 2217
72 Ga0070663_101086466 3300005455 Unclassified 699
73 Ga0070663_101919341 3300005455 Unclassified 532
74 Ga0070663_102128918 3300005455 Unclassified 506
75 Ga0070678_100065613 3300005456 Bacteria 2696
76 Ga0070678_100219733 3300005456 Unclassified 1579
77 Ga0070678_100248166 3300005456 Bacteria 1491
78 Ga0070678_100315426 3300005456 Bacteria 1333
79 Ga0070678_101479182 3300005456 Unclassified 636
80 Ga0070662_100055615 3300005457 Bacteria 2871
81 Ga0070662_100125965 3300005457 Bacteria 1969
82 Ga0070662_100175457 3300005457 Bacteria 1686
83 Ga0068867_100060799 3300005459 Bacteria 2803
84 Ga0068867_101233925 3300005459 Archaea 688
85 Ga0070685_10259322 3300005466 Bacteria 1155
86 Ga0070685_10444545 3300005466 Bacteria 907
87 Ga0070707_100410227 3300005468 Bacteria 1315
88 Ga0070698_102155597 3300005471 Bacteria 511
89 Ga0070679_100035626 3300005530 Bacteria 4938
90 Ga0070684_100000168 3300005535 Bacteria 45138
91 Ga0070697_102133309 3300005536 Unclassified 502
92 Ga0068853_100571975 3300005539 Bacteria 1072
93 Ga0070672_100089450 3300005543 Bacteria 2481
94 Ga0070672_100153745 3300005543 Bacteria 1905
95 Ga0070672_100182666 3300005543 Bacteria 1748
96 Ga0070672_100621509 3300005543 Archaea 942
97 Ga0070672_101838230 3300005543 Bacteria 545
98 Ga0070686_100194559 3300005544 Bacteria 1449
99 Ga0070686_101854438 3300005544 Unclassified 514
100 Ga0070695_101123731 3300005545 Unclassified 644
101 Ga0070696_100267437 3300005546 Bacteria 1299
102 Ga0070696_101042545 3300005546 Unclassified 685
103 Ga0070665_100003081 3300005548 Bacteria 17957
104 Ga0070704_100534838 3300005549 Unclassified 1022
105 Ga0070704_100770063 3300005549 Unclassified 858
106 Ga0070704_101472878 3300005549 Bacteria 626
107 Ga0068855_100040397 3300005563 Bacteria 5537
108 Ga0068855_102086700 3300005563 Unclassified 571
109 Ga0070664_100001248 3300005564 Bacteria 20353
110 Ga0070664_100462277 3300005564 Bacteria 1166
111 Ga0068854_100749274 3300005578 Bacteria 847
112 Ga0068856_100339141 3300005614 Unclassified 1521
113 Ga0070702_100281581 3300005615 Bacteria 1142
114 Ga0070702_100771132 3300005615 Bacteria 741
115 Ga0070702_101051014 3300005615 Bacteria 648
116 Ga0068859_101191366 3300005617 Bacteria 839
117 Ga0068859_101394930 3300005617 Bacteria 773
118 Ga0068859_101504362 3300005617 Bacteria 743
119 Ga0068864_100080988 3300005618 Bacteria 2846
120 Ga0068864_100322562 3300005618 Bacteria 1451
121 Ga0068866_10010564 3300005718 Bacteria 3963
122 Ga0068866_10821403 3300005718 Bacteria 648
123 Ga0068861_100120755 3300005719 Bacteria 2114
124 Ga0068861_100129225 3300005719 Bacteria 2049
125 Ga0068851_10373252 3300005834 Bacteria 834
126 Ga0068851_10982478 3300005834 Unclassified 532
127 Ga0068870_10502298 3300005840 Unclassified 808
128 Ga0068870_11262569 3300005840 Bacteria 537
129 Ga0068863_100869707 3300005841 Bacteria 901
130 Ga0068863_101820011 3300005841 Bacteria 619
131 Ga0068863_102265533 3300005841 Unclassified 553
132 Ga0068858_100011466 3300005842 Bacteria 8365
133 Ga0068858_100107960 3300005842 Bacteria 2598
134 Ga0068858_100810043 3300005842 Bacteria 914
135 Ga0068858_100895311 3300005842 Unclassified 868
136 Ga0068858_101526724 3300005842 Bacteria 659
137 Ga0068860_100540305 3300005843 Bacteria 1167
138 Ga0068860_101713874 3300005843 Bacteria 650
139 Ga0068862_100112153 3300005844 Bacteria 2395
140 Ga0081455_10782728 3300005937 Unclassified 600
141 Ga0081538_10225821 3300005981 Bacteria 737
142 Ga0075368_10016927 3300006042 Bacteria 2722
143 Ga0075363_100212204 3300006048 Bacteria 1108
144 Ga0075363_100703627 3300006048 Unclassified 610
145 Ga0075364_10129664 3300006051 Bacteria 1692
146 Ga0070715_10073808 3300006163 Bacteria 1531
147 Ga0070716_100037217 3300006173 Bacteria 2688
148 Ga0075367_10008193 3300006178 Bacteria 5401
149 Ga0075427_10026819 3300006194 Unclassified 934
150 Ga0075366_10018803 3300006195 Bacteria 3993
151 Ga0075366_10468481 3300006195 Bacteria 778
152 Ga0075366_10668243 3300006195 Unclassified 645
153 Ga0097621_100048363 3300006237 Bacteria 3450
154 Ga0097621_100354683 3300006237 Bacteria 1305
155 Ga0097621_101401014 3300006237 Unclassified 662
156 Ga0097621_101563474 3300006237 Unclassified 627
157 Ga0075370_10615890 3300006353 Bacteria 658
158 Ga0068871_100061183 3300006358 Bacteria 3074
159 Ga0068871_100123992 3300006358 Bacteria 2185
160 Ga0068871_101839580 3300006358 Unclassified 575
161 Ga0068871_102147946 3300006358 Unclassified 532
162 Ga0075428_100069296 3300006844 Bacteria 3857
163 Ga0075428_100113028 3300006844 Bacteria 2958
164 Ga0075428_100140578 3300006844 Bacteria 2625
165 Ga0075428_100172883 3300006844 Bacteria 2341
166 Ga0075428_100315122 3300006844 Unclassified 1681
167 Ga0075428_100953696 3300006844 Bacteria 909
168 Ga0075430_100020696 3300006846 Bacteria 5595
169 Ga0075430_100050736 3300006846 Bacteria 3497
170 Ga0075430_100118799 3300006846 Bacteria 2204
171 Ga0075430_100193055 3300006846 Bacteria 1692
172 Ga0075430_100212369 3300006846 Unclassified 1605
173 Ga0075430_100981376 3300006846 Unclassified 696
174 Ga0075431_100008733 3300006847 Bacteria 10151
175 Ga0075431_100018733 3300006847 Bacteria 7053
176 Ga0075431_100180630 3300006847 Bacteria 2166
177 Ga0075431_100195068 3300006847 Bacteria 2073
178 Ga0075431_100428397 3300006847 Unclassified 1321
179 Ga0075431_100484231 3300006847 Bacteria 1230
180 Ga0075431_100671892 3300006847 Unclassified 1015
181 Ga0075431_100739127 3300006847 Unclassified 960
182 Ga0075431_101013868 3300006847 Bacteria 797
183 Ga0075431_101060805 3300006847 Unclassified 776
184 Ga0075433_10000771 3300006852 Bacteria 22052
185 Ga0075433_10040318 3300006852 Bacteria 4042
186 Ga0075434_100001704 3300006871 Bacteria 18818
187 Ga0075434_100131318 3300006871 Unclassified 2524
188 Ga0075429_100053275 3300006880 Bacteria 3521
189 Ga0075429_100205088 3300006880 Unclassified 1727
190 Ga0075429_100215308 3300006880 Unclassified 1683
191 Ga0075429_100452712 3300006880 Bacteria 1125
192 Ga0075429_100717475 3300006880 Bacteria 876
193 Ga0075429_100983427 3300006880 Bacteria 738
194 Ga0075429_101036845 3300006880 Unclassified 717
195 Ga0075429_101614100 3300006880 Bacteria 564
196 Ga0068865_100442578 3300006881 Bacteria 1073
197 Ga0068865_100685015 3300006881 Unclassified 874
198 Ga0075436_100005845 3300006914 Bacteria 8451
199 Ga0097620_101191333 3300006931 Bacteria 839
200 Ga0097620_101394995 3300006931 Bacteria 773
201 Ga0097620_101504472 3300006931 Bacteria 743
202 Ga0075435_100000911 3300007076 Bacteria 18610
203 Ga0075435_100113300 3300007076 Bacteria 2257
204 Ga0075435_100137530 3300007076 Bacteria 2047
205 Ga0075435_100360114 3300007076 Bacteria 1248
206 Ga0075435_101099284 3300007076 Unclassified 695
207 Ga0075435_101173563 3300007076 Bacteria 672
208 Ga0111539_10013664 3300009094 Bacteria 10142
209 Ga0111539_10029838 3300009094 Bacteria 6635
210 Ga0111539_10198464 3300009094 Bacteria 2340
211 Ga0111539_10225729 3300009094 Bacteria 2181
212 Ga0111539_10314865 3300009094 Unclassified 1821
213 Ga0111539_10618602 3300009094 Unclassified 1261
214 Ga0111539_10958020 3300009094 Bacteria 995
215 Ga0111539_11134599 3300009094 Bacteria 908
216 Ga0111539_13405019 3300009094 Unclassified 511
217 Ga0105245_10107633 3300009098 Bacteria 2588
218 Ga0105245_10575990 3300009098 Bacteria 1150
219 Ga0105245_12070183 3300009098 Unclassified 623
220 Ga0105247_10047760 3300009101 Unclassified 2629
221 Ga0105247_10203235 3300009101 Unclassified 1332
222 Ga0105247_10608264 3300009101 Unclassified 811
223 Ga0114129_10002530 3300009147 Bacteria 25397
224 Ga0114129_10007226 3300009147 Bacteria 15811
225 Ga0114129_10011087 3300009147 Bacteria 12841
226 Ga0114129_10024673 3300009147 Bacteria 8522
227 Ga0114129_10046338 3300009147 Bacteria 6110
228 Ga0114129_10296290 3300009147 Unclassified 2157
229 Ga0114129_10475970 3300009147 Bacteria 1635
230 Ga0114129_10906049 3300009147 Bacteria 1117
231 Ga0114129_11027934 3300009147 Bacteria 1036
232 Ga0114129_11401400 3300009147 Bacteria 862
233 Ga0114129_12844577 3300009147 Bacteria 574
234 Ga0105243_10457102 3300009148 Bacteria 1200
235 Ga0105241_11001518 3300009174 Unclassified 782
236 Ga0105241_11246342 3300009174 Unclassified 706
237 Ga0105241_11287008 3300009174 Bacteria 696
238 Ga0105242_10042859 3300009176 Bacteria 3657
239 Ga0105248_10055504 3300009177 Bacteria 4443
240 Ga0105248_10081580 3300009177 Bacteria 3635
241 Ga0105248_10141958 3300009177 Bacteria 2709
242 Ga0105248_10739565 3300009177 Bacteria 1110
243 Ga0105248_10743220 3300009177 Bacteria 1107
244 Ga0105248_11475166 3300009177 Bacteria 770
245 Ga0105248_11719719 3300009177 Bacteria 711
246 Ga0105238_10810504 3300009551 Bacteria 952
247 Ga0105238_11728478 3300009551 Bacteria 657
248 Ga0105238_11816921 3300009551 Bacteria 642
249 Ga0105249_11599349 3300009553 Unclassified 724
250 Ga0099796_10136619 3300010159 Bacteria 955
251 Ga0105239_11792903 3300010375 Unclassified 711
252 Ga0105239_12329495 3300010375 Unclassified 623
253 Ga0105239_12973092 3300010375 Unclassified 553
254 Ga0105246_11545096 3300011119 Unclassified 625
255 Ga0105246_11736624 3300011119 Bacteria 594
256 Ga0105246_11963275 3300011119 Bacteria 564
257 Ga0157374_10209043 3300013296 Bacteria 1913
258 Ga0157374_10243285 3300013296 Bacteria 1770
259 Ga0157374_10400544 3300013296 Bacteria 1369
260 Ga0157374_11639395 3300013296 Bacteria 668
261 Ga0157378_10089055 3300013297 Bacteria 2802
262 Ga0157378_10238622 3300013297 Bacteria 1736
263 Ga0157378_11487976 3300013297 Bacteria 721
264 Ga0163162_10539620 3300013306 Bacteria 1295
265 Ga0163162_11483403 3300013306 Bacteria 772
266 Ga0163162_12415746 3300013306 Bacteria 604
267 Ga0163162_13308438 3300013306 Unclassified 516
268 Ga0163162_13441198 3300013306 Unclassified 504
269 Ga0157375_10113069 3300013308 Bacteria 2816
270 Ga0157375_10526351 3300013308 Bacteria 1345
271 Ga0157375_11005624 3300013308 Unclassified 973
272 Ga0163163_10028350 3300014325 Bacteria 5375
273 Ga0163163_10094081 3300014325 Bacteria 3014
274 Ga0163163_10192095 3300014325 Bacteria 2090
275 Ga0163163_10536616 3300014325 Bacteria 1232
276 Ga0157380_10001199 3300014326 Bacteria 16776
277 Ga0157380_10067669 3300014326 Bacteria 2877
278 Ga0157380_10114556 3300014326 Bacteria 2272
279 Ga0157380_10332375 3300014326 Bacteria 1414
280 Ga0157380_10695283 3300014326 Unclassified 1021
281 Ga0157377_10074597 3300014745 Bacteria 1968
282 Ga0157377_10214080 3300014745 Bacteria 1230
283 Ga0157377_10449125 3300014745 Bacteria 889
284 Ga0157379_10011179 3300014968 Bacteria 7824
285 Ga0157379_11024874 3300014968 Bacteria 788
286 Ga0157379_12022386 3300014968 Bacteria 570
287 Ga0157379_12305976 3300014968 Bacteria 536
288 Ga0157376_10160194 3300014969 Bacteria 2039
289 Ga0157376_10475218 3300014969 Bacteria 1224
290 Ga0157376_11782789 3300014969 Unclassified 651
291 Ga0157376_11935151 3300014969 Unclassified 627
292 Ga0163161_10100993 3300017792 Bacteria 2147
293 Ga0207666_1051313 3300025271 Bacteria 654
294 Ga0207697_10001132 3300025315 Bacteria 14697
295 Ga0207697_10009543 3300025315 Bacteria 4188
296 Ga0207682_10471471 3300025893 Bacteria 594
297 Ga0207642_10307453 3300025899 Bacteria 921
298 Ga0207710_10155432 3300025900 Bacteria 1112
299 Ga0207688_10002580 3300025901 Bacteria 9798
300 Ga0207680_10717522 3300025903 Unclassified 716
301 Ga0207680_10799279 3300025903 Bacteria 676
302 Ga0207647_10360573 3300025904 Unclassified 822
303 Ga0207643_10024064 3300025908 Bacteria 3361
304 Ga0207643_10312324 3300025908 Bacteria 980
305 Ga0207643_10931367 3300025908 Unclassified 563
306 Ga0207705_10210281 3300025909 Bacteria 1476
307 Ga0207660_10246087 3300025917 Bacteria 1410
308 Ga0207660_10833443 3300025917 Unclassified 753
309 Ga0207657_10007831 3300025919 Bacteria 10903
310 Ga0207657_11099761 3300025919 Bacteria 607
311 Ga0207657_11340641 3300025919 Bacteria 539
312 Ga0207649_10197030 3300025920 Bacteria 1420
313 Ga0207649_10331016 3300025920 Bacteria 1122
314 Ga0207652_10192850 3300025921 Unclassified 1832
315 Ga0207646_11088414 3300025922 Bacteria 704
316 Ga0207681_10231547 3300025923 Bacteria 1434
317 Ga0207681_11407692 3300025923 Unclassified 585
318 Ga0207694_10356930 3300025924 Bacteria 1211
319 Ga0207694_10785116 3300025924 Unclassified 804
320 Ga0207650_10015328 3300025925 Bacteria 5336
321 Ga0207650_10576014 3300025925 Bacteria 945
322 Ga0207650_11053801 3300025925 Bacteria 692
323 Ga0207659_10000072 3300025926 Bacteria 64525
324 Ga0207659_10020558 3300025926 Bacteria 4366
325 Ga0207659_10125333 3300025926 Bacteria 1974
326 Ga0207659_10381905 3300025926 Bacteria 1175
327 Ga0207659_10389550 3300025926 Bacteria 1163
328 Ga0207687_10009098 3300025927 Bacteria 6495
329 Ga0207687_10493315 3300025927 Bacteria 1021
330 Ga0207687_10822312 3300025927 Unclassified 793
331 Ga0207644_10030125 3300025931 Bacteria 3770
332 Ga0207690_10171404 3300025932 Unclassified 1626
333 Ga0207706_10026758 3300025933 Bacteria 5163
334 Ga0207706_10480077 3300025933 Bacteria 1074
335 Ga0207706_11458323 3300025933 Bacteria 560
336 Ga0207686_10041899 3300025934 Bacteria 2795
337 Ga0207709_10738308 3300025935 Unclassified 791
338 Ga0207669_10047363 3300025937 Bacteria 2546
339 Ga0207669_10114216 3300025937 Bacteria 1817
340 Ga0207669_10262142 3300025937 Bacteria 1293
341 Ga0207669_11032558 3300025937 Unclassified 692
342 Ga0207704_10233042 3300025938 Bacteria 1370
343 Ga0207704_10252240 3300025938 Bacteria 1325
344 Ga0207665_10294494 3300025939 Unclassified 1211
345 Ga0207691_10100493 3300025940 Unclassified 2582
346 Ga0207691_10168968 3300025940 Bacteria 1915
347 Ga0207691_11338803 3300025940 Unclassified 590
348 Ga0207711_10037678 3300025941 Bacteria 4109
349 Ga0207711_10177851 3300025941 Bacteria 1933
350 Ga0207711_10277044 3300025941 Bacteria 1544
351 Ga0207711_10498579 3300025941 Bacteria 1135
352 Ga0207711_10826721 3300025941 Bacteria 862
353 Ga0207711_10947338 3300025941 Unclassified 800
354 Ga0207689_10029381 3300025942 Bacteria 4591
355 Ga0207661_10047767 3300025944 Bacteria 3399
356 Ga0207661_10368723 3300025944 Bacteria 1298
357 Ga0207661_11400421 3300025944 Unclassified 642
358 Ga0207679_10005466 3300025945 Bacteria 7961
359 Ga0207679_10678247 3300025945 Bacteria 934
360 Ga0207667_11348458 3300025949 Bacteria 688
361 Ga0207651_10154198 3300025960 Bacteria 1792
362 Ga0207651_10331791 3300025960 Unclassified 1275
363 Ga0207651_10935455 3300025960 Bacteria 773
364 Ga0207651_10985694 3300025960 Bacteria 753
365 Ga0207668_10696401 3300025972 Bacteria 893
366 Ga0207668_10796531 3300025972 Unclassified 836
367 Ga0207668_10885823 3300025972 Bacteria 794
368 Ga0207658_10088819 3300025986 Bacteria 2391
369 Ga0207658_10686631 3300025986 Bacteria 925
370 Ga0207658_11044405 3300025986 Unclassified 746
371 Ga0207658_11155696 3300025986 Unclassified 707
372 Ga0207677_10063247 3300026023 Bacteria 2571
373 Ga0207677_10182354 3300026023 Bacteria 1652
374 Ga0207677_10398381 3300026023 Bacteria 1167
375 Ga0207677_10489755 3300026023 Bacteria 1061
376 Ga0207703_10008225 3300026035 Bacteria 8243
377 Ga0207703_10080469 3300026035 Bacteria 2713
378 Ga0207703_10564723 3300026035 Bacteria 1074
379 Ga0207703_11804814 3300026035 Bacteria 588
380 Ga0207678_10003620 3300026067 Bacteria 13881
381 Ga0207678_10053420 3300026067 Bacteria 3482
382 Ga0207678_11375602 3300026067 Bacteria 624
383 Ga0207708_10054229 3300026075 Bacteria 3056
384 Ga0207708_10080785 3300026075 Bacteria 2498
385 Ga0207708_10243146 3300026075 Bacteria 1448
386 Ga0207708_11343621 3300026075 Bacteria 627
387 Ga0207702_12033906 3300026078 Unclassified 565
388 Ga0207641_10574043 3300026088 Unclassified 1102
389 Ga0207641_11659070 3300026088 Unclassified 641
390 Ga0207648_10050261 3300026089 Bacteria 3646
391 Ga0207648_10258142 3300026089 Bacteria 1555
392 Ga0207648_10516875 3300026089 Archaea 1094
393 Ga0207648_11641130 3300026089 Unclassified 604
394 Ga0207676_10105923 3300026095 Bacteria 2342
395 Ga0207675_100126025 3300026118 Bacteria 2425
396 Ga0207675_100570144 3300026118 Bacteria 1133
397 Ga0207675_100738006 3300026118 Bacteria 995
398 Ga0207675_102080247 3300026118 Bacteria 584
399 Ga0207683_10036397 3300026121 Bacteria 4286
400 Ga0207683_10129472 3300026121 Bacteria 2269
401 Ga0207683_10271199 3300026121 Bacteria 1550
402 Ga0207683_10361520 3300026121 Bacteria 1333
403 Ga0207683_10475390 3300026121 Bacteria 1153
404 Ga0207683_10633216 3300026121 Unclassified 990
405 Ga0207683_11512853 3300026121 Bacteria 620
406 Ga0207698_12050750 3300026142 Unclassified 586
407 Ga0210002_1108185 3300027617 Bacteria 505
408 Ga0209971_1013625 3300027682 Bacteria 1925
409 Ga0209813_10021164 3300027866 Bacteria 1826
410 Ga0207428_10000349 3300027907 Bacteria 59671
411 Ga0207428_10001421 3300027907 Bacteria 25181
412 Ga0207428_10272884 3300027907 Unclassified 1257
413 Ga0207428_10413321 3300027907 Bacteria 987
414 Ga0207428_10452463 3300027907 Bacteria 936
415 Ga0268266_10034103 3300028379 Bacteria 4327
416 Ga0268265_10097260 3300028380 Bacteria 2368
417 Ga0268264_10051010 3300028381 Bacteria 3447
418 Ga0268264_10102969 3300028381 Unclassified 2485
419 Ga0268264_12116601 3300028381 Bacteria 571
420 Ga0316182_1235704 3300030745 Bacteria 638
421 Ga0307408_100066147 3300031548 Bacteria 2654
422 Ga0307408_100078654 3300031548 Bacteria 2459
423 Ga0307408_100080827 3300031548 Bacteria 2429
424 Ga0307408_100095825 3300031548 Bacteria 2250
425 Ga0307408_100219797 3300031548 Bacteria 1549
426 Ga0307405_10036153 3300031731 Bacteria 2956
427 Ga0307405_10080671 3300031731 Bacteria 2125
428 Ga0307405_10607384 3300031731 Bacteria 893
429 Ga0307405_12059691 3300031731 Bacteria 512
430 Ga0307413_10114741 3300031824 Bacteria 1811
431 Ga0307413_10224312 3300031824 Unclassified 1375
432 Ga0307413_10406348 3300031824 Bacteria 1068
433 Ga0307413_10850029 3300031824 Unclassified 771
434 Ga0307410_10035916 3300031852 Bacteria 3223
435 Ga0307410_12035950 3300031852 Bacteria 513
436 Ga0326468_10092630 3300031889 Bacteria 543
437 Ga0307406_10028273 3300031901 Bacteria 3387
438 Ga0307406_10376173 3300031901 Bacteria 1118
439 Ga0307406_11242858 3300031901 Unclassified 648
440 Ga0307407_10009129 3300031903 Bacteria 4601
441 Ga0307407_10631654 3300031903 Unclassified 800
442 Ga0307412_10114833 3300031911 Bacteria 1929
443 Ga0307412_10162863 3300031911 Bacteria 1659
444 Ga0307412_10461052 3300031911 Bacteria 1049
445 Ga0307412_10887862 3300031911 Bacteria 780
446 Ga0307409_100022487 3300031995 Bacteria 4349
447 Ga0307409_100053923 3300031995 Bacteria 3093
448 Ga0307409_100184355 3300031995 Bacteria 1851
449 Ga0307416_100009915 3300032002 Bacteria 6266
450 Ga0307416_100131865 3300032002 Bacteria 2251
451 Ga0307416_100152662 3300032002 Bacteria 2121
452 Ga0307416_100611864 3300032002 Bacteria 1170
453 Ga0307416_101829780 3300032002 Unclassified 711
454 Ga0307416_102829985 3300032002 Unclassified 580
455 Ga0307414_10504791 3300032004 Bacteria 1071
456 Ga0307411_10012530 3300032005 Bacteria 4633
457 Ga0307411_10045602 3300032005 Bacteria 2821
458 Ga0307411_10485352 3300032005 Bacteria 1041
459 Ga0307411_11161704 3300032005 Bacteria 698
460 Ga0307415_100014778 3300032126 Bacteria 4602
461 Ga0307415_100229743 3300032126 Bacteria 1493
462 Ga0307415_101353044 3300032126 Bacteria 676
463 Ga0373938_0131647 3300034957 Unclassified 653
464 Ga0373936_0195563 3300035113 Unclassified 891
465 Ga0373945_0394042 3300035116 Unclassified 606
466 Ga0373957_0283306 3300035120 Bacteria 701
467 Ga0373955_0058623 3300035172 Bacteria 2119
468 Ga0373955_0155408 3300035172 Bacteria 1348
469 Ga0373924_0101121 3300035410 Unclassified 1240
470 Ga0373924_0174460 3300035410 Unclassified 945
471 Ga0373937_0914014 3300036401 Bacteria 826
472 Ga0373937_1514872 3300036401 Unclassified 618
473 Ga0373925_0093282 3300037068 Bacteria 2304
474 Ga0439439_0078492 3300041406 Unclassified 890
475 Ga0451789_0595895 3300041443 Unclassified 597
476 Ga0451802_0768188 3300041460 Bacteria 706
477 Ga0451807_0778831 3300041486 Bacteria 1888
478 Ga0451835_0438836 3300041492 Bacteria 708
479 Ga0451847_0782458 3300041503 Bacteria 629
480 Ga0439431_0174928 3300041997 Bacteria 618
481 Ga0439433_0032060 3300041999 Unclassified 1204
482 Ga0439450_015363 3300042008 Bacteria 1566
483 Ga0439457_116712 3300042014 Bacteria 629
484 Ga0450920_025211 3300042122 Unclassified 1157
485 Ga0450896_100382 3300042133 Unclassified 500
486 Ga0439446_0011701 3300042156 Bacteria 2386
487 Ga0439446_0075128 3300042156 Unclassified 1039
488 Ga0450909_080264 3300042185 Unclassified 528
489 Ga0439435_0003643 3300042436 Bacteria 3229
490 Ga0439435_0007210 3300042436 Bacteria 2532
491 Ga0439435_0027227 3300042436 Bacteria 1528
492 Ga0439435_0074968 3300042436 Bacteria 1007
493 Ga0439444_0011728 3300042437 Bacteria 1425
494 Ga0439444_0129858 3300042437 Unclassified 595
495 Ga0439464_0005212 3300042439 Bacteria 3351
496 Ga0439464_0036368 3300042439 Bacteria 1393
497 Ga0439464_0056942 3300042439 Bacteria 1139
498 Ga0439460_0037630 3300042461 Unclassified 1408
499 Ga0439460_0043518 3300042461 Bacteria 1327
500 Ga0439460_0111184 3300042461 Bacteria 889
501 Ga0450916_005686 3300042530 Bacteria 1450
502 Ga0450893_0131545 3300042532 Bacteria 529
503 Ga0451577_0049297 3300042876 Bacteria 3761
504 Ga0453684_0020035 3300044712 Bacteria 10130
505 Ga0453684_2070040 3300044712 Unclassified 572
506 Ga0451576_0323658 3300045051 Bacteria 1614
507 Ga0451576_0583309 3300045051 Unclassified 1175
508 Ga0451576_2465000 3300045051 Unclassified 532
509 Ga0466967_1548566 3300045976 Bacteria 660
510 Ga0495603_0203919 3300046455 Bacteria 1143
511 Ga0495629_0411542 3300046459 Bacteria 918
512 Ga0495629_0432018 3300046459 Archaea 893
513 Ga0495641_0477982 3300046461 Bacteria 568
514 Ga0495639_0133207 3300046475 Bacteria 1191
515 Ga0495662_0321692 3300046476 Unclassified 761
516 Ga0495630_0538279 3300046517 Bacteria 896
517 Ga0495586_0091873 3300046535 Bacteria 1678
518 Ga0495587_0502414 3300046536 Unclassified 670
519 Ga0495645_0148883 3300046543 Bacteria 1628
520 Ga0495633_0575595 3300046558 Bacteria 507
521 Ga0495667_0700153 3300046559 Bacteria 628
522 Ga0495656_0457040 3300046615 Bacteria 673
523 Ga0495668_0185133 3300046616 Unclassified 1141
524 Ga0495634_0403075 3300046642 Unclassified 812
525 Ga0495635_0139161 3300046663 Bacteria 1653
526 Ga0495659_0108682 3300046664 Bacteria 1081
527 Ga0495647_0009823 3300046681 Bacteria 3249
528 Ga0495647_0096514 3300046681 Bacteria 1219
529 Ga0495658_0315868 3300046683 Unclassified 990
530 Ga0495670_0357219 3300046691 Bacteria 787
531 Ga0495649_0575289 3300046694 Unclassified 557
532 Ga0495649_0630844 3300046694 Bacteria 528
533 Ga0495600_0058500 3300046809 Bacteria 2518
534 Ga0495674_0819465 3300047319 Bacteria 723
535 Ga0495680_0657072 3300047322 Unclassified 696
536 Ga0496100_0450352 3300048903 Archaea 987
537 Ga0496100_1413794 3300048903 Unclassified 549
538 Ga0496101_0070883 3300048904 Bacteria 2553
539 Ga0496101_0159790 3300048904 Bacteria 1728
540 Ga0496101_0679749 3300048904 Bacteria 813
541 Ga0496102_0269420 3300048905 Bacteria 1605
542 Ga0496103_0579940 3300048906 Bacteria 715
543 Ga0496104_0013330 3300048907 Bacteria 7407
544 Ga0496104_0020319 3300048907 Bacteria 6085
545 Ga0496104_0154960 3300048907 Bacteria 2199
546 Ga0496104_0738223 3300048907 Bacteria 892
547 Ga0496105_0030594 3300048908 Bacteria 4411
548 Ga0496105_0064547 3300048908 Bacteria 3021
549 Ga0496105_0077127 3300048908 Bacteria 2752
550 Ga0496106_0037675 3300048909 Bacteria 3618
551 Ga0496106_0127079 3300048909 Bacteria 1997
552 Ga0496106_0200879 3300048909 Bacteria 1586
553 Ga0496106_0428213 3300048909 Unclassified 1063
554 Ga0496106_0977997 3300048909 Unclassified 666
555 Ga0496107_0016684 3300048910 Bacteria 5162
556 Ga0496107_0060010 3300048910 Bacteria 2753
557 Ga0496108_0004028 3300048911 Bacteria 11793
558 Ga0496108_0035069 3300048911 Bacteria 4169
559 Ga0496108_0170363 3300048911 Bacteria 1884
560 Ga0496109_0001846 3300048912 Bacteria 17552
561 Ga0496109_0167109 3300048912 Bacteria 2063
562 Ga0496109_0185147 3300048912 Bacteria 1957
563 Ga0496110_0001102 3300048913 Bacteria 19046
564 Ga0496110_0122855 3300048913 Bacteria 2341
565 Ga0496110_0778056 3300048913 Bacteria 861
566 Ga0496111_0000954 3300048914 Bacteria 15825
567 Ga0496111_0080696 3300048914 Bacteria 2374
568 Ga0496111_0228608 3300048914 Bacteria 1382
569 Ga0496112_0012297 3300048915 Bacteria 7861
570 Ga0496112_0188578 3300048915 Bacteria 2024
571 Ga0496112_0198529 3300048915 Bacteria 1966
572 Ga0496112_0643998 3300048915 Bacteria 990
573 Ga0496113_0172692 3300048916 Bacteria 1712
574 Ga0496114_0063228 3300048917 Bacteria 3098
575 Ga0496114_1231182 3300048917 Bacteria 635
576 Ga0496115_0055505 3300048918 Bacteria 3182
577 Ga0501290_079369 3300049513 Unclassified 557
578 Ga0501292_004315 3300049515 Bacteria 1941
579 Ga0501299_087856 3300049522 Bacteria 701
580 Ga0501299_122953 3300049522 Unclassified 627
581 Ga0501031_0038545 3300049568 Bacteria 3119
582 Ga0501031_0564422 3300049568 Bacteria 733
583 Ga0501033_1189390 3300049570 Bacteria 505
584 Ga0501036_0028391 3300049572 Bacteria 4729
585 Ga0501036_0061087 3300049572 Bacteria 3192
586 Ga0501036_0855581 3300049572 Bacteria 747
587 Ga0501037_0360441 3300049573 Bacteria 1002
588 Ga0501037_0614510 3300049573 Bacteria 729
589 Ga0501038_0759133 3300049574 Bacteria 723
590 Ga0501040_0116438 3300049576 Bacteria 1872
591 Ga0501040_0226057 3300049576 Bacteria 1332
592 Ga0501040_0476389 3300049576 Bacteria 899
593 Ga0501040_0546280 3300049576 Bacteria 836
594 Ga0501040_0653105 3300049576 Unclassified 760
595 Ga0501041_0083530 3300049577 Bacteria 1968
596 Ga0501041_0111791 3300049577 Bacteria 1695
597 Ga0501041_0254373 3300049577 Unclassified 1104
598 Ga0501041_0637095 3300049577 Bacteria 681
599 Ga0501041_0830759 3300049577 Bacteria 593
600 Ga0501042_0049639 3300049578 Bacteria 2994
601 Ga0501042_0300280 3300049578 Bacteria 1160
602 Ga0501042_0316617 3300049578 Unclassified 1127
603 Ga0501042_0825879 3300049578 Bacteria 675
604 Ga0501042_1164273 3300049578 Bacteria 562
605 Ga0501043_0258213 3300049579 Bacteria 1341
606 Ga0501046_0503751 3300049580 Bacteria 867
607 Ga0501048_0394612 3300049582 Bacteria 989
608 Ga0501067_0189672 3300049583 Bacteria 1145
609 Ga0501068_0554837 3300049584 Bacteria 747
610 Ga0501068_1036321 3300049584 Unclassified 542
611 Ga0501070_0852851 3300049586 Bacteria 713
612 Ga0501071_0081426 3300049587 Unclassified 2369
613 Ga0501071_0114847 3300049587 Bacteria 1992
614 Ga0501071_0242716 3300049587 Bacteria 1358
615 Ga0501071_0976001 3300049587 Bacteria 654
616 Ga0501071_1517908 3300049587 Unclassified 517
617 Ga0501072_0041729 3300049588 Bacteria 3604
618 Ga0501072_0048029 3300049588 Bacteria 3361
619 Ga0501072_0431023 3300049588 Unclassified 1045
620 Ga0501072_0542860 3300049588 Bacteria 918
621 Ga0501072_1010481 3300049588 Bacteria 648
622 Ga0501073_0003040 3300049589 Bacteria 12583
623 Ga0501073_0018016 3300049589 Bacteria 5106
624 Ga0501074_0102598 3300049590 Bacteria 2048
625 Ga0501074_0207101 3300049590 Bacteria 1397
626 Ga0501074_0258520 3300049590 Bacteria 1238
627 Ga0501075_0049516 3300049591 Bacteria 3158
628 Ga0501075_0121378 3300049591 Bacteria 1989
629 Ga0501075_0225777 3300049591 Bacteria 1428
630 Ga0501075_0615342 3300049591 Bacteria 828
631 Ga0501075_0762103 3300049591 Bacteria 737
632 Ga0501076_0019323 3300049592 Bacteria 5207
633 Ga0501076_0137576 3300049592 Bacteria 1983
634 Ga0501076_0182934 3300049592 Bacteria 1709
635 Ga0501077_0134659 3300049593 Bacteria 1567
636 Ga0501077_0339421 3300049593 Unclassified 958
637 Ga0501077_0657142 3300049593 Bacteria 673
638 Ga0501202_071022 3300049652 Unclassified 803
639 Ga0501207_125880 3300049654 Bacteria 535
640 Ga0501208_005073 3300049655 Bacteria 1596
641 Ga0501209_193351 3300049656 Unclassified 624
642 Ga0501216_016507 3300049660 Bacteria 1254
643 Ga0501217_009465 3300049661 Bacteria 2121
644 Ga0501217_160379 3300049661 Unclassified 678
645 Ga0501223_104266 3300049663 Unclassified 587
646 Ga0501240_079308 3300049673 Unclassified 606
647 Ga0501248_003954 3300049678 Bacteria 1096
648 Ga0501249_005814 3300049679 Bacteria 2522
649 Ga0501257_009357 3300049686 Unclassified 2211
650 Ga0501260_021454 3300049689 Unclassified 702
651 Ga0501225_0073986 3300049705 Bacteria 971
652 Ga0501079_0027535 3300049741 Bacteria 4359
653 Ga0501079_0325735 3300049741 Bacteria 1203
654 Ga0501079_1639446 3300049741 Bacteria 506
655 Ga0501080_0089572 3300049742 Bacteria 2858
656 Ga0501080_0540964 3300049742 Unclassified 1038
657 Ga0501080_1342376 3300049742 Bacteria 611
658 Ga0501081_0118553 3300049743 Bacteria 1883
659 Ga0501081_0255552 3300049743 Bacteria 1280
660 Ga0501265_054080 3300049762 Unclassified 639
661 Ga0501266_007656 3300049763 Unclassified 1356
662 Ga0501267_053341 3300049764 Unclassified 531
663 Ga0501274_015225 3300049771 Unclassified 753
664 Ga0501035_0743217 3300049822 Bacteria 788
665 Ga0501035_0862966 3300049822 Unclassified 719
666 Ga0501045_0061246 3300049824 Bacteria 2761
667 Ga0501045_0064388 3300049824 Bacteria 2691
668 Ga0501045_0192423 3300049824 Bacteria 1520
669 Ga0501045_0461476 3300049824 Bacteria 944
670 Ga0501045_0799702 3300049824 Bacteria 694
671 nmdc:mga03n38_266970_c1 3300050490 Bacteria 909
672 nmdc:mga0k408_15652_c1 3300050493 Bacteria 4198
673 nmdc:mga0k408_213464_c1 3300050493 Unclassified 1152
674 nmdc:mga0k408_418008_c1 3300050493 Bacteria 797
675 nmdc:mga0k408_455308_c1 3300050493 Unclassified 760
676 nmdc:mga06z11_141222_c1 3300050494 Unclassified 1362
677 nmdc:mga05p37_10687_c1 3300050507 Bacteria 10895
678 nmdc:mga05p37_1281490_c1 3300050507 Bacteria 749
679 nmdc:mga05p37_154728_c1 3300050507 Bacteria 2803
680 nmdc:mga05p37_171660_c1 3300050507 Bacteria 2644
681 nmdc:mga05p37_1976_c1 3300050507 Bacteria 23897
682 nmdc:mga05p37_19814_c1 3300050507 Bacteria 8139
683 nmdc:mga05p37_22697_c1 3300050507 Bacteria 7612
684 nmdc:mga05p37_309308_c1 3300050507 Unclassified 1874
685 nmdc:mga05p37_526088_c1 3300050507 Unclassified 1352
686 nmdc:mga05p37_585099_c1 3300050507 Bacteria 1263
687 nmdc:mga05p37_655616_c1 3300050507 Bacteria 1174
688 nmdc:mga05p37_86402_c1 3300050507 Bacteria 3865
689 nmdc:mga09592_127518_c1 3300050508 Bacteria 2188
690 nmdc:mga09592_1329775_c1 3300050508 Bacteria 590
691 nmdc:mga09592_2613_c1 3300050508 Bacteria 14575
692 nmdc:mga09592_27002_c1 3300050508 Bacteria 4761
693 nmdc:mga09592_308998_c1 3300050508 Bacteria 1370
694 nmdc:mga09592_355668_c1 3300050508 Unclassified 1267
695 nmdc:mga0qj67_173544_c1 3300050509 Unclassified 1751
696 nmdc:mga0qj67_205756_c1 3300050509 Unclassified 1599
697 nmdc:mga0qj67_215937_c1 3300050509 Bacteria 1557
698 nmdc:mga0qj67_363959_c1 3300050509 Bacteria 1168
699 nmdc:mga0qj67_43412_c1 3300050509 Bacteria 3541
700 nmdc:mga0qj67_5741_c1 3300050509 Bacteria 9085
701 nmdc:mga06r32_1057944_c1 3300050510 Unclassified 762
702 nmdc:mga06r32_142625_c1 3300050510 Bacteria 2373
703 nmdc:mga06r32_169093_c1 3300050510 Bacteria 2169
704 nmdc:mga06r32_178119_c1 3300050510 Bacteria 2111
705 nmdc:mga06r32_237906_c1 3300050510 Bacteria 1809
706 nmdc:mga06r32_349348_c1 3300050510 Bacteria 1463
707 nmdc:mga06r32_401350_c1 3300050510 Bacteria 1353
708 nmdc:mga06r32_407433_c1 3300050510 Unclassified 1342
709 nmdc:mga06r32_451928_c1 3300050510 Unclassified 1264
710 nmdc:mga06r32_506831_c1 3300050510 Bacteria 1183
711 nmdc:mga06r32_51723_c1 3300050510 Bacteria 3932
712 nmdc:mga08y16_12185_c1 3300050511 Bacteria 9038
713 nmdc:mga08y16_144753_c1 3300050511 Bacteria 2470
714 nmdc:mga08y16_25391_c1 3300050511 Bacteria 6249
715 nmdc:mga08y16_30515_c1 3300050511 Bacteria 5673
716 nmdc:mga08y16_334919_c1 3300050511 Bacteria 1556
717 nmdc:mga0n895_117210_c1 3300050512 Unclassified 2682
718 nmdc:mga0n895_11_c1 3300050512 Bacteria 112540
719 nmdc:mga0n895_77045_c1 3300050512 Bacteria 3316
720 nmdc:mga0rr50_19_c1 3300050513 Bacteria 158236
721 nmdc:mga0rr50_51867_c1 3300050513 Bacteria 3046
722 nmdc:mga0rr50_562783_c1 3300050513 Bacteria 971
723 nmdc:mga08x19_684_c1 3300050514 Bacteria 21764
724 nmdc:mga0a205_139238_c1 3300050515 Bacteria 2327
725 nmdc:mga0a205_40766_c1 3300050515 Bacteria 4471
726 nmdc:mga0a205_43710_c1 3300050515 Bacteria 4318
727 nmdc:mga0a205_475349_c1 3300050515 Bacteria 1108
728 nmdc:mga0a205_492_c1 3300050515 Bacteria 30923
729 nmdc:mga0a205_81248_c1 3300050515 Bacteria 3131
730 nmdc:mga0a205_973638_c1 3300050515 Unclassified 695
731 Ga0495601_0016644 3300053077 Bacteria 4458
732 Ga0495595_0113182 3300053084 Bacteria 1317
733 Ga0495619_0090727 3300053085 Bacteria 2069
734 Ga0495619_0785717 3300053085 Bacteria 644
735 Ga0495619_1133436 3300053085 Unclassified 520
736 Ga0500627_0236848 3300053158 Unclassified 811
737 Ga0501084_0033548 3300054114 Bacteria 4295
738 Ga0501084_0084650 3300054114 Bacteria 2662
739 Ga0501084_0189565 3300054114 Bacteria 1735
740 Ga0590071_000282 3300059421 Bacteria 14815
741 Ga0590071_002648 3300059421 Bacteria 4495
742 Ga0590071_057714 3300059421 Unclassified 946
743 Ga0590074_001566 3300059423 Bacteria 3716
744 Ga0590074_012018 3300059423 Unclassified 1454
745 Ga0590074_059239 3300059423 Unclassified 710
746 Ga0590075_000872 3300059424 Bacteria 7892
747 Ga0590075_012451 3300059424 Unclassified 2067
748 Ga0590077_000238 3300059426 Bacteria 15670
749 Ga0590077_019677 3300059426 Bacteria 1431
750 Ga0590077_043048 3300059426 Bacteria 1006
751 Ga0501082_0020583 3300060353 Bacteria 5687
752 Ga0501082_0159202 3300060353 Bacteria 1962
753 Ga0501082_0286730 3300060353 Unclassified 1433
754 Ga0501082_0304117 3300060353 Bacteria 1389
755 Ga0501082_1226295 3300060353 Bacteria 655
756 Ga0501082_1987843 3300060353 Bacteria 507
757 Ga0530510_0225442 3300061734 Bacteria 1394
758 Ga0530510_0334695 3300061734 Bacteria 1136
759 Ga0530510_0438268 3300061734 Unclassified 987
760 Ga0075433_10288780
761 CNBas_1003843
762 JGI24743J22301_10007403
763 Ga0065712_10078115
764 Ga0065715_10114194
765 Ga0065715_10352863
766 Ga0065715_10370516
767 Ga0065715_10823409
768 Ga0065707_10159632
769 Ga0065707_10847010
770 Ga0065707_10873261
771 Ga0065707_11120632
772 Ga0065707_11120890
773 Ga0070683_100000326
774 Ga0070683_100684382
775 Ga0070683_100691064
776 Ga0070690_100105546
777 Ga0070670_100015796
778 Ga0070670_100134948
779 Ga0070670_101135722
780 Ga0070670_102124806
781 Ga0070677_10110193
782 Ga0070677_10812037
783 Ga0068869_100328065
784 Ga0070666_10226993
785 Ga0070666_11294679
786 Ga0068868_100069374
787 Ga0068868_100398212
788 Ga0068868_100409156
789 Ga0068868_100654630
790 Ga0070660_100010623
791 Ga0070689_100147713
792 Ga0070689_100764070
793 Ga0070689_101891483
794 Ga0070661_100118749
795 Ga0070692_10687619
796 Ga0070692_10960327
797 Ga0070668_100035387
798 Ga0070668_100689685
799 Ga0070668_101187153
800 Ga0070669_100346036
801 Ga0070669_100436878
802 Ga0070675_100093178
803 Ga0070675_100096084
804 Ga0070675_100191156
805 Ga0070675_100569030
806 Ga0070675_101883273
807 Ga0070671_100045359
808 Ga0070671_100166192
809 Ga0070671_101889175
810 Ga0070674_100056212
811 Ga0070674_101039372
812 Ga0070674_101133389
813 Ga0070673_100179151
814 Ga0070673_100252368
815 Ga0070659_100102874
816 Ga0070659_100404460
817 Ga0070667_100392490
818 Ga0070667_101111488
819 Ga0070667_101120405
820 Ga0070709_11046852
821 Ga0070711_100765433
822 Ga0070705_100195965
823 Ga0070700_100048761
824 Ga0070700_100473916
825 Ga0070700_100652604
826 Ga0070694_100295569
827 Ga0070694_100509917
828 Ga0070708_102205048
829 Ga0070663_100009370
830 Ga0070663_100094814
831 Ga0070663_101086466
832 Ga0070663_101919341
833 Ga0070663_102128918
834 Ga0070678_100065613
835 Ga0070678_100219733
836 Ga0070678_100248166
837 Ga0070678_100315426
838 Ga0070678_101479182
839 Ga0070662_100055615
840 Ga0070662_100125965
841 Ga0070662_100175457
842 Ga0068867_100060799
843 Ga0068867_101233925
844 Ga0070685_10259322
845 Ga0070685_10444545
846 Ga0070707_100410227
847 Ga0070698_102155597
848 Ga0070679_100035626
849 Ga0070684_100000168
850 Ga0070697_102133309
851 Ga0068853_100571975
852 Ga0070672_100089450
853 Ga0070672_100153745
854 Ga0070672_100182666
855 Ga0070672_100621509
856 Ga0070672_101838230
857 Ga0070686_100194559
858 Ga0070686_101854438
859 Ga0070695_101123731
860 Ga0070696_100267437
861 Ga0070696_101042545
862 Ga0070665_100003081
863 Ga0070704_100534838
864 Ga0070704_100770063
865 Ga0070704_101472878
866 Ga0068855_100040397
867 Ga0068855_102086700
868 Ga0070664_100001248
869 Ga0070664_100462277
870 Ga0068854_100749274
871 Ga0068856_100339141
872 Ga0070702_100281581
873 Ga0070702_100771132
874 Ga0070702_101051014
875 Ga0068859_101191366
876 Ga0068859_101394930
877 Ga0068859_101504362
878 Ga0068864_100080988
879 Ga0068864_100322562
880 Ga0068866_10010564
881 Ga0068866_10821403
882 Ga0068861_100120755
883 Ga0068861_100129225
884 Ga0068851_10373252
885 Ga0068851_10982478
886 Ga0068870_10502298
887 Ga0068870_11262569
888 Ga0068863_100869707
889 Ga0068863_101820011
890 Ga0068863_102265533
891 Ga0068858_100011466
892 Ga0068858_100107960
893 Ga0068858_100810043
894 Ga0068858_100895311
895 Ga0068858_101526724
896 Ga0068860_100540305
897 Ga0068860_101713874
898 Ga0068862_100112153
899 Ga0081455_10782728
900 Ga0081538_10225821
901 Ga0075368_10016927
902 Ga0075363_100212204
903 Ga0075363_100703627
904 Ga0075364_10129664
905 Ga0070715_10073808
906 Ga0070716_100037217
907 Ga0075367_10008193
908 Ga0075427_10026819
909 Ga0075366_10018803
910 Ga0075366_10468481
911 Ga0075366_10668243
912 Ga0097621_100048363
913 Ga0097621_100354683
914 Ga0097621_101401014
915 Ga0097621_101563474
916 Ga0075370_10615890
917 Ga0068871_100061183
918 Ga0068871_100123992
919 Ga0068871_101839580
920 Ga0068871_102147946
921 Ga0075428_100069296
922 Ga0075428_100113028
923 Ga0075428_100140578
924 Ga0075428_100172883
925 Ga0075428_100315122
926 Ga0075428_100953696
927 Ga0075430_100020696
928 Ga0075430_100050736
929 Ga0075430_100118799
930 Ga0075430_100193055
931 Ga0075430_100212369
932 Ga0075430_100981376
933 Ga0075431_100008733
934 Ga0075431_100018733
935 Ga0075431_100180630
936 Ga0075431_100195068
937 Ga0075431_100428397
938 Ga0075431_100484231
939 Ga0075431_100671892
940 Ga0075431_100739127
941 Ga0075431_101013868
942 Ga0075431_101060805
943 Ga0075433_10000771
944 Ga0075433_10040318
945 Ga0075434_100001704
946 Ga0075434_100131318
947 Ga0075429_100053275
948 Ga0075429_100205088
949 Ga0075429_100215308
950 Ga0075429_100452712
951 Ga0075429_100717475
952 Ga0075429_100983427
953 Ga0075429_101036845
954 Ga0075429_101614100
955 Ga0068865_100442578
956 Ga0068865_100685015
957 Ga0075436_100005845
958 Ga0097620_101191333
959 Ga0097620_101394995
960 Ga0097620_101504472
961 Ga0075435_100000911
962 Ga0075435_100113300
963 Ga0075435_100137530
964 Ga0075435_100360114
965 Ga0075435_101099284
966 Ga0075435_101173563
967 Ga0111539_10013664
968 Ga0111539_10029838
969 Ga0111539_10198464
970 Ga0111539_10225729
971 Ga0111539_10314865
972 Ga0111539_10618602
973 Ga0111539_10958020
974 Ga0111539_11134599
975 Ga0111539_13405019
976 Ga0105245_10107633
977 Ga0105245_10575990
978 Ga0105245_12070183
979 Ga0105247_10047760
980 Ga0105247_10203235
981 Ga0105247_10608264
982 Ga0114129_10002530
983 Ga0114129_10007226
984 Ga0114129_10011087
985 Ga0114129_10024673
986 Ga0114129_10046338
987 Ga0114129_10296290
988 Ga0114129_10475970
989 Ga0114129_10906049
990 Ga0114129_11027934
991 Ga0114129_11401400
992 Ga0114129_12844577
993 Ga0105243_10457102
994 Ga0105241_11001518
995 Ga0105241_11246342
996 Ga0105241_11287008
997 Ga0105242_10042859
998 Ga0105248_10055504
999 Ga0105248_10081580
1000 Ga0105248_10141958
1001 Ga0105248_10739565
1002 Ga0105248_10743220
1003 Ga0105248_11475166
1004 Ga0105248_11719719
1005 Ga0105238_10810504
1006 Ga0105238_11728478
1007 Ga0105238_11816921
1008 Ga0105249_11599349
1009 Ga0099796_10136619
1010 Ga0105239_11792903
1011 Ga0105239_12329495
1012 Ga0105239_12973092
1013 Ga0105246_11545096
1014 Ga0105246_11736624
1015 Ga0105246_11963275
1016 Ga0157374_10209043
1017 Ga0157374_10243285
1018 Ga0157374_10400544
1019 Ga0157374_11639395
1020 Ga0157378_10089055
1021 Ga0157378_10238622
1022 Ga0157378_11487976
1023 Ga0163162_10539620
1024 Ga0163162_11483403
1025 Ga0163162_12415746
1026 Ga0163162_13308438
1027 Ga0163162_13441198
1028 Ga0157375_10113069
1029 Ga0157375_10526351
1030 Ga0157375_11005624
1031 Ga0163163_10028350
1032 Ga0163163_10094081
1033 Ga0163163_10192095
1034 Ga0163163_10536616
1035 Ga0157380_10001199
1036 Ga0157380_10067669
1037 Ga0157380_10114556
1038 Ga0157380_10332375
1039 Ga0157380_10695283
1040 Ga0157377_10074597
1041 Ga0157377_10214080
1042 Ga0157377_10449125
1043 Ga0157379_10011179
1044 Ga0157379_11024874
1045 Ga0157379_12022386
1046 Ga0157379_12305976
1047 Ga0157376_10160194
1048 Ga0157376_10475218
1049 Ga0157376_11782789
1050 Ga0157376_11935151
1051 Ga0163161_10100993
1052 Ga0207666_1051313
1053 Ga0207697_10001132
1054 Ga0207697_10009543
1055 Ga0207682_10471471
1056 Ga0207642_10307453
1057 Ga0207710_10155432
1058 Ga0207688_10002580
1059 Ga0207680_10717522
1060 Ga0207680_10799279
1061 Ga0207647_10360573
1062 Ga0207643_10024064
1063 Ga0207643_10312324
1064 Ga0207643_10931367
1065 Ga0207705_10210281
1066 Ga0207660_10246087
1067 Ga0207660_10833443
1068 Ga0207657_10007831
1069 Ga0207657_11099761
1070 Ga0207657_11340641
1071 Ga0207649_10197030
1072 Ga0207649_10331016
1073 Ga0207652_10192850
1074 Ga0207646_11088414
1075 Ga0207681_10231547
1076 Ga0207681_11407692
1077 Ga0207694_10356930
1078 Ga0207694_10785116
1079 Ga0207650_10015328
1080 Ga0207650_10576014
1081 Ga0207650_11053801
1082 Ga0207659_10000072
1083 Ga0207659_10020558
1084 Ga0207659_10125333
1085 Ga0207659_10381905
1086 Ga0207659_10389550
1087 Ga0207687_10009098
1088 Ga0207687_10493315
1089 Ga0207687_10822312
1090 Ga0207644_10030125
1091 Ga0207690_10171404
1092 Ga0207706_10026758
1093 Ga0207706_10480077
1094 Ga0207706_11458323
1095 Ga0207686_10041899
1096 Ga0207709_10738308
1097 Ga0207669_10047363
1098 Ga0207669_10114216
1099 Ga0207669_10262142
1100 Ga0207669_11032558
1101 Ga0207704_10233042
1102 Ga0207704_10252240
1103 Ga0207665_10294494
1104 Ga0207691_10100493
1105 Ga0207691_10168968
1106 Ga0207691_11338803
1107 Ga0207711_10037678
1108 Ga0207711_10177851
1109 Ga0207711_10277044
1110 Ga0207711_10498579
1111 Ga0207711_10826721
1112 Ga0207711_10947338
1113 Ga0207689_10029381
1114 Ga0207661_10047767
1115 Ga0207661_10368723
1116 Ga0207661_11400421
1117 Ga0207679_10005466
1118 Ga0207679_10678247
1119 Ga0207667_11348458
1120 Ga0207651_10154198
1121 Ga0207651_10331791
1122 Ga0207651_10935455
1123 Ga0207651_10985694
1124 Ga0207668_10696401
1125 Ga0207668_10796531
1126 Ga0207668_10885823
1127 Ga0207658_10088819
1128 Ga0207658_10686631
1129 Ga0207658_11044405
1130 Ga0207658_11155696
1131 Ga0207677_10063247
1132 Ga0207677_10182354
1133 Ga0207677_10398381
1134 Ga0207677_10489755
1135 Ga0207703_10008225
1136 Ga0207703_10080469
1137 Ga0207703_10564723
1138 Ga0207703_11804814
1139 Ga0207678_10003620
1140 Ga0207678_10053420
1141 Ga0207678_11375602
1142 Ga0207708_10054229
1143 Ga0207708_10080785
1144 Ga0207708_10243146
1145 Ga0207708_11343621
1146 Ga0207702_12033906
1147 Ga0207641_10574043
1148 Ga0207641_11659070
1149 Ga0207648_10050261
1150 Ga0207648_10258142
1151 Ga0207648_10516875
1152 Ga0207648_11641130
1153 Ga0207676_10105923
1154 Ga0207675_100126025
1155 Ga0207675_100570144
1156 Ga0207675_100738006
1157 Ga0207675_102080247
1158 Ga0207683_10036397
1159 Ga0207683_10129472
1160 Ga0207683_10271199
1161 Ga0207683_10361520
1162 Ga0207683_10475390
1163 Ga0207683_10633216
1164 Ga0207683_11512853
1165 Ga0207698_12050750
1166 Ga0210002_1108185
1167 Ga0209971_1013625
1168 Ga0209813_10021164
1169 Ga0207428_10000349
1170 Ga0207428_10001421
1171 Ga0207428_10272884
1172 Ga0207428_10413321
1173 Ga0207428_10452463
1174 Ga0268266_10034103
1175 Ga0268265_10097260
1176 Ga0268264_10051010
1177 Ga0268264_10102969
1178 Ga0268264_12116601
1179 Ga0316182_1235704
1180 Ga0307408_100066147
1181 Ga0307408_100078654
1182 Ga0307408_100080827
1183 Ga0307408_100095825
1184 Ga0307408_100219797
1185 Ga0307405_10036153
1186 Ga0307405_10080671
1187 Ga0307405_10607384
1188 Ga0307405_12059691
1189 Ga0307413_10114741
1190 Ga0307413_10224312
1191 Ga0307413_10406348
1192 Ga0307413_10850029
1193 Ga0307410_10035916
1194 Ga0307410_12035950
1195 Ga0326468_10092630
1196 Ga0307406_10028273
1197 Ga0307406_10376173
1198 Ga0307406_11242858
1199 Ga0307407_10009129
1200 Ga0307407_10631654
1201 Ga0307412_10114833
1202 Ga0307412_10162863
1203 Ga0307412_10461052
1204 Ga0307412_10887862
1205 Ga0307409_100022487
1206 Ga0307409_100053923
1207 Ga0307409_100184355
1208 Ga0307416_100009915
1209 Ga0307416_100131865
1210 Ga0307416_100152662
1211 Ga0307416_100611864
1212 Ga0307416_101829780
1213 Ga0307416_102829985
1214 Ga0307414_10504791
1215 Ga0307411_10012530
1216 Ga0307411_10045602
1217 Ga0307411_10485352
1218 Ga0307411_11161704
1219 Ga0307415_100014778
1220 Ga0307415_100229743
1221 Ga0307415_101353044
1222 Ga0373938_0131647
1223 Ga0373936_0195563
1224 Ga0373945_0394042
1225 Ga0373957_0283306
1226 Ga0373955_0058623
1227 Ga0373955_0155408
1228 Ga0373924_0101121
1229 Ga0373924_0174460
1230 Ga0373937_0914014
1231 Ga0373937_1514872
1232 Ga0373925_0093282
1233 Ga0439439_0078492
1234 Ga0451789_0595895
1235 Ga0451802_0768188
1236 Ga0451807_0778831
1237 Ga0451835_0438836
1238 Ga0451847_0782458
1239 Ga0439431_0174928
1240 Ga0439433_0032060
1241 Ga0439450_015363
1242 Ga0439457_116712
1243 Ga0450920_025211
1244 Ga0450896_100382
1245 Ga0439446_0011701
1246 Ga0439446_0075128
1247 Ga0450909_080264
1248 Ga0439435_0003643
1249 Ga0439435_0007210
1250 Ga0439435_0027227
1251 Ga0439435_0074968
1252 Ga0439444_0011728
1253 Ga0439444_0129858
1254 Ga0439464_0005212
1255 Ga0439464_0036368
1256 Ga0439464_0056942
1257 Ga0439460_0037630
1258 Ga0439460_0043518
1259 Ga0439460_0111184
1260 Ga0450916_005686
1261 Ga0450893_0131545
1262 Ga0451577_0049297
1263 Ga0453684_0020035
1264 Ga0453684_2070040
1265 Ga0451576_0323658
1266 Ga0451576_0583309
1267 Ga0451576_2465000
1268 Ga0466967_1548566
1269 Ga0495603_0203919
1270 Ga0495629_0411542
1271 Ga0495629_0432018
1272 Ga0495641_0477982
1273 Ga0495639_0133207
1274 Ga0495662_0321692
1275 Ga0495630_0538279
1276 Ga0495586_0091873
1277 Ga0495587_0502414
1278 Ga0495645_0148883
1279 Ga0495633_0575595
1280 Ga0495667_0700153
1281 Ga0495656_0457040
1282 Ga0495668_0185133
1283 Ga0495634_0403075
1284 Ga0495635_0139161
1285 Ga0495659_0108682
1286 Ga0495647_0009823
1287 Ga0495647_0096514
1288 Ga0495658_0315868
1289 Ga0495670_0357219
1290 Ga0495649_0575289
1291 Ga0495649_0630844
1292 Ga0495600_0058500
1293 Ga0495674_0819465
1294 Ga0495680_0657072
1295 Ga0496100_0450352
1296 Ga0496100_1413794
1297 Ga0496101_0070883
1298 Ga0496101_0159790
1299 Ga0496101_0679749
1300 Ga0496102_0269420
1301 Ga0496103_0579940
1302 Ga0496104_0013330
1303 Ga0496104_0020319
1304 Ga0496104_0154960
1305 Ga0496104_0738223
1306 Ga0496105_0030594
1307 Ga0496105_0064547
1308 Ga0496105_0077127
1309 Ga0496106_0037675
1310 Ga0496106_0127079
1311 Ga0496106_0200879
1312 Ga0496106_0428213
1313 Ga0496106_0977997
1314 Ga0496107_0016684
1315 Ga0496107_0060010
1316 Ga0496108_0004028
1317 Ga0496108_0035069
1318 Ga0496108_0170363
1319 Ga0496109_0001846
1320 Ga0496109_0167109
1321 Ga0496109_0185147
1322 Ga0496110_0001102
1323 Ga0496110_0122855
1324 Ga0496110_0778056
1325 Ga0496111_0000954
1326 Ga0496111_0080696
1327 Ga0496111_0228608
1328 Ga0496112_0012297
1329 Ga0496112_0188578
1330 Ga0496112_0198529
1331 Ga0496112_0643998
1332 Ga0496113_0172692
1333 Ga0496114_0063228
1334 Ga0496114_1231182
1335 Ga0496115_0055505
1336 Ga0501290_079369
1337 Ga0501292_004315
1338 Ga0501299_087856
1339 Ga0501299_122953
1340 Ga0501031_0038545
1341 Ga0501031_0564422
1342 Ga0501033_1189390
1343 Ga0501036_0028391
1344 Ga0501036_0061087
1345 Ga0501036_0855581
1346 Ga0501037_0360441
1347 Ga0501037_0614510
1348 Ga0501038_0759133
1349 Ga0501040_0116438
1350 Ga0501040_0226057
1351 Ga0501040_0476389
1352 Ga0501040_0546280
1353 Ga0501040_0653105
1354 Ga0501041_0083530
1355 Ga0501041_0111791
1356 Ga0501041_0254373
1357 Ga0501041_0637095
1358 Ga0501041_0830759
1359 Ga0501042_0049639
1360 Ga0501042_0300280
1361 Ga0501042_0316617
1362 Ga0501042_0825879
1363 Ga0501042_1164273
1364 Ga0501043_0258213
1365 Ga0501046_0503751
1366 Ga0501048_0394612
1367 Ga0501067_0189672
1368 Ga0501068_0554837
1369 Ga0501068_1036321
1370 Ga0501070_0852851
1371 Ga0501071_0081426
1372 Ga0501071_0114847
1373 Ga0501071_0242716
1374 Ga0501071_0976001
1375 Ga0501071_1517908
1376 Ga0501072_0041729
1377 Ga0501072_0048029
1378 Ga0501072_0431023
1379 Ga0501072_0542860
1380 Ga0501072_1010481
1381 Ga0501073_0003040
1382 Ga0501073_0018016
1383 Ga0501074_0102598
1384 Ga0501074_0207101
1385 Ga0501074_0258520
1386 Ga0501075_0049516
1387 Ga0501075_0121378
1388 Ga0501075_0225777
1389 Ga0501075_0615342
1390 Ga0501075_0762103
1391 Ga0501076_0019323
1392 Ga0501076_0137576
1393 Ga0501076_0182934
1394 Ga0501077_0134659
1395 Ga0501077_0339421
1396 Ga0501077_0657142
1397 Ga0501202_071022
1398 Ga0501207_125880
1399 Ga0501208_005073
1400 Ga0501209_193351
1401 Ga0501216_016507
1402 Ga0501217_009465
1403 Ga0501217_160379
1404 Ga0501223_104266
1405 Ga0501240_079308
1406 Ga0501248_003954
1407 Ga0501249_005814
1408 Ga0501257_009357
1409 Ga0501260_021454
1410 Ga0501225_0073986
1411 Ga0501079_0027535
1412 Ga0501079_0325735
1413 Ga0501079_1639446
1414 Ga0501080_0089572
1415 Ga0501080_0540964
1416 Ga0501080_1342376
1417 Ga0501081_0118553
1418 Ga0501081_0255552
1419 Ga0501265_054080
1420 Ga0501266_007656
1421 Ga0501267_053341
1422 Ga0501274_015225
1423 Ga0501035_0743217
1424 Ga0501035_0862966
1425 Ga0501045_0061246
1426 Ga0501045_0064388
1427 Ga0501045_0192423
1428 Ga0501045_0461476
1429 Ga0501045_0799702
1430 nmdc:mga03n38_266970_c1
1431 nmdc:mga0k408_15652_c1
1432 nmdc:mga0k408_213464_c1
1433 nmdc:mga0k408_418008_c1
1434 nmdc:mga0k408_455308_c1
1435 nmdc:mga06z11_141222_c1
1436 nmdc:mga05p37_10687_c1
1437 nmdc:mga05p37_1281490_c1
1438 nmdc:mga05p37_154728_c1
1439 nmdc:mga05p37_171660_c1
1440 nmdc:mga05p37_1976_c1
1441 nmdc:mga05p37_19814_c1
1442 nmdc:mga05p37_22697_c1
1443 nmdc:mga05p37_309308_c1
1444 nmdc:mga05p37_526088_c1
1445 nmdc:mga05p37_585099_c1
1446 nmdc:mga05p37_655616_c1
1447 nmdc:mga05p37_86402_c1
1448 nmdc:mga09592_127518_c1
1449 nmdc:mga09592_1329775_c1
1450 nmdc:mga09592_2613_c1
1451 nmdc:mga09592_27002_c1
1452 nmdc:mga09592_308998_c1
1453 nmdc:mga09592_355668_c1
1454 nmdc:mga0qj67_173544_c1
1455 nmdc:mga0qj67_205756_c1
1456 nmdc:mga0qj67_215937_c1
1457 nmdc:mga0qj67_363959_c1
1458 nmdc:mga0qj67_43412_c1
1459 nmdc:mga0qj67_5741_c1
1460 nmdc:mga06r32_1057944_c1
1461 nmdc:mga06r32_142625_c1
1462 nmdc:mga06r32_169093_c1
1463 nmdc:mga06r32_178119_c1
1464 nmdc:mga06r32_237906_c1
1465 nmdc:mga06r32_349348_c1
1466 nmdc:mga06r32_401350_c1
1467 nmdc:mga06r32_407433_c1
1468 nmdc:mga06r32_451928_c1
1469 nmdc:mga06r32_506831_c1
1470 nmdc:mga06r32_51723_c1
1471 nmdc:mga08y16_12185_c1
1472 nmdc:mga08y16_144753_c1
1473 nmdc:mga08y16_25391_c1
1474 nmdc:mga08y16_30515_c1
1475 nmdc:mga08y16_334919_c1
1476 nmdc:mga0n895_117210_c1
1477 nmdc:mga0n895_11_c1
1478 nmdc:mga0n895_77045_c1
1479 nmdc:mga0rr50_19_c1
1480 nmdc:mga0rr50_51867_c1
1481 nmdc:mga0rr50_562783_c1
1482 nmdc:mga08x19_684_c1
1483 nmdc:mga0a205_139238_c1
1484 nmdc:mga0a205_40766_c1
1485 nmdc:mga0a205_43710_c1
1486 nmdc:mga0a205_475349_c1
1487 nmdc:mga0a205_492_c1
1488 nmdc:mga0a205_81248_c1
1489 nmdc:mga0a205_973638_c1
1490 Ga0495601_0016644
1491 Ga0495595_0113182
1492 Ga0495619_0090727
1493 Ga0495619_0785717
1494 Ga0495619_1133436
1495 Ga0500627_0236848
1496 Ga0501084_0033548
1497 Ga0501084_0084650
1498 Ga0501084_0189565
1499 Ga0590071_000282
1500 Ga0590071_002648
1501 Ga0590071_057714
1502 Ga0590074_001566
1503 Ga0590074_012018
1504 Ga0590074_059239
1505 Ga0590075_000872
1506 Ga0590075_012451
1507 Ga0590077_000238
1508 Ga0590077_019677
1509 Ga0590077_043048
1510 Ga0501082_0020583
1511 Ga0501082_0159202
1512 Ga0501082_0286730
1513 Ga0501082_0304117
1514 Ga0501082_1226295
1515 Ga0501082_1987843
1516 Ga0530510_0225442
1517 Ga0530510_0334695
1518 Ga0530510_0438268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map