F479346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 756 | 242 | 756 | 271 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100357535|Ga0207675_1003575352 |
| Length | 308 |
| Sequence | MYPILFRIWNFPVNTYGVFLALGFLGAIYVTVRLGVRDGLPRERIYDLCLWLLLSSLIGSKLLMLFTEPEYRQNPRLLFSLDFLRSGGVFYGGLIGAVVVAYLLMRHWKLPWWKTADACAPGISLGLFFGRQGCFAAGCCWGKPTNLPWGVQFTQAGHDVTDVPINAHLHPTQLYESFAMLIVFCFLLWLHKKKKFSGQVILVYAVIYATVRFLIEFVRDDPRGDLLGLTSLTGLSTSQMIGLVVGVPALILLVIRWRRAVDDRRAQRLHDQPLRADPGHGPGETAALIPPLYRLGSAGWGTSLNSNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 189 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 192 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 193 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 194 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 195 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 196 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 203 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 212 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 213 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 214 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 215 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 216 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 217 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 221 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 224 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 225 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 226 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 227 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 229 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 230 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 231 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 232 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 242 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 1.59 |
| Rhizosphere | 97.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1818041 | 2162886006 | Unclassified | 1114 |
| 2 | SwRhRL3b_contig_3769909 | 2162886006 | Unclassified | 1116 |
| 3 | SwRhRL3b_contig_4315247 | 2162886006 | Unclassified | 1025 |
| 4 | SwRhRL3b_contig_657186 | 2162886006 | Unclassified | 924 |
| 5 | SwRhRL2b_contig_2665322 | 2162886007 | Bacteria | 1830 |
| 6 | CNAas_1000304 | 3300000532 | Bacteria | 4722 |
| 7 | JGI24034J14986_100233 | 3300001432 | Unclassified | 3022 |
| 8 | JGI24748J21848_1000010 | 3300002074 | Bacteria | 166979 |
| 9 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 10 | rootL2_10159794 | 3300003322 | Bacteria | 5065 |
| 11 | Ga0065714_10064605 | 3300005288 | Bacteria | 29427 |
| 12 | Ga0065704_10115131 | 3300005289 | Unclassified | 1877 |
| 13 | Ga0065704_10195398 | 3300005289 | Unclassified | 1170 |
| 14 | Ga0065712_10014908 | 3300005290 | Bacteria | 2758 |
| 15 | Ga0065712_10067817 | 3300005290 | Bacteria | 29447 |
| 16 | Ga0065715_10022399 | 3300005293 | Bacteria | 1503 |
| 17 | Ga0065715_10040462 | 3300005293 | Unclassified | 1426 |
| 18 | Ga0065715_10049877 | 3300005293 | Bacteria | 1266 |
| 19 | Ga0065715_10090255 | 3300005293 | Bacteria | 7339 |
| 20 | Ga0065715_10091791 | 3300005293 | Bacteria | 5537 |
| 21 | Ga0065715_10111101 | 3300005293 | Bacteria | 2523 |
| 22 | Ga0065715_10134000 | 3300005293 | Bacteria | 1962 |
| 23 | Ga0065715_10172415 | 3300005293 | Unclassified | 1537 |
| 24 | Ga0065707_10012515 | 3300005295 | Bacteria | 1919 |
| 25 | Ga0065707_10094651 | 3300005295 | Bacteria | 3470 |
| 26 | Ga0065707_10098569 | 3300005295 | Bacteria | 3075 |
| 27 | Ga0065707_10184306 | 3300005295 | Bacteria | 1398 |
| 28 | Ga0070690_100001562 | 3300005330 | Bacteria | 12009 |
| 29 | Ga0070690_100029550 | 3300005330 | Bacteria | 3400 |
| 30 | Ga0070690_100074788 | 3300005330 | Bacteria | 2207 |
| 31 | Ga0070670_100003915 | 3300005331 | Bacteria | 12419 |
| 32 | Ga0070670_100022633 | 3300005331 | Bacteria | 5408 |
| 33 | Ga0070670_100222270 | 3300005331 | Unclassified | 1643 |
| 34 | Ga0068869_100012844 | 3300005334 | Bacteria | 5544 |
| 35 | Ga0068869_100021665 | 3300005334 | Bacteria | 4423 |
| 36 | Ga0068869_100094004 | 3300005334 | Bacteria | 2259 |
| 37 | Ga0068869_100127430 | 3300005334 | Bacteria | 1953 |
| 38 | Ga0068869_100156164 | 3300005334 | Unclassified | 1773 |
| 39 | Ga0068869_100202923 | 3300005334 | Bacteria | 1564 |
| 40 | Ga0068869_100269679 | 3300005334 | Unclassified | 1365 |
| 41 | Ga0070666_10405155 | 3300005335 | Unclassified | 981 |
| 42 | Ga0070680_100068866 | 3300005336 | Bacteria | 2905 |
| 43 | Ga0070682_100000048 | 3300005337 | Bacteria | 129542 |
| 44 | Ga0070682_100433228 | 3300005337 | Bacteria | 1003 |
| 45 | Ga0068868_100057771 | 3300005338 | Bacteria | 3066 |
| 46 | Ga0070689_100001010 | 3300005340 | Bacteria | 17645 |
| 47 | Ga0070689_100261285 | 3300005340 | Bacteria | 1431 |
| 48 | Ga0070691_10219344 | 3300005341 | Unclassified | 1007 |
| 49 | Ga0070687_100033725 | 3300005343 | Bacteria | 2529 |
| 50 | Ga0070687_100110792 | 3300005343 | Bacteria | 1553 |
| 51 | Ga0070687_100168368 | 3300005343 | Bacteria | 1302 |
| 52 | Ga0070661_100157254 | 3300005344 | Bacteria | 1720 |
| 53 | Ga0070661_100174773 | 3300005344 | Bacteria | 1632 |
| 54 | Ga0070692_10047476 | 3300005345 | Unclassified | 2222 |
| 55 | Ga0070692_10060861 | 3300005345 | Bacteria | 1989 |
| 56 | Ga0070692_10095891 | 3300005345 | Bacteria | 1619 |
| 57 | Ga0070692_10108091 | 3300005345 | Unclassified | 1535 |
| 58 | Ga0070668_100001615 | 3300005347 | Bacteria | 16312 |
| 59 | Ga0070669_100006486 | 3300005353 | Bacteria | 8426 |
| 60 | Ga0070669_100006636 | 3300005353 | Bacteria | 8334 |
| 61 | Ga0070669_100023676 | 3300005353 | Unclassified | 4399 |
| 62 | Ga0070669_100083977 | 3300005353 | Bacteria | 2375 |
| 63 | Ga0070669_100113465 | 3300005353 | Bacteria | 2059 |
| 64 | Ga0070669_100511382 | 3300005353 | Unclassified | 997 |
| 65 | Ga0070675_100109678 | 3300005354 | Bacteria | 2333 |
| 66 | Ga0070675_100165738 | 3300005354 | Bacteria | 1903 |
| 67 | Ga0070675_100216495 | 3300005354 | Bacteria | 1667 |
| 68 | Ga0070671_100000822 | 3300005355 | Bacteria | 22486 |
| 69 | Ga0070671_100065096 | 3300005355 | Bacteria | 3036 |
| 70 | Ga0070671_100174259 | 3300005355 | Bacteria | 1820 |
| 71 | Ga0070674_100061892 | 3300005356 | Bacteria | 2614 |
| 72 | Ga0070673_100049770 | 3300005364 | Bacteria | 3273 |
| 73 | Ga0070673_100051504 | 3300005364 | Bacteria | 3225 |
| 74 | Ga0070673_100358862 | 3300005364 | Unclassified | 1295 |
| 75 | Ga0070673_100370000 | 3300005364 | Unclassified | 1276 |
| 76 | Ga0070673_100495983 | 3300005364 | Unclassified | 1104 |
| 77 | Ga0070688_100015714 | 3300005365 | Bacteria | 4314 |
| 78 | Ga0070688_100065383 | 3300005365 | Bacteria | 2311 |
| 79 | Ga0070667_100149791 | 3300005367 | Bacteria | 2049 |
| 80 | Ga0070703_10000070 | 3300005406 | Bacteria | 51916 |
| 81 | Ga0070703_10002781 | 3300005406 | Bacteria | 5012 |
| 82 | Ga0070709_10381179 | 3300005434 | Bacteria | 1048 |
| 83 | Ga0070701_10029396 | 3300005438 | Bacteria | 2710 |
| 84 | Ga0070701_10055113 | 3300005438 | Bacteria | 2075 |
| 85 | Ga0070705_100005049 | 3300005440 | Bacteria | 6423 |
| 86 | Ga0070705_100051410 | 3300005440 | Bacteria | 2403 |
| 87 | Ga0070705_100153536 | 3300005440 | Bacteria | 1530 |
| 88 | Ga0070700_100000055 | 3300005441 | Bacteria | 83561 |
| 89 | Ga0070700_100132399 | 3300005441 | Bacteria | 1684 |
| 90 | Ga0070700_100214623 | 3300005441 | Bacteria | 1360 |
| 91 | Ga0070694_100008982 | 3300005444 | Bacteria | 6122 |
| 92 | Ga0070694_100010819 | 3300005444 | Bacteria | 5644 |
| 93 | Ga0070694_100012777 | 3300005444 | Bacteria | 5231 |
| 94 | Ga0070694_100019372 | 3300005444 | Bacteria | 4326 |
| 95 | Ga0070694_100051152 | 3300005444 | Bacteria | 2788 |
| 96 | Ga0070694_100138108 | 3300005444 | Bacteria | 1768 |
| 97 | Ga0070694_100257655 | 3300005444 | Bacteria | 1322 |
| 98 | Ga0070694_100265247 | 3300005444 | Bacteria | 1304 |
| 99 | Ga0070694_100311291 | 3300005444 | Bacteria | 1209 |
| 100 | Ga0070708_100111246 | 3300005445 | Bacteria | 2518 |
| 101 | Ga0070708_100125261 | 3300005445 | Bacteria | 2374 |
| 102 | Ga0070708_100216027 | 3300005445 | Bacteria | 1797 |
| 103 | Ga0070678_100106093 | 3300005456 | Bacteria | 2188 |
| 104 | Ga0070678_100254832 | 3300005456 | Bacteria | 1473 |
| 105 | Ga0070662_100038792 | 3300005457 | Bacteria | 3385 |
| 106 | Ga0070662_100530766 | 3300005457 | Unclassified | 984 |
| 107 | Ga0070681_10000523 | 3300005458 | Bacteria | 31450 |
| 108 | Ga0070681_10001765 | 3300005458 | Bacteria | 19390 |
| 109 | Ga0070681_10022640 | 3300005458 | Bacteria | 6311 |
| 110 | Ga0068867_100024527 | 3300005459 | Bacteria | 4322 |
| 111 | Ga0068867_100077899 | 3300005459 | Unclassified | 2492 |
| 112 | Ga0068867_100091425 | 3300005459 | Bacteria | 2310 |
| 113 | Ga0068867_100460414 | 3300005459 | Bacteria | 1086 |
| 114 | Ga0070685_10016990 | 3300005466 | Bacteria | 3887 |
| 115 | Ga0070706_100000138 | 3300005467 | Bacteria | 91724 |
| 116 | Ga0070706_100001203 | 3300005467 | Bacteria | 27707 |
| 117 | Ga0070706_100001891 | 3300005467 | Bacteria | 21615 |
| 118 | Ga0070706_100131249 | 3300005467 | Bacteria | 2338 |
| 119 | Ga0070706_100154941 | 3300005467 | Unclassified | 2139 |
| 120 | Ga0070706_100176850 | 3300005467 | Bacteria | 1992 |
| 121 | Ga0070706_100223324 | 3300005467 | Bacteria | 1758 |
| 122 | Ga0070706_100516116 | 3300005467 | Unclassified | 1111 |
| 123 | Ga0070707_100000197 | 3300005468 | Bacteria | 60425 |
| 124 | Ga0070707_100018624 | 3300005468 | Bacteria | 6534 |
| 125 | Ga0070707_100061112 | 3300005468 | Bacteria | 3613 |
| 126 | Ga0070707_100096224 | 3300005468 | Bacteria | 2868 |
| 127 | Ga0070707_100104173 | 3300005468 | Bacteria | 2750 |
| 128 | Ga0070707_100188487 | 3300005468 | Bacteria | 2011 |
| 129 | Ga0070707_100203006 | 3300005468 | Bacteria | 1932 |
| 130 | Ga0070707_100297633 | 3300005468 | Bacteria | 1568 |
| 131 | Ga0070698_100003095 | 3300005471 | Bacteria | 18340 |
| 132 | Ga0070698_100005783 | 3300005471 | Bacteria | 13528 |
| 133 | Ga0070698_100006823 | 3300005471 | Bacteria | 12375 |
| 134 | Ga0070698_100008698 | 3300005471 | Bacteria | 10936 |
| 135 | Ga0070698_100072848 | 3300005471 | Bacteria | 3442 |
| 136 | Ga0070698_100133050 | 3300005471 | Bacteria | 2441 |
| 137 | Ga0070698_100155226 | 3300005471 | Bacteria | 2234 |
| 138 | Ga0070698_100180858 | 3300005471 | Bacteria | 2047 |
| 139 | Ga0070698_100211080 | 3300005471 | Unclassified | 1876 |
| 140 | Ga0070698_100345531 | 3300005471 | Unclassified | 1419 |
| 141 | Ga0070698_100549674 | 3300005471 | Bacteria | 1094 |
| 142 | Ga0070699_100036747 | 3300005518 | Bacteria | 4237 |
| 143 | Ga0070699_100114781 | 3300005518 | Bacteria | 2366 |
| 144 | Ga0070699_100240871 | 3300005518 | Bacteria | 1614 |
| 145 | Ga0070699_100349043 | 3300005518 | Unclassified | 1333 |
| 146 | Ga0070679_100001109 | 3300005530 | Bacteria | 23549 |
| 147 | Ga0070679_100009165 | 3300005530 | Bacteria | 9344 |
| 148 | Ga0070697_100000089 | 3300005536 | Bacteria | 76112 |
| 149 | Ga0070697_100000839 | 3300005536 | Bacteria | 23076 |
| 150 | Ga0070697_100006751 | 3300005536 | Bacteria | 8900 |
| 151 | Ga0070697_100021115 | 3300005536 | Bacteria | 5157 |
| 152 | Ga0070697_100030854 | 3300005536 | Bacteria | 4307 |
| 153 | Ga0070697_100082386 | 3300005536 | Bacteria | 2652 |
| 154 | Ga0070697_100130094 | 3300005536 | Bacteria | 2111 |
| 155 | Ga0070697_100173736 | 3300005536 | Bacteria | 1824 |
| 156 | Ga0068853_100034814 | 3300005539 | Bacteria | 4276 |
| 157 | Ga0068853_100037988 | 3300005539 | Bacteria | 4100 |
| 158 | Ga0068853_100141786 | 3300005539 | Bacteria | 2158 |
| 159 | Ga0070672_100022167 | 3300005543 | Unclassified | 4659 |
| 160 | Ga0070672_100037399 | 3300005543 | Bacteria | 3703 |
| 161 | Ga0070686_100000559 | 3300005544 | Bacteria | 22205 |
| 162 | Ga0070686_100002856 | 3300005544 | Bacteria | 9512 |
| 163 | Ga0070686_100033399 | 3300005544 | Unclassified | 3161 |
| 164 | Ga0070686_100058582 | 3300005544 | Bacteria | 2478 |
| 165 | Ga0070695_100048122 | 3300005545 | Unclassified | 2726 |
| 166 | Ga0070695_100069698 | 3300005545 | Bacteria | 2299 |
| 167 | Ga0070695_100090543 | 3300005545 | Unclassified | 2041 |
| 168 | Ga0070695_100101837 | 3300005545 | Unclassified | 1935 |
| 169 | Ga0070695_100166542 | 3300005545 | Unclassified | 1552 |
| 170 | Ga0070695_100264258 | 3300005545 | Bacteria | 1258 |
| 171 | Ga0070696_100015591 | 3300005546 | Bacteria | 5106 |
| 172 | Ga0070696_100019299 | 3300005546 | Bacteria | 4616 |
| 173 | Ga0070696_100074018 | 3300005546 | Unclassified | 2401 |
| 174 | Ga0070696_100082247 | 3300005546 | Bacteria | 2282 |
| 175 | Ga0070696_100210271 | 3300005546 | Unclassified | 1456 |
| 176 | Ga0070696_100348814 | 3300005546 | Bacteria | 1146 |
| 177 | Ga0070696_100370023 | 3300005546 | Bacteria | 1114 |
| 178 | Ga0070696_100389555 | 3300005546 | Unclassified | 1088 |
| 179 | Ga0070693_100006979 | 3300005547 | Bacteria | 5497 |
| 180 | Ga0070693_100063597 | 3300005547 | Bacteria | 2151 |
| 181 | Ga0070693_100073333 | 3300005547 | Unclassified | 2022 |
| 182 | Ga0070693_100100658 | 3300005547 | Unclassified | 1760 |
| 183 | Ga0070693_100122238 | 3300005547 | Bacteria | 1616 |
| 184 | Ga0070704_100001928 | 3300005549 | Bacteria | 11463 |
| 185 | Ga0070704_100016807 | 3300005549 | Bacteria | 4635 |
| 186 | Ga0070704_100060062 | 3300005549 | Bacteria | 2715 |
| 187 | Ga0070704_100063819 | 3300005549 | Bacteria | 2645 |
| 188 | Ga0070704_100065324 | 3300005549 | Unclassified | 2619 |
| 189 | Ga0070704_100128477 | 3300005549 | Bacteria | 1960 |
| 190 | Ga0070704_100293918 | 3300005549 | Bacteria | 1351 |
| 191 | Ga0070704_100330648 | 3300005549 | Unclassified | 1280 |
| 192 | Ga0070704_100377243 | 3300005549 | Bacteria | 1204 |
| 193 | Ga0070704_100378662 | 3300005549 | Unclassified | 1202 |
| 194 | Ga0070704_100441413 | 3300005549 | Bacteria | 1119 |
| 195 | Ga0070704_100610852 | 3300005549 | Unclassified | 959 |
| 196 | Ga0070664_100001715 | 3300005564 | Bacteria | 17549 |
| 197 | Ga0070664_100355048 | 3300005564 | Bacteria | 1334 |
| 198 | Ga0068857_100013452 | 3300005577 | Bacteria | 7128 |
| 199 | Ga0068857_100039642 | 3300005577 | Bacteria | 4173 |
| 200 | Ga0068857_100365267 | 3300005577 | Bacteria | 1338 |
| 201 | Ga0068854_100081023 | 3300005578 | Bacteria | 2396 |
| 202 | Ga0068854_100135728 | 3300005578 | Unclassified | 1883 |
| 203 | Ga0068854_100327073 | 3300005578 | Bacteria | 1248 |
| 204 | Ga0068856_100022591 | 3300005614 | Bacteria | 6115 |
| 205 | Ga0070702_100005034 | 3300005615 | Bacteria | 6106 |
| 206 | Ga0070702_100018033 | 3300005615 | Bacteria | 3653 |
| 207 | Ga0070702_100120277 | 3300005615 | Unclassified | 1643 |
| 208 | Ga0070702_100223035 | 3300005615 | Bacteria | 1262 |
| 209 | Ga0070702_100232557 | 3300005615 | Unclassified | 1239 |
| 210 | Ga0068852_100084959 | 3300005616 | Bacteria | 2818 |
| 211 | Ga0068852_100112464 | 3300005616 | Bacteria | 2478 |
| 212 | Ga0068852_100185520 | 3300005616 | Archaea | 1959 |
| 213 | Ga0068859_100000586 | 3300005617 | Bacteria | 36318 |
| 214 | Ga0068859_100003464 | 3300005617 | Bacteria | 16044 |
| 215 | Ga0068859_100011486 | 3300005617 | Bacteria | 8903 |
| 216 | Ga0068859_100020147 | 3300005617 | Bacteria | 6696 |
| 217 | Ga0068859_100070691 | 3300005617 | Bacteria | 3526 |
| 218 | Ga0068859_100085206 | 3300005617 | Bacteria | 3205 |
| 219 | Ga0068859_100111118 | 3300005617 | Bacteria | 2803 |
| 220 | Ga0068859_100196044 | 3300005617 | Bacteria | 2104 |
| 221 | Ga0068859_100450996 | 3300005617 | Bacteria | 1382 |
| 222 | Ga0068859_100652033 | 3300005617 | Bacteria | 1145 |
| 223 | Ga0068859_100733458 | 3300005617 | Unclassified | 1078 |
| 224 | Ga0068864_100003228 | 3300005618 | Bacteria | 13474 |
| 225 | Ga0068864_100016132 | 3300005618 | Bacteria | 6216 |
| 226 | Ga0068864_100021949 | 3300005618 | Bacteria | 5351 |
| 227 | Ga0068864_100094593 | 3300005618 | Bacteria | 2641 |
| 228 | Ga0068864_100399101 | 3300005618 | Bacteria | 1306 |
| 229 | Ga0068861_100005663 | 3300005719 | Bacteria | 8471 |
| 230 | Ga0068861_100010458 | 3300005719 | Bacteria | 6439 |
| 231 | Ga0068861_100014204 | 3300005719 | Bacteria | 5586 |
| 232 | Ga0068861_100016686 | 3300005719 | Bacteria | 5201 |
| 233 | Ga0068861_100120544 | 3300005719 | Bacteria | 2115 |
| 234 | Ga0068861_100137352 | 3300005719 | Unclassified | 1991 |
| 235 | Ga0068861_100281957 | 3300005719 | Bacteria | 1431 |
| 236 | Ga0068861_100438438 | 3300005719 | Unclassified | 1168 |
| 237 | Ga0068851_10001570 | 3300005834 | Bacteria | 10023 |
| 238 | Ga0068870_10061014 | 3300005840 | Bacteria | 2026 |
| 239 | Ga0068863_100095379 | 3300005841 | Bacteria | 2823 |
| 240 | Ga0068863_100113289 | 3300005841 | Bacteria | 2583 |
| 241 | Ga0068863_100207162 | 3300005841 | Bacteria | 1888 |
| 242 | Ga0068863_100294465 | 3300005841 | Bacteria | 1573 |
| 243 | Ga0068863_100401607 | 3300005841 | Unclassified | 1340 |
| 244 | Ga0068858_100000005 | 3300005842 | Bacteria | 305830 |
| 245 | Ga0068858_100034796 | 3300005842 | Bacteria | 4673 |
| 246 | Ga0068858_100043649 | 3300005842 | Bacteria | 4158 |
| 247 | Ga0068858_100082453 | 3300005842 | Bacteria | 2989 |
| 248 | Ga0068858_100101047 | 3300005842 | Unclassified | 2690 |
| 249 | Ga0068858_100113066 | 3300005842 | Unclassified | 2536 |
| 250 | Ga0068858_100126165 | 3300005842 | Bacteria | 2397 |
| 251 | Ga0068858_100158410 | 3300005842 | Bacteria | 2131 |
| 252 | Ga0068858_100274411 | 3300005842 | Bacteria | 1605 |
| 253 | Ga0068858_100337666 | 3300005842 | Unclassified | 1441 |
| 254 | Ga0068858_100537740 | 3300005842 | Bacteria | 1131 |
| 255 | Ga0068860_100031983 | 3300005843 | Bacteria | 5058 |
| 256 | Ga0068860_100048156 | 3300005843 | Bacteria | 4063 |
| 257 | Ga0068860_100051120 | 3300005843 | Bacteria | 3933 |
| 258 | Ga0068860_100074102 | 3300005843 | Bacteria | 3236 |
| 259 | Ga0068860_100086317 | 3300005843 | Bacteria | 2986 |
| 260 | Ga0068860_100088822 | 3300005843 | Bacteria | 2942 |
| 261 | Ga0068860_100155505 | 3300005843 | Unclassified | 2203 |
| 262 | Ga0068860_100227081 | 3300005843 | Bacteria | 1814 |
| 263 | Ga0068860_100231649 | 3300005843 | Bacteria | 1795 |
| 264 | Ga0068862_100005732 | 3300005844 | Bacteria | 10366 |
| 265 | Ga0068862_100032812 | 3300005844 | Unclassified | 4386 |
| 266 | Ga0068862_100132249 | 3300005844 | Bacteria | 2208 |
| 267 | Ga0081539_10000279 | 3300005985 | Bacteria | 115766 |
| 268 | Ga0081539_10000695 | 3300005985 | Bacteria | 67496 |
| 269 | Ga0070715_10000020 | 3300006163 | Bacteria | 119605 |
| 270 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 271 | Ga0097621_100001987 | 3300006237 | Bacteria | 13937 |
| 272 | Ga0097621_100005536 | 3300006237 | Bacteria | 8898 |
| 273 | Ga0097621_100102914 | 3300006237 | Bacteria | 2405 |
| 274 | Ga0097621_100178552 | 3300006237 | Unclassified | 1834 |
| 275 | Ga0097621_100406621 | 3300006237 | Unclassified | 1219 |
| 276 | Ga0068871_100012702 | 3300006358 | Bacteria | 6223 |
| 277 | Ga0068871_100016720 | 3300006358 | Bacteria | 5535 |
| 278 | Ga0068871_100020429 | 3300006358 | Bacteria | 5073 |
| 279 | Ga0068871_100260611 | 3300006358 | Bacteria | 1512 |
| 280 | Ga0075428_100096541 | 3300006844 | Bacteria | 3221 |
| 281 | Ga0075430_100174292 | 3300006846 | Unclassified | 1789 |
| 282 | Ga0075431_100158453 | 3300006847 | Unclassified | 2328 |
| 283 | Ga0075431_100228684 | 3300006847 | Unclassified | 1896 |
| 284 | Ga0075433_10009960 | 3300006852 | Bacteria | 7614 |
| 285 | Ga0075433_10029567 | 3300006852 | Bacteria | 4670 |
| 286 | Ga0075433_10055254 | 3300006852 | Bacteria | 3465 |
| 287 | Ga0075433_10166003 | 3300006852 | Bacteria | 1965 |
| 288 | Ga0075433_10214128 | 3300006852 | Unclassified | 1712 |
| 289 | Ga0075433_10635207 | 3300006852 | Unclassified | 936 |
| 290 | Ga0075434_100019006 | 3300006871 | Bacteria | 6642 |
| 291 | Ga0075434_100040693 | 3300006871 | Bacteria | 4603 |
| 292 | Ga0075434_100072207 | 3300006871 | Bacteria | 3443 |
| 293 | Ga0075434_100103051 | 3300006871 | Bacteria | 2861 |
| 294 | Ga0075434_100246323 | 3300006871 | Unclassified | 1807 |
| 295 | Ga0075434_100298664 | 3300006871 | Bacteria | 1631 |
| 296 | Ga0075434_100435859 | 3300006871 | Bacteria | 1332 |
| 297 | Ga0075429_100046391 | 3300006880 | Bacteria | 3780 |
| 298 | Ga0068865_100017990 | 3300006881 | Bacteria | 4554 |
| 299 | Ga0068865_100162468 | 3300006881 | Unclassified | 1705 |
| 300 | Ga0075436_100000013 | 3300006914 | Bacteria | 177118 |
| 301 | Ga0075436_100028599 | 3300006914 | Bacteria | 3834 |
| 302 | Ga0075436_100188675 | 3300006914 | Bacteria | 1458 |
| 303 | Ga0097620_100000586 | 3300006931 | Bacteria | 36318 |
| 304 | Ga0097620_100003464 | 3300006931 | Bacteria | 16044 |
| 305 | Ga0097620_100011487 | 3300006931 | Bacteria | 8903 |
| 306 | Ga0097620_100020148 | 3300006931 | Bacteria | 6696 |
| 307 | Ga0097620_100070690 | 3300006931 | Bacteria | 3526 |
| 308 | Ga0097620_100085205 | 3300006931 | Bacteria | 3205 |
| 309 | Ga0097620_100111119 | 3300006931 | Bacteria | 2803 |
| 310 | Ga0097620_100196045 | 3300006931 | Bacteria | 2104 |
| 311 | Ga0097620_100451034 | 3300006931 | Bacteria | 1382 |
| 312 | Ga0097620_100651971 | 3300006931 | Bacteria | 1145 |
| 313 | Ga0097620_100733440 | 3300006931 | Unclassified | 1078 |
| 314 | Ga0075435_100011221 | 3300007076 | Bacteria | 6577 |
| 315 | Ga0075435_100288561 | 3300007076 | Bacteria | 1402 |
| 316 | Ga0105240_10091078 | 3300009093 | Unclassified | 3726 |
| 317 | Ga0105240_10452654 | 3300009093 | Unclassified | 1436 |
| 318 | Ga0111539_10006864 | 3300009094 | Bacteria | 14627 |
| 319 | Ga0111539_10106467 | 3300009094 | Unclassified | 3290 |
| 320 | Ga0111539_10144800 | 3300009094 | Unclassified | 2782 |
| 321 | Ga0111539_10191181 | 3300009094 | Bacteria | 2388 |
| 322 | Ga0111539_10200139 | 3300009094 | Bacteria | 2329 |
| 323 | Ga0111539_10522706 | 3300009094 | Unclassified | 1382 |
| 324 | Ga0111539_10548888 | 3300009094 | Unclassified | 1346 |
| 325 | Ga0111539_10778886 | 3300009094 | Unclassified | 1113 |
| 326 | Ga0105245_10099496 | 3300009098 | Unclassified | 2688 |
| 327 | Ga0105245_10152304 | 3300009098 | Bacteria | 2187 |
| 328 | Ga0105245_10346381 | 3300009098 | Bacteria | 1471 |
| 329 | Ga0105245_10460715 | 3300009098 | Bacteria | 1281 |
| 330 | Ga0105247_10000002 | 3300009101 | Bacteria | 724587 |
| 331 | Ga0105247_10031353 | 3300009101 | Unclassified | 3225 |
| 332 | Ga0105247_10041130 | 3300009101 | Unclassified | 2827 |
| 333 | Ga0114129_10005832 | 3300009147 | Bacteria | 17448 |
| 334 | Ga0114129_10011843 | 3300009147 | Bacteria | 12405 |
| 335 | Ga0114129_10042631 | 3300009147 | Bacteria | 6387 |
| 336 | Ga0114129_10082347 | 3300009147 | Bacteria | 4471 |
| 337 | Ga0114129_10130383 | 3300009147 | Unclassified | 3453 |
| 338 | Ga0114129_10130794 | 3300009147 | Bacteria | 3447 |
| 339 | Ga0114129_10207665 | 3300009147 | Bacteria | 2649 |
| 340 | Ga0114129_10261157 | 3300009147 | Bacteria | 2321 |
| 341 | Ga0114129_10509154 | 3300009147 | Unclassified | 1571 |
| 342 | Ga0114129_10986673 | 3300009147 | Unclassified | 1062 |
| 343 | Ga0105243_10000182 | 3300009148 | Bacteria | 73148 |
| 344 | Ga0105243_10000792 | 3300009148 | Bacteria | 30316 |
| 345 | Ga0105243_10011106 | 3300009148 | Bacteria | 6813 |
| 346 | Ga0105243_10210884 | 3300009148 | Unclassified | 1710 |
| 347 | Ga0105243_10238167 | 3300009148 | Bacteria | 1618 |
| 348 | Ga0105243_10582858 | 3300009148 | Unclassified | 1074 |
| 349 | Ga0105243_10631933 | 3300009148 | Bacteria | 1035 |
| 350 | Ga0105243_10632729 | 3300009148 | Unclassified | 1034 |
| 351 | Ga0105243_10632908 | 3300009148 | Unclassified | 1034 |
| 352 | Ga0105241_10210850 | 3300009174 | Unclassified | 1627 |
| 353 | Ga0105241_10314108 | 3300009174 | Unclassified | 1349 |
| 354 | Ga0105241_10323466 | 3300009174 | Unclassified | 1331 |
| 355 | Ga0105242_10000370 | 3300009176 | Bacteria | 35743 |
| 356 | Ga0105242_10000767 | 3300009176 | Bacteria | 24990 |
| 357 | Ga0105242_10060633 | 3300009176 | Unclassified | 3109 |
| 358 | Ga0105242_10130640 | 3300009176 | Bacteria | 2168 |
| 359 | Ga0105242_10164086 | 3300009176 | Bacteria | 1947 |
| 360 | Ga0105248_10013649 | 3300009177 | Bacteria | 8943 |
| 361 | Ga0105248_10036086 | 3300009177 | Bacteria | 5530 |
| 362 | Ga0105248_10040235 | 3300009177 | Bacteria | 5240 |
| 363 | Ga0105248_10042861 | 3300009177 | Bacteria | 5074 |
| 364 | Ga0105248_10076353 | 3300009177 | Bacteria | 3766 |
| 365 | Ga0105248_10161549 | 3300009177 | Unclassified | 2527 |
| 366 | Ga0105248_10222274 | 3300009177 | Bacteria | 2126 |
| 367 | Ga0105248_10275645 | 3300009177 | Bacteria | 1894 |
| 368 | Ga0105248_10688533 | 3300009177 | Bacteria | 1153 |
| 369 | Ga0105237_10001910 | 3300009545 | Bacteria | 26587 |
| 370 | Ga0105237_10022887 | 3300009545 | Bacteria | 6408 |
| 371 | Ga0105237_10093964 | 3300009545 | Bacteria | 2988 |
| 372 | Ga0105237_10455528 | 3300009545 | Unclassified | 1285 |
| 373 | Ga0105238_10019867 | 3300009551 | Bacteria | 6838 |
| 374 | Ga0105249_10000003 | 3300009553 | Bacteria | 370855 |
| 375 | Ga0105249_10010555 | 3300009553 | Bacteria | 8117 |
| 376 | Ga0105249_10051054 | 3300009553 | Bacteria | 3771 |
| 377 | Ga0105249_10230726 | 3300009553 | Unclassified | 1825 |
| 378 | Ga0105249_10400831 | 3300009553 | Unclassified | 1402 |
| 379 | Ga0105249_10539027 | 3300009553 | Bacteria | 1216 |
| 380 | Ga0105239_10109632 | 3300010375 | Bacteria | 3059 |
| 381 | Ga0105239_10333000 | 3300010375 | Unclassified | 1713 |
| 382 | Ga0105246_10139604 | 3300011119 | Bacteria | 1821 |
| 383 | Ga0105246_10210419 | 3300011119 | Unclassified | 1518 |
| 384 | Ga0105246_10311504 | 3300011119 | Bacteria | 1275 |
| 385 | Ga0105246_10540141 | 3300011119 | Unclassified | 997 |
| 386 | Ga0157373_10026553 | 3300013100 | Bacteria | 4181 |
| 387 | Ga0157373_10030718 | 3300013100 | Bacteria | 3866 |
| 388 | Ga0157373_10459345 | 3300013100 | Unclassified | 917 |
| 389 | Ga0157374_10064303 | 3300013296 | Bacteria | 3442 |
| 390 | Ga0157374_10360317 | 3300013296 | Bacteria | 1446 |
| 391 | Ga0157374_10524654 | 3300013296 | Bacteria | 1190 |
| 392 | Ga0157378_10000342 | 3300013297 | Bacteria | 45875 |
| 393 | Ga0157378_10008224 | 3300013297 | Bacteria | 9095 |
| 394 | Ga0157378_10010432 | 3300013297 | Bacteria | 8113 |
| 395 | Ga0157378_10067451 | 3300013297 | Unclassified | 3206 |
| 396 | Ga0157378_10072703 | 3300013297 | Unclassified | 3090 |
| 397 | Ga0157378_10098022 | 3300013297 | Bacteria | 2672 |
| 398 | Ga0157378_10150749 | 3300013297 | Bacteria | 2166 |
| 399 | Ga0157378_10214703 | 3300013297 | Unclassified | 1826 |
| 400 | Ga0157378_10254782 | 3300013297 | Unclassified | 1681 |
| 401 | Ga0157378_10757384 | 3300013297 | Unclassified | 994 |
| 402 | Ga0157378_10764053 | 3300013297 | Unclassified | 990 |
| 403 | Ga0163162_10000020 | 3300013306 | Bacteria | 220558 |
| 404 | Ga0163162_10004174 | 3300013306 | Bacteria | 13880 |
| 405 | Ga0163162_10009766 | 3300013306 | Bacteria | 9344 |
| 406 | Ga0163162_10021352 | 3300013306 | Bacteria | 6375 |
| 407 | Ga0163162_10045274 | 3300013306 | Bacteria | 4408 |
| 408 | Ga0163162_10112897 | 3300013306 | Bacteria | 2816 |
| 409 | Ga0163162_10166578 | 3300013306 | Unclassified | 2328 |
| 410 | Ga0163162_10487603 | 3300013306 | Bacteria | 1364 |
| 411 | Ga0157372_10006818 | 3300013307 | Bacteria | 12146 |
| 412 | Ga0157372_10024822 | 3300013307 | Bacteria | 6515 |
| 413 | Ga0157372_10544565 | 3300013307 | Unclassified | 1353 |
| 414 | Ga0157375_10025425 | 3300013308 | Bacteria | 5501 |
| 415 | Ga0157375_10080235 | 3300013308 | Bacteria | 3300 |
| 416 | Ga0157375_10213775 | 3300013308 | Bacteria | 2086 |
| 417 | Ga0157375_10388977 | 3300013308 | Unclassified | 1561 |
| 418 | Ga0157375_10464767 | 3300013308 | Bacteria | 1431 |
| 419 | Ga0157375_10767318 | 3300013308 | Bacteria | 1115 |
| 420 | Ga0163163_10005683 | 3300014325 | Bacteria | 10812 |
| 421 | Ga0163163_10028191 | 3300014325 | Bacteria | 5389 |
| 422 | Ga0163163_10030744 | 3300014325 | Bacteria | 5177 |
| 423 | Ga0163163_10043665 | 3300014325 | Bacteria | 4395 |
| 424 | Ga0163163_10044443 | 3300014325 | Unclassified | 4358 |
| 425 | Ga0163163_10181778 | 3300014325 | Bacteria | 2150 |
| 426 | Ga0163163_10198815 | 3300014325 | Bacteria | 2053 |
| 427 | Ga0163163_10333987 | 3300014325 | Unclassified | 1570 |
| 428 | Ga0163163_10503600 | 3300014325 | Bacteria | 1273 |
| 429 | Ga0157380_10013970 | 3300014326 | Bacteria | 5864 |
| 430 | Ga0157380_10017360 | 3300014326 | Bacteria | 5325 |
| 431 | Ga0157380_10032377 | 3300014326 | Bacteria | 4021 |
| 432 | Ga0157380_10033291 | 3300014326 | Bacteria | 3969 |
| 433 | Ga0157380_10039429 | 3300014326 | Bacteria | 3673 |
| 434 | Ga0157380_10062342 | 3300014326 | Bacteria | 2987 |
| 435 | Ga0157380_10070139 | 3300014326 | Bacteria | 2831 |
| 436 | Ga0157380_10078527 | 3300014326 | Unclassified | 2693 |
| 437 | Ga0157380_10094680 | 3300014326 | Bacteria | 2472 |
| 438 | Ga0157380_10249271 | 3300014326 | Bacteria | 1606 |
| 439 | Ga0157377_10080375 | 3300014745 | Bacteria | 1904 |
| 440 | Ga0157379_10061460 | 3300014968 | Unclassified | 3359 |
| 441 | Ga0157379_10374720 | 3300014968 | Bacteria | 1305 |
| 442 | Ga0157376_10011232 | 3300014969 | Bacteria | 6592 |
| 443 | Ga0157376_10154636 | 3300014969 | Bacteria | 2072 |
| 444 | Ga0163161_10044122 | 3300017792 | Bacteria | 3211 |
| 445 | Ga0163161_10057508 | 3300017792 | Bacteria | 2825 |
| 446 | Ga0163161_10270006 | 3300017792 | Unclassified | 1331 |
| 447 | Ga0207672_1000050 | 3300025223 | Bacteria | 15664 |
| 448 | Ga0207656_10000959 | 3300025321 | Bacteria | 9441 |
| 449 | Ga0207653_10000332 | 3300025885 | Bacteria | 24901 |
| 450 | Ga0207682_10172915 | 3300025893 | Unclassified | 983 |
| 451 | Ga0207642_10055729 | 3300025899 | Unclassified | 1810 |
| 452 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 453 | Ga0207688_10276182 | 3300025901 | Unclassified | 1023 |
| 454 | Ga0207680_10146329 | 3300025903 | Bacteria | 1571 |
| 455 | Ga0207680_10271851 | 3300025903 | Bacteria | 1175 |
| 456 | Ga0207685_10000008 | 3300025905 | Bacteria | 273136 |
| 457 | Ga0207699_10261780 | 3300025906 | Bacteria | 1196 |
| 458 | Ga0207645_10181273 | 3300025907 | Unclassified | 1382 |
| 459 | Ga0207643_10005560 | 3300025908 | Bacteria | 6736 |
| 460 | Ga0207643_10008153 | 3300025908 | Bacteria | 5620 |
| 461 | Ga0207643_10043429 | 3300025908 | Bacteria | 2537 |
| 462 | Ga0207684_10000023 | 3300025910 | Bacteria | 334838 |
| 463 | Ga0207684_10006564 | 3300025910 | Bacteria | 10591 |
| 464 | Ga0207684_10052534 | 3300025910 | Bacteria | 3458 |
| 465 | Ga0207684_10058417 | 3300025910 | Bacteria | 3273 |
| 466 | Ga0207684_10091968 | 3300025910 | Bacteria | 2586 |
| 467 | Ga0207684_10095810 | 3300025910 | Bacteria | 2533 |
| 468 | Ga0207684_10132301 | 3300025910 | Unclassified | 2141 |
| 469 | Ga0207684_10138630 | 3300025910 | Bacteria | 2090 |
| 470 | Ga0207684_10215367 | 3300025910 | Bacteria | 1657 |
| 471 | Ga0207684_10375097 | 3300025910 | Unclassified | 1224 |
| 472 | Ga0207684_10465379 | 3300025910 | Unclassified | 1085 |
| 473 | Ga0207654_10019532 | 3300025911 | Bacteria | 3578 |
| 474 | Ga0207654_10037005 | 3300025911 | Bacteria | 2730 |
| 475 | Ga0207654_10147211 | 3300025911 | Bacteria | 1508 |
| 476 | Ga0207707_10000006 | 3300025912 | Bacteria | 374131 |
| 477 | Ga0207707_10009795 | 3300025912 | Bacteria | 8311 |
| 478 | Ga0207707_10010819 | 3300025912 | Bacteria | 7929 |
| 479 | Ga0207695_10067169 | 3300025913 | Unclassified | 3679 |
| 480 | Ga0207695_10451972 | 3300025913 | Unclassified | 1168 |
| 481 | Ga0207671_10009096 | 3300025914 | Bacteria | 8347 |
| 482 | Ga0207660_10000971 | 3300025917 | Bacteria | 18966 |
| 483 | Ga0207660_10114181 | 3300025917 | Bacteria | 2037 |
| 484 | Ga0207662_10013770 | 3300025918 | Bacteria | 4526 |
| 485 | Ga0207662_10030359 | 3300025918 | Bacteria | 3136 |
| 486 | Ga0207662_10034077 | 3300025918 | Unclassified | 2971 |
| 487 | Ga0207662_10071828 | 3300025918 | Bacteria | 2096 |
| 488 | Ga0207662_10107120 | 3300025918 | Bacteria | 1739 |
| 489 | Ga0207662_10228548 | 3300025918 | Bacteria | 1214 |
| 490 | Ga0207662_10244213 | 3300025918 | Unclassified | 1176 |
| 491 | Ga0207662_10253814 | 3300025918 | Bacteria | 1155 |
| 492 | Ga0207657_10075018 | 3300025919 | Bacteria | 2855 |
| 493 | Ga0207649_10068408 | 3300025920 | Bacteria | 2258 |
| 494 | Ga0207652_10000216 | 3300025921 | Bacteria | 61049 |
| 495 | Ga0207652_10016140 | 3300025921 | Bacteria | 6091 |
| 496 | Ga0207652_10166483 | 3300025921 | Bacteria | 1977 |
| 497 | Ga0207646_10006385 | 3300025922 | Bacteria | 12192 |
| 498 | Ga0207646_10006845 | 3300025922 | Bacteria | 11719 |
| 499 | Ga0207646_10015551 | 3300025922 | Bacteria | 7184 |
| 500 | Ga0207646_10021644 | 3300025922 | Bacteria | 5936 |
| 501 | Ga0207646_10069826 | 3300025922 | Bacteria | 3138 |
| 502 | Ga0207646_10102666 | 3300025922 | Bacteria | 2564 |
| 503 | Ga0207646_10138723 | 3300025922 | Bacteria | 2190 |
| 504 | Ga0207646_10151956 | 3300025922 | Bacteria | 2088 |
| 505 | Ga0207681_10000204 | 3300025923 | Bacteria | 47135 |
| 506 | Ga0207681_10029307 | 3300025923 | Bacteria | 3573 |
| 507 | Ga0207681_10080535 | 3300025923 | Bacteria | 2297 |
| 508 | Ga0207681_10088152 | 3300025923 | Unclassified | 2209 |
| 509 | Ga0207681_10096040 | 3300025923 | Bacteria | 2127 |
| 510 | Ga0207694_10005775 | 3300025924 | Bacteria | 9482 |
| 511 | Ga0207650_10004849 | 3300025925 | Bacteria | 9189 |
| 512 | Ga0207650_10049137 | 3300025925 | Bacteria | 3113 |
| 513 | Ga0207650_10052753 | 3300025925 | Unclassified | 3013 |
| 514 | Ga0207650_10122064 | 3300025925 | Bacteria | 2030 |
| 515 | Ga0207650_10198819 | 3300025925 | Unclassified | 1605 |
| 516 | Ga0207659_10236189 | 3300025926 | Bacteria | 1477 |
| 517 | Ga0207644_10000102 | 3300025931 | Bacteria | 61918 |
| 518 | Ga0207644_10094620 | 3300025931 | Unclassified | 2232 |
| 519 | Ga0207644_10141475 | 3300025931 | Bacteria | 1853 |
| 520 | Ga0207706_10060738 | 3300025933 | Bacteria | 3329 |
| 521 | Ga0207706_10629695 | 3300025933 | Unclassified | 920 |
| 522 | Ga0207686_10000018 | 3300025934 | Bacteria | 189717 |
| 523 | Ga0207686_10000021 | 3300025934 | Bacteria | 181793 |
| 524 | Ga0207686_10001930 | 3300025934 | Bacteria | 11454 |
| 525 | Ga0207686_10004855 | 3300025934 | Bacteria | 7227 |
| 526 | Ga0207686_10101472 | 3300025934 | Bacteria | 1922 |
| 527 | Ga0207686_10128500 | 3300025934 | Unclassified | 1735 |
| 528 | Ga0207709_10000069 | 3300025935 | Bacteria | 183367 |
| 529 | Ga0207709_10000595 | 3300025935 | Bacteria | 30171 |
| 530 | Ga0207709_10007003 | 3300025935 | Bacteria | 6303 |
| 531 | Ga0207709_10083688 | 3300025935 | Bacteria | 2064 |
| 532 | Ga0207670_10000275 | 3300025936 | Bacteria | 31956 |
| 533 | Ga0207670_10106787 | 3300025936 | Bacteria | 2009 |
| 534 | Ga0207670_10167102 | 3300025936 | Unclassified | 1647 |
| 535 | Ga0207670_10206873 | 3300025936 | Bacteria | 1494 |
| 536 | Ga0207704_10035226 | 3300025938 | Bacteria | 2866 |
| 537 | Ga0207704_10119732 | 3300025938 | Unclassified | 1799 |
| 538 | Ga0207704_10518383 | 3300025938 | Unclassified | 964 |
| 539 | Ga0207665_10000003 | 3300025939 | Bacteria | 220666 |
| 540 | Ga0207691_10006319 | 3300025940 | Bacteria | 11440 |
| 541 | Ga0207691_10066661 | 3300025940 | Bacteria | 3257 |
| 542 | Ga0207691_10102248 | 3300025940 | Bacteria | 2556 |
| 543 | Ga0207691_10145915 | 3300025940 | Unclassified | 2083 |
| 544 | Ga0207711_10002579 | 3300025941 | Bacteria | 16125 |
| 545 | Ga0207711_10047141 | 3300025941 | Bacteria | 3683 |
| 546 | Ga0207711_10144384 | 3300025941 | Bacteria | 2143 |
| 547 | Ga0207711_10395128 | 3300025941 | Bacteria | 1284 |
| 548 | Ga0207711_10614697 | 3300025941 | Bacteria | 1014 |
| 549 | Ga0207689_10000794 | 3300025942 | Bacteria | 30388 |
| 550 | Ga0207689_10002977 | 3300025942 | Bacteria | 15628 |
| 551 | Ga0207689_10008554 | 3300025942 | Bacteria | 8921 |
| 552 | Ga0207689_10020733 | 3300025942 | Bacteria | 5527 |
| 553 | Ga0207689_10142963 | 3300025942 | Bacteria | 1971 |
| 554 | Ga0207689_10145370 | 3300025942 | Bacteria | 1954 |
| 555 | Ga0207689_10217816 | 3300025942 | Bacteria | 1577 |
| 556 | Ga0207689_10242056 | 3300025942 | Unclassified | 1491 |
| 557 | Ga0207689_10268753 | 3300025942 | Bacteria | 1412 |
| 558 | Ga0207679_10026276 | 3300025945 | Bacteria | 4013 |
| 559 | Ga0207679_10111367 | 3300025945 | Bacteria | 2161 |
| 560 | Ga0207651_10032451 | 3300025960 | Bacteria | 3354 |
| 561 | Ga0207651_10034668 | 3300025960 | Bacteria | 3272 |
| 562 | Ga0207651_10393002 | 3300025960 | Unclassified | 1178 |
| 563 | Ga0207712_10000232 | 3300025961 | Bacteria | 54804 |
| 564 | Ga0207668_10001515 | 3300025972 | Bacteria | 13576 |
| 565 | Ga0207658_10042608 | 3300025986 | Unclassified | 3294 |
| 566 | Ga0207658_10147216 | 3300025986 | Bacteria | 1914 |
| 567 | Ga0207658_10191898 | 3300025986 | Bacteria | 1699 |
| 568 | Ga0207677_10071687 | 3300026023 | Bacteria | 2446 |
| 569 | Ga0207703_10000475 | 3300026035 | Bacteria | 42000 |
| 570 | Ga0207703_10015260 | 3300026035 | Bacteria | 5994 |
| 571 | Ga0207703_10054024 | 3300026035 | Bacteria | 3266 |
| 572 | Ga0207703_10089392 | 3300026035 | Bacteria | 2587 |
| 573 | Ga0207703_10127792 | 3300026035 | Bacteria | 2191 |
| 574 | Ga0207639_10124116 | 3300026041 | Bacteria | 2127 |
| 575 | Ga0207639_10308262 | 3300026041 | Bacteria | 1401 |
| 576 | Ga0207678_10174757 | 3300026067 | Bacteria | 1834 |
| 577 | Ga0207708_10000026 | 3300026075 | Bacteria | 168232 |
| 578 | Ga0207708_10005206 | 3300026075 | Bacteria | 9591 |
| 579 | Ga0207708_10103922 | 3300026075 | Bacteria | 2201 |
| 580 | Ga0207708_10284612 | 3300026075 | Bacteria | 1340 |
| 581 | Ga0207708_10650591 | 3300026075 | Unclassified | 897 |
| 582 | Ga0207702_10055397 | 3300026078 | Bacteria | 3363 |
| 583 | Ga0207641_10161155 | 3300026088 | Bacteria | 2039 |
| 584 | Ga0207641_10177934 | 3300026088 | Bacteria | 1946 |
| 585 | Ga0207641_10178794 | 3300026088 | Unclassified | 1942 |
| 586 | Ga0207641_10668032 | 3300026088 | Bacteria | 1022 |
| 587 | Ga0207641_10719672 | 3300026088 | Bacteria | 984 |
| 588 | Ga0207648_10007763 | 3300026089 | Bacteria | 10479 |
| 589 | Ga0207648_10061971 | 3300026089 | Unclassified | 3261 |
| 590 | Ga0207648_10092849 | 3300026089 | Bacteria | 2639 |
| 591 | Ga0207648_10107939 | 3300026089 | Bacteria | 2443 |
| 592 | Ga0207648_10171358 | 3300026089 | Unclassified | 1919 |
| 593 | Ga0207648_10268796 | 3300026089 | Bacteria | 1523 |
| 594 | Ga0207648_10338214 | 3300026089 | Bacteria | 1355 |
| 595 | Ga0207648_10521719 | 3300026089 | Bacteria | 1088 |
| 596 | Ga0207676_10003407 | 3300026095 | Bacteria | 11240 |
| 597 | Ga0207676_10016307 | 3300026095 | Bacteria | 5379 |
| 598 | Ga0207676_10024106 | 3300026095 | Bacteria | 4499 |
| 599 | Ga0207676_10030718 | 3300026095 | Unclassified | 4035 |
| 600 | Ga0207676_10066690 | 3300026095 | Unclassified | 2872 |
| 601 | Ga0207676_10071352 | 3300026095 | Bacteria | 2788 |
| 602 | Ga0207676_10316303 | 3300026095 | Bacteria | 1431 |
| 603 | Ga0207676_10379025 | 3300026095 | Unclassified | 1316 |
| 604 | Ga0207676_10627352 | 3300026095 | Bacteria | 1035 |
| 605 | Ga0207676_10809076 | 3300026095 | Bacteria | 914 |
| 606 | Ga0207674_10000192 | 3300026116 | Bacteria | 75255 |
| 607 | Ga0207674_10043919 | 3300026116 | Unclassified | 4606 |
| 608 | Ga0207674_10052773 | 3300026116 | Bacteria | 4146 |
| 609 | Ga0207674_10124936 | 3300026116 | Bacteria | 2539 |
| 610 | Ga0207674_10224200 | 3300026116 | Unclassified | 1828 |
| 611 | Ga0207674_10264235 | 3300026116 | Bacteria | 1668 |
| 612 | Ga0207675_100000960 | 3300026118 | Bacteria | 28760 |
| 613 | Ga0207675_100029991 | 3300026118 | Bacteria | 5063 |
| 614 | Ga0207675_100173549 | 3300026118 | Unclassified | 2061 |
| 615 | Ga0207675_100283030 | 3300026118 | Bacteria | 1611 |
| 616 | Ga0207675_100357535 | 3300026118 | Bacteria | 1432 |
| 617 | Ga0207675_100430969 | 3300026118 | Unclassified | 1304 |
| 618 | Ga0207683_10209580 | 3300026121 | Bacteria | 1773 |
| 619 | Ga0207698_10057444 | 3300026142 | Bacteria | 3011 |
| 620 | Ga0207698_10129729 | 3300026142 | Bacteria | 2152 |
| 621 | Ga0207698_10239983 | 3300026142 | Unclassified | 1651 |
| 622 | Ga0207698_10276258 | 3300026142 | Unclassified | 1551 |
| 623 | Ga0207428_10026037 | 3300027907 | Bacteria | 4887 |
| 624 | Ga0207428_10122322 | 3300027907 | Unclassified | 1995 |
| 625 | Ga0268266_10072750 | 3300028379 | Bacteria | 2982 |
| 626 | Ga0268265_10021379 | 3300028380 | Bacteria | 4532 |
| 627 | Ga0268265_10070955 | 3300028380 | Bacteria | 2711 |
| 628 | Ga0268265_10075112 | 3300028380 | Unclassified | 2646 |
| 629 | Ga0268265_10213512 | 3300028380 | Unclassified | 1683 |
| 630 | Ga0268264_10123277 | 3300028381 | Bacteria | 2287 |
| 631 | Ga0268264_10154925 | 3300028381 | Bacteria | 2058 |
| 632 | Ga0268264_10154981 | 3300028381 | Bacteria | 2058 |
| 633 | Ga0307408_100024802 | 3300031548 | Unclassified | 4099 |
| 634 | Ga0307408_100164581 | 3300031548 | Bacteria | 1765 |
| 635 | Ga0307408_100193129 | 3300031548 | Bacteria | 1642 |
| 636 | Ga0307408_100361613 | 3300031548 | Unclassified | 1235 |
| 637 | Ga0307405_10264114 | 3300031731 | Unclassified | 1287 |
| 638 | Ga0307405_10278375 | 3300031731 | Bacteria | 1258 |
| 639 | Ga0307413_10205849 | 3300031824 | Unclassified | 1425 |
| 640 | Ga0307406_10022725 | 3300031901 | Bacteria | 3723 |
| 641 | Ga0307407_10101320 | 3300031903 | Bacteria | 1788 |
| 642 | Ga0307412_10030476 | 3300031911 | Bacteria | 3397 |
| 643 | Ga0307412_10112261 | 3300031911 | Bacteria | 1948 |
| 644 | Ga0307412_10145272 | 3300031911 | Bacteria | 1742 |
| 645 | Ga0307412_10173837 | 3300031911 | Bacteria | 1613 |
| 646 | Ga0307416_100102294 | 3300032002 | Bacteria | 2498 |
| 647 | Ga0307416_100431372 | 3300032002 | Unclassified | 1365 |
| 648 | Ga0307416_100558438 | 3300032002 | Bacteria | 1219 |
| 649 | Ga0307416_100761940 | 3300032002 | Bacteria | 1061 |
| 650 | Ga0307416_100819330 | 3300032002 | Unclassified | 1027 |
| 651 | Ga0307414_10003383 | 3300032004 | Bacteria | 8519 |
| 652 | Ga0307411_10351205 | 3300032005 | Unclassified | 1202 |
| 653 | Ga0373951_0001364 | 3300035091 | Bacteria | 6417 |
| 654 | Ga0373941_0032729 | 3300035115 | Bacteria | 1558 |
| 655 | Ga0395900_0239699 | 3300037418 | Bacteria | 1820 |
| 656 | Ga0395900_0741377 | 3300037418 | Bacteria | 913 |
| 657 | Ga0395898_0133927 | 3300037466 | Bacteria | 2373 |
| 658 | Ga0395898_0184418 | 3300037466 | Bacteria | 1994 |
| 659 | Ga0395898_0289085 | 3300037466 | Bacteria | 1564 |
| 660 | Ga0395898_0546565 | 3300037466 | Bacteria | 1100 |
| 661 | Ga0395905_0000787 | 3300037471 | Bacteria | 41702 |
| 662 | Ga0395905_0009249 | 3300037471 | Bacteria | 9645 |
| 663 | Ga0395905_0154044 | 3300037471 | Bacteria | 2162 |
| 664 | Ga0395901_0322819 | 3300038443 | Bacteria | 1597 |
| 665 | Ga0242420_002795 | 3300038996 | Bacteria | 2525 |
| 666 | Ga0242420_007936 | 3300038996 | Bacteria | 1713 |
| 667 | Ga0400489_68120 | 3300039093 | Unclassified | 1796 |
| 668 | Ga0436365_0206631 | 3300039437 | Bacteria | 2940 |
| 669 | Ga0439448_0006017 | 3300042005 | Bacteria | 3476 |
| 670 | Ga0439455_0003976 | 3300042012 | Bacteria | 2884 |
| 671 | Ga0453683_0003384 | 3300044673 | Bacteria | 11770 |
| 672 | Ga0453684_0146100 | 3300044712 | Unclassified | 2817 |
| 673 | Ga0451576_0275503 | 3300045051 | Bacteria | 1759 |
| 674 | Ga0495663_0000537 | 3300046525 | Bacteria | 13525 |
| 675 | Ga0495598_0000409 | 3300046537 | Bacteria | 7723 |
| 676 | Ga0495598_0115671 | 3300046537 | Bacteria | 904 |
| 677 | Ga0495621_0000654 | 3300046539 | Bacteria | 8729 |
| 678 | Ga0495621_0112519 | 3300046539 | Bacteria | 1045 |
| 679 | Ga0495672_0012033 | 3300047320 | Bacteria | 6060 |
| 680 | Ga0495684_0093790 | 3300047471 | Bacteria | 2273 |
| 681 | Ga0496102_0159003 | 3300048905 | Bacteria | 2125 |
| 682 | Ga0496103_0128839 | 3300048906 | Bacteria | 1615 |
| 683 | Ga0496104_0058907 | 3300048907 | Bacteria | 3636 |
| 684 | Ga0496104_0220891 | 3300048907 | Bacteria | 1807 |
| 685 | Ga0496106_0026559 | 3300048909 | Bacteria | 4312 |
| 686 | Ga0496106_0035942 | 3300048909 | Bacteria | 3705 |
| 687 | Ga0496107_0248463 | 3300048910 | Unclassified | 1324 |
| 688 | Ga0496108_0104517 | 3300048911 | Bacteria | 2417 |
| 689 | Ga0496109_0353874 | 3300048912 | Bacteria | 1387 |
| 690 | Ga0496110_0144319 | 3300048913 | Bacteria | 2153 |
| 691 | Ga0496112_0115880 | 3300048915 | Bacteria | 2650 |
| 692 | Ga0496112_0722773 | 3300048915 | Bacteria | 923 |
| 693 | Ga0496126_0044283 | 3300048929 | Bacteria | 4100 |
| 694 | Ga0501292_001906 | 3300049515 | Bacteria | 2623 |
| 695 | Ga0501295_019888 | 3300049518 | Bacteria | 1210 |
| 696 | Ga0501296_003320 | 3300049519 | Unclassified | 1712 |
| 697 | Ga0501298_001045 | 3300049521 | Bacteria | 3971 |
| 698 | Ga0501298_014548 | 3300049521 | Bacteria | 1407 |
| 699 | Ga0501202_002243 | 3300049652 | Bacteria | 3229 |
| 700 | Ga0501202_005068 | 3300049652 | Bacteria | 2325 |
| 701 | Ga0501217_014533 | 3300049661 | Bacteria | 1780 |
| 702 | Ga0501217_020678 | 3300049661 | Bacteria | 1548 |
| 703 | Ga0501223_008576 | 3300049663 | Bacteria | 2082 |
| 704 | Ga0501223_010404 | 3300049663 | Bacteria | 1872 |
| 705 | Ga0501223_012618 | 3300049663 | Bacteria | 1688 |
| 706 | Ga0501223_016828 | 3300049663 | Bacteria | 1445 |
| 707 | Ga0501224_023886 | 3300049664 | Unclassified | 913 |
| 708 | Ga0501227_004379 | 3300049665 | Bacteria | 3039 |
| 709 | Ga0501227_047658 | 3300049665 | Bacteria | 1074 |
| 710 | Ga0501230_001052 | 3300049667 | Bacteria | 3167 |
| 711 | Ga0501233_004439 | 3300049668 | Bacteria | 2573 |
| 712 | Ga0501235_035980 | 3300049669 | Bacteria | 1125 |
| 713 | Ga0501243_008705 | 3300049675 | Bacteria | 1568 |
| 714 | Ga0501243_019163 | 3300049675 | Bacteria | 1120 |
| 715 | Ga0501249_011084 | 3300049679 | Bacteria | 1890 |
| 716 | Ga0501251_005905 | 3300049681 | Bacteria | 1315 |
| 717 | Ga0501225_0010071 | 3300049705 | Bacteria | 2684 |
| 718 | Ga0501225_0011279 | 3300049705 | Bacteria | 2516 |
| 719 | Ga0501225_0012182 | 3300049705 | Bacteria | 2416 |
| 720 | Ga0501234_003723 | 3300049707 | Bacteria | 2398 |
| 721 | Ga0501234_010506 | 3300049707 | Bacteria | 1443 |
| 722 | Ga0501241_019925 | 3300049758 | Bacteria | 1233 |
| 723 | Ga0501273_001028 | 3300049770 | Bacteria | 2517 |
| 724 | Ga0501283_005330 | 3300049779 | Bacteria | 1766 |
| 725 | Ga0501204_004382 | 3300049850 | Bacteria | 1520 |
| 726 | Ga0501212_004155 | 3300049851 | Bacteria | 1852 |
| 727 | nmdc:mga05p37_167155_c1 | 3300050507 | Bacteria | 2684 |
| 728 | nmdc:mga05p37_20534_c1 | 3300050507 | Bacteria | 7991 |
| 729 | nmdc:mga05p37_30117_c1 | 3300050507 | Bacteria | 6622 |
| 730 | nmdc:mga05p37_572771_c1 | 3300050507 | Bacteria | 1280 |
| 731 | nmdc:mga05p37_802923_c1 | 3300050507 | Unclassified | 1029 |
| 732 | nmdc:mga05p37_89552_c1 | 3300050507 | Bacteria | 3792 |
| 733 | nmdc:mga09592_158632_c1 | 3300050508 | Bacteria | 1953 |
| 734 | nmdc:mga09592_47623_c1 | 3300050508 | Bacteria | 3613 |
| 735 | nmdc:mga0qj67_34559_c1 | 3300050509 | Unclassified | 3949 |
| 736 | nmdc:mga0qj67_76094_c1 | 3300050509 | Unclassified | 2684 |
| 737 | nmdc:mga08y16_19882_c1 | 3300050511 | Bacteria | 7083 |
| 738 | nmdc:mga08y16_251000_c1 | 3300050511 | Unclassified | 1828 |
| 739 | nmdc:mga08y16_40139_c1 | 3300050511 | Bacteria | 4907 |
| 740 | nmdc:mga08y16_45727_c1 | 3300050511 | Bacteria | 4586 |
| 741 | nmdc:mga0n895_322262_c1 | 3300050512 | Bacteria | 1566 |
| 742 | nmdc:mga0n895_364995_c1 | 3300050512 | Unclassified | 1462 |
| 743 | nmdc:mga0n895_55020_c1 | 3300050512 | Bacteria | 3915 |
| 744 | nmdc:mga0n895_719518_c1 | 3300050512 | Unclassified | 993 |
| 745 | nmdc:mga0rr50_102_c1 | 3300050513 | Bacteria | 48211 |
| 746 | nmdc:mga0rr50_85345_c1 | 3300050513 | Bacteria | 2447 |
| 747 | nmdc:mga08x19_17997_c1 | 3300050514 | Bacteria | 4328 |
| 748 | nmdc:mga08x19_195689_c1 | 3300050514 | Bacteria | 1384 |
| 749 | nmdc:mga08x19_29_c1 | 3300050514 | Bacteria | 214647 |
| 750 | nmdc:mga0a205_138337_c1 | 3300050515 | Bacteria | 2335 |
| 751 | nmdc:mga0a205_16862_c1 | 3300050515 | Bacteria | 6837 |
| 752 | nmdc:mga0a205_18763_c1 | 3300050515 | Bacteria | 5888 |
| 753 | nmdc:mga0a205_370482_c1 | 3300050515 | Unclassified | 1298 |
| 754 | nmdc:mga0a205_8373_c1 | 3300050515 | Bacteria | 9409 |
| 755 | Ga0500643_006219 | 3300053087 | Bacteria | 5021 |
| 756 | Ga0530510_0223263 | 3300061734 | Unclassified | 1400 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0546565 | Ga0395898_0546565_420_1070 | 209 |
| 2 | 3300025893 | Ga0207682_10172915 | Ga0207682_101729151 | 218 |
| 3 | 3300003322 | rootL2_10159794 | rootL2_101597943 | 224 |
| 4 | 3300053087 | Ga0500643_006219 | Ga0500643_006219_239_1027 | 228 |
| 5 | 3300048929 | Ga0496126_0044283 | Ga0496126_0044283_2027_2848 | 233 |
| 6 | 3300005364 | Ga0070673_100049770 | Ga0070673_1000497703 | 249 |
| 7 | 3300005545 | Ga0070695_100264258 | Ga0070695_1002642581 | 249 |
| 8 | 3300006358 | Ga0068871_100260611 | Ga0068871_1002606112 | 249 |
| 9 | 3300025960 | Ga0207651_10034668 | Ga0207651_100346683 | 249 |
| 10 | 3300049681 | Ga0501251_005905 | Ga0501251_005905_311_1063 | 249 |
| 11 | 3300005347 | Ga0070668_100001615 | Ga0070668_10000161510 | 250 |
| 12 | 3300005365 | Ga0070688_100015714 | Ga0070688_1000157144 | 250 |
| 13 | 3300009553 | Ga0105249_10000003 | Ga0105249_10000003268 | 250 |
| 14 | 3300013306 | Ga0163162_10000020 | Ga0163162_1000002020 | 250 |
| 15 | 3300014326 | Ga0157380_10078527 | Ga0157380_100785272 | 250 |
| 16 | 3300025903 | Ga0207680_10271851 | Ga0207680_102718512 | 250 |
| 17 | 3300025961 | Ga0207712_10000232 | Ga0207712_1000023222 | 250 |
| 18 | 3300025972 | Ga0207668_10001515 | Ga0207668_100015159 | 250 |
| 19 | 3300026089 | Ga0207648_10338214 | Ga0207648_103382142 | 250 |
| 20 | 3300044673 | Ga0453683_0003384 | Ga0453683_0003384_7384_8187 | 250 |
| 21 | 3300009553 | Ga0105249_10539027 | Ga0105249_105390272 | 251 |
| 22 | 3300026116 | Ga0207674_10124936 | Ga0207674_101249362 | 251 |
| 23 | 3300005546 | Ga0070696_100370023 | Ga0070696_1003700232 | 252 |
| 24 | 3300009148 | Ga0105243_10632729 | Ga0105243_106327292 | 252 |
| 25 | 3300009553 | Ga0105249_10051054 | Ga0105249_100510543 | 252 |
| 26 | 3300037471 | Ga0395905_0000787 | Ga0395905_0000787_2510_3295 | 254 |
| 27 | 3300037471 | Ga0395905_0009249 | Ga0395905_0009249_360_1145 | 254 |
| 28 | 3300061734 | Ga0530510_0223263 | Ga0530510_0223263_448_1284 | 254 |
| 29 | 3300009148 | Ga0105243_10210884 | Ga0105243_102108842 | 255 |
| 30 | 3300037471 | Ga0395905_0154044 | Ga0395905_0154044_503_1291 | 255 |
| 31 | 3300039093 | Ga0400489_68120 | Ga0400489_68120_710_1498 | 255 |
| 32 | 3300005549 | Ga0070704_100378662 | Ga0070704_1003786622 | 256 |
| 33 | 3300037418 | Ga0395900_0741377 | Ga0395900_0741377_33_812 | 256 |
| 34 | 3300005334 | Ga0068869_100021665 | Ga0068869_1000216653 | 257 |
| 35 | 3300005719 | Ga0068861_100014204 | Ga0068861_1000142043 | 257 |
| 36 | 3300006852 | Ga0075433_10055254 | Ga0075433_100552543 | 257 |
| 37 | 3300006871 | Ga0075434_100040693 | Ga0075434_1000406933 | 257 |
| 38 | 3300009098 | Ga0105245_10152304 | Ga0105245_101523042 | 257 |
| 39 | 3300009147 | Ga0114129_10261157 | Ga0114129_102611572 | 257 |
| 40 | 3300010375 | Ga0105239_10109632 | Ga0105239_101096323 | 257 |
| 41 | 3300013297 | Ga0157378_10254782 | Ga0157378_102547822 | 257 |
| 42 | 3300013306 | Ga0163162_10009766 | Ga0163162_100097666 | 257 |
| 43 | 3300017792 | Ga0163161_10057508 | Ga0163161_100575083 | 257 |
| 44 | 3300025901 | Ga0207688_10276182 | Ga0207688_102761821 | 257 |
| 45 | 3300025942 | Ga0207689_10000794 | Ga0207689_1000079421 | 257 |
| 46 | 3300026118 | Ga0207675_100000960 | Ga0207675_1000009603 | 257 |
| 47 | 3300038996 | Ga0242420_002795 | Ga0242420_002795_87_917 | 257 |
| 48 | 3300005543 | Ga0070672_100037399 | Ga0070672_1000373993 | 258 |
| 49 | 3300005617 | Ga0068859_100196044 | Ga0068859_1001960442 | 258 |
| 50 | 3300006931 | Ga0097620_100196045 | Ga0097620_1001960452 | 258 |
| 51 | 3300009148 | Ga0105243_10000792 | Ga0105243_100007922 | 258 |
| 52 | 3300009176 | Ga0105242_10000370 | Ga0105242_1000037028 | 258 |
| 53 | 3300009177 | Ga0105248_10222274 | Ga0105248_102222742 | 258 |
| 54 | 3300013297 | Ga0157378_10000342 | Ga0157378_1000034212 | 258 |
| 55 | 3300025922 | Ga0207646_10138723 | Ga0207646_101387233 | 258 |
| 56 | 3300025934 | Ga0207686_10004855 | Ga0207686_100048552 | 258 |
| 57 | 3300025935 | Ga0207709_10000595 | Ga0207709_100005952 | 258 |
| 58 | 3300025940 | Ga0207691_10066661 | Ga0207691_100666614 | 258 |
| 59 | 3300025942 | Ga0207689_10142963 | Ga0207689_101429633 | 258 |
| 60 | 3300048909 | Ga0496106_0035942 | Ga0496106_0035942_51_881 | 258 |
| 61 | 3300005406 | Ga0070703_10000070 | Ga0070703_1000007034 | 259 |
| 62 | 3300005841 | Ga0068863_100401607 | Ga0068863_1004016071 | 259 |
| 63 | 3300025885 | Ga0207653_10000332 | Ga0207653_1000033220 | 259 |
| 64 | 3300046539 | Ga0495621_0112519 | Ga0495621_0112519_178_1008 | 259 |
| 65 | 3300001432 | JGI24034J14986_100233 | JGI24034J14986_1002332 | 260 |
| 66 | 3300002074 | JGI24748J21848_1000010 | JGI24748J21848_1000010114 | 260 |
| 67 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_10000001568 | 260 |
| 68 | 3300005334 | Ga0068869_100202923 | Ga0068869_1002029231 | 260 |
| 69 | 3300005337 | Ga0070682_100433228 | Ga0070682_1004332281 | 260 |
| 70 | 3300005340 | Ga0070689_100261285 | Ga0070689_1002612852 | 260 |
| 71 | 3300005343 | Ga0070687_100110792 | Ga0070687_1001107922 | 260 |
| 72 | 3300005343 | Ga0070687_100168368 | Ga0070687_1001683682 | 260 |
| 73 | 3300005354 | Ga0070675_100216495 | Ga0070675_1002164952 | 260 |
| 74 | 3300005355 | Ga0070671_100065096 | Ga0070671_1000650963 | 260 |
| 75 | 3300005364 | Ga0070673_100358862 | Ga0070673_1003588622 | 260 |
| 76 | 3300005406 | Ga0070703_10002781 | Ga0070703_100027813 | 260 |
| 77 | 3300005440 | Ga0070705_100005049 | Ga0070705_1000050493 | 260 |
| 78 | 3300005440 | Ga0070705_100051410 | Ga0070705_1000514102 | 260 |
| 79 | 3300005444 | Ga0070694_100012777 | Ga0070694_1000127772 | 260 |
| 80 | 3300005444 | Ga0070694_100051152 | Ga0070694_1000511523 | 260 |
| 81 | 3300005444 | Ga0070694_100311291 | Ga0070694_1003112912 | 260 |
| 82 | 3300005459 | Ga0068867_100460414 | Ga0068867_1004604141 | 260 |
| 83 | 3300005468 | Ga0070707_100018624 | Ga0070707_1000186243 | 260 |
| 84 | 3300005471 | Ga0070698_100008698 | Ga0070698_1000086985 | 260 |
| 85 | 3300005544 | Ga0070686_100033399 | Ga0070686_1000333992 | 260 |
| 86 | 3300005547 | Ga0070693_100006979 | Ga0070693_1000069793 | 260 |
| 87 | 3300005549 | Ga0070704_100016807 | Ga0070704_1000168075 | 260 |
| 88 | 3300005549 | Ga0070704_100441413 | Ga0070704_1004414131 | 260 |
| 89 | 3300005615 | Ga0070702_100005034 | Ga0070702_1000050345 | 260 |
| 90 | 3300005615 | Ga0070702_100120277 | Ga0070702_1001202772 | 260 |
| 91 | 3300005719 | Ga0068861_100281957 | Ga0068861_1002819572 | 260 |
| 92 | 3300005834 | Ga0068851_10001570 | Ga0068851_100015706 | 260 |
| 93 | 3300005841 | Ga0068863_100095379 | Ga0068863_1000953792 | 260 |
| 94 | 3300005842 | Ga0068858_100000005 | Ga0068858_100000005171 | 260 |
| 95 | 3300005842 | Ga0068858_100101047 | Ga0068858_1001010472 | 260 |
| 96 | 3300005842 | Ga0068858_100113066 | Ga0068858_1001130663 | 260 |
| 97 | 3300005842 | Ga0068858_100126165 | Ga0068858_1001261653 | 260 |
| 98 | 3300005843 | Ga0068860_100086317 | Ga0068860_1000863173 | 260 |
| 99 | 3300005843 | Ga0068860_100155505 | Ga0068860_1001555052 | 260 |
| 100 | 3300006237 | Ga0097621_100102914 | Ga0097621_1001029141 | 260 |
| 101 | 3300006237 | Ga0097621_100178552 | Ga0097621_1001785523 | 260 |
| 102 | 3300009094 | Ga0111539_10144800 | Ga0111539_101448003 | 260 |
| 103 | 3300009101 | Ga0105247_10000002 | Ga0105247_10000002426 | 260 |
| 104 | 3300009101 | Ga0105247_10041130 | Ga0105247_100411303 | 260 |
| 105 | 3300009147 | Ga0114129_10130383 | Ga0114129_101303833 | 260 |
| 106 | 3300009148 | Ga0105243_10000182 | Ga0105243_100001825 | 260 |
| 107 | 3300009148 | Ga0105243_10631933 | Ga0105243_106319331 | 260 |
| 108 | 3300009148 | Ga0105243_10632908 | Ga0105243_106329081 | 260 |
| 109 | 3300009177 | Ga0105248_10042861 | Ga0105248_100428613 | 260 |
| 110 | 3300009545 | Ga0105237_10001910 | Ga0105237_100019109 | 260 |
| 111 | 3300009553 | Ga0105249_10400831 | Ga0105249_104008312 | 260 |
| 112 | 3300010375 | Ga0105239_10333000 | Ga0105239_103330003 | 260 |
| 113 | 3300013297 | Ga0157378_10098022 | Ga0157378_100980222 | 260 |
| 114 | 3300013306 | Ga0163162_10045274 | Ga0163162_100452743 | 260 |
| 115 | 3300013306 | Ga0163162_10487603 | Ga0163162_104876032 | 260 |
| 116 | 3300014326 | Ga0157380_10249271 | Ga0157380_102492712 | 260 |
| 117 | 3300014968 | Ga0157379_10061460 | Ga0157379_100614603 | 260 |
| 118 | 3300025223 | Ga0207672_1000050 | Ga0207672_10000509 | 260 |
| 119 | 3300025321 | Ga0207656_10000959 | Ga0207656_100009597 | 260 |
| 120 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002426 | 260 |
| 121 | 3300025914 | Ga0207671_10009096 | Ga0207671_100090964 | 260 |
| 122 | 3300025918 | Ga0207662_10107120 | Ga0207662_101071201 | 260 |
| 123 | 3300025918 | Ga0207662_10244213 | Ga0207662_102442132 | 260 |
| 124 | 3300025922 | Ga0207646_10015551 | Ga0207646_100155513 | 260 |
| 125 | 3300025931 | Ga0207644_10000102 | Ga0207644_1000010210 | 260 |
| 126 | 3300025934 | Ga0207686_10000018 | Ga0207686_10000018127 | 260 |
| 127 | 3300025934 | Ga0207686_10000021 | Ga0207686_1000002163 | 260 |
| 128 | 3300025935 | Ga0207709_10000069 | Ga0207709_1000006988 | 260 |
| 129 | 3300025936 | Ga0207670_10167102 | Ga0207670_101671021 | 260 |
| 130 | 3300025938 | Ga0207704_10518383 | Ga0207704_105183832 | 260 |
| 131 | 3300025940 | Ga0207691_10145915 | Ga0207691_101459152 | 260 |
| 132 | 3300025941 | Ga0207711_10047141 | Ga0207711_100471413 | 260 |
| 133 | 3300025942 | Ga0207689_10217816 | Ga0207689_102178163 | 260 |
| 134 | 3300025960 | Ga0207651_10393002 | Ga0207651_103930022 | 260 |
| 135 | 3300025986 | Ga0207658_10042608 | Ga0207658_100426083 | 260 |
| 136 | 3300026035 | Ga0207703_10000475 | Ga0207703_1000047510 | 260 |
| 137 | 3300026035 | Ga0207703_10054024 | Ga0207703_100540243 | 260 |
| 138 | 3300026035 | Ga0207703_10127792 | Ga0207703_101277922 | 260 |
| 139 | 3300026075 | Ga0207708_10650591 | Ga0207708_106505911 | 260 |
| 140 | 3300026088 | Ga0207641_10177934 | Ga0207641_101779343 | 260 |
| 141 | 3300026089 | Ga0207648_10092849 | Ga0207648_100928492 | 260 |
| 142 | 3300028380 | Ga0268265_10070955 | Ga0268265_100709551 | 260 |
| 143 | 3300028381 | Ga0268264_10123277 | Ga0268264_101232772 | 260 |
| 144 | 3300028381 | Ga0268264_10154925 | Ga0268264_101549253 | 260 |
| 145 | 3300049515 | Ga0501292_001906 | Ga0501292_001906_176_1006 | 260 |
| 146 | 3300049518 | Ga0501295_019888 | Ga0501295_019888_37_867 | 260 |
| 147 | 3300049521 | Ga0501298_014548 | Ga0501298_014548_207_1037 | 260 |
| 148 | 3300049652 | Ga0501202_002243 | Ga0501202_002243_473_1303 | 260 |
| 149 | 3300049661 | Ga0501217_014533 | Ga0501217_014533_723_1553 | 260 |
| 150 | 3300049663 | Ga0501223_008576 | Ga0501223_008576_1065_1895 | 260 |
| 151 | 3300049665 | Ga0501227_004379 | Ga0501227_004379_1665_2495 | 260 |
| 152 | 3300049675 | Ga0501243_019163 | Ga0501243_019163_75_905 | 260 |
| 153 | 3300049705 | Ga0501225_0012182 | Ga0501225_0012182_1408_2238 | 260 |
| 154 | 3300049758 | Ga0501241_019925 | Ga0501241_019925_180_1010 | 260 |
| 155 | 3300050507 | nmdc:mga05p37_167155_c1 | nmdc:mga05p37_167155_c1_814_1644 | 260 |
| 156 | 3300050511 | nmdc:mga08y16_251000_c1 | nmdc:mga08y16_251000_c1_286_1116 | 260 |
| 157 | 3300005344 | Ga0070661_100157254 | Ga0070661_1001572542 | 261 |
| 158 | 3300005444 | Ga0070694_100019372 | Ga0070694_1000193723 | 261 |
| 159 | 3300005536 | Ga0070697_100021115 | Ga0070697_1000211152 | 261 |
| 160 | 3300005546 | Ga0070696_100015591 | Ga0070696_1000155912 | 261 |
| 161 | 3300005577 | Ga0068857_100039642 | Ga0068857_1000396422 | 261 |
| 162 | 3300005618 | Ga0068864_100094593 | Ga0068864_1000945933 | 261 |
| 163 | 3300005842 | Ga0068858_100537740 | Ga0068858_1005377402 | 261 |
| 164 | 3300006871 | Ga0075434_100072207 | Ga0075434_1000722073 | 261 |
| 165 | 3300014325 | Ga0163163_10333987 | Ga0163163_103339872 | 261 |
| 166 | 3300025911 | Ga0207654_10147211 | Ga0207654_101472112 | 261 |
| 167 | 3300025925 | Ga0207650_10122064 | Ga0207650_101220642 | 261 |
| 168 | 3300026088 | Ga0207641_10668032 | Ga0207641_106680322 | 261 |
| 169 | 3300026095 | Ga0207676_10030718 | Ga0207676_100307183 | 261 |
| 170 | 3300026116 | Ga0207674_10043919 | Ga0207674_100439193 | 261 |
| 171 | 3300032002 | Ga0307416_100819330 | Ga0307416_1008193301 | 261 |
| 172 | 3300037418 | Ga0395900_0239699 | Ga0395900_0239699_432_1262 | 261 |
| 173 | 3300037466 | Ga0395898_0184418 | Ga0395898_0184418_837_1667 | 261 |
| 174 | 3300038443 | Ga0395901_0322819 | Ga0395901_0322819_421_1251 | 261 |
| 175 | 3300039437 | Ga0436365_0206631 | Ga0436365_0206631_1160_2005 | 261 |
| 176 | 3300042005 | Ga0439448_0006017 | Ga0439448_0006017_1497_2327 | 261 |
| 177 | 3300042012 | Ga0439455_0003976 | Ga0439455_0003976_1963_2793 | 261 |
| 178 | 3300005445 | Ga0070708_100216027 | Ga0070708_1002160272 | 262 |
| 179 | 3300005471 | Ga0070698_100180858 | Ga0070698_1001808582 | 262 |
| 180 | 3300005518 | Ga0070699_100114781 | Ga0070699_1001147813 | 262 |
| 181 | 3300005536 | Ga0070697_100030854 | Ga0070697_1000308541 | 262 |
| 182 | 3300005546 | Ga0070696_100082247 | Ga0070696_1000822472 | 262 |
| 183 | 3300005546 | Ga0070696_100389555 | Ga0070696_1003895552 | 262 |
| 184 | 3300009094 | Ga0111539_10522706 | Ga0111539_105227062 | 262 |
| 185 | 3300025910 | Ga0207684_10138630 | Ga0207684_101386301 | 262 |
| 186 | 3300031548 | Ga0307408_100024802 | Ga0307408_1000248022 | 262 |
| 187 | 3300031824 | Ga0307413_10205849 | Ga0307413_102058492 | 262 |
| 188 | 3300031901 | Ga0307406_10022725 | Ga0307406_100227252 | 262 |
| 189 | 3300031903 | Ga0307407_10101320 | Ga0307407_101013202 | 262 |
| 190 | 3300031911 | Ga0307412_10030476 | Ga0307412_100304763 | 262 |
| 191 | 3300032004 | Ga0307414_10003383 | Ga0307414_100033836 | 262 |
| 192 | 3300048915 | Ga0496112_0115880 | Ga0496112_0115880_1550_2380 | 262 |
| 193 | 3300049652 | Ga0501202_005068 | Ga0501202_005068_295_1125 | 262 |
| 194 | 3300049661 | Ga0501217_020678 | Ga0501217_020678_484_1314 | 262 |
| 195 | 3300049663 | Ga0501223_012618 | Ga0501223_012618_328_1158 | 262 |
| 196 | 3300049667 | Ga0501230_001052 | Ga0501230_001052_606_1436 | 262 |
| 197 | 3300049705 | Ga0501225_0010071 | Ga0501225_0010071_447_1277 | 262 |
| 198 | 3300049707 | Ga0501234_010506 | Ga0501234_010506_193_1023 | 262 |
| 199 | 3300049851 | Ga0501212_004155 | Ga0501212_004155_451_1281 | 262 |
| 200 | 3300005293 | Ga0065715_10090255 | Ga0065715_100902556 | 263 |
| 201 | 3300005293 | Ga0065715_10134000 | Ga0065715_101340001 | 263 |
| 202 | 3300005295 | Ga0065707_10184306 | Ga0065707_101843062 | 263 |
| 203 | 3300005330 | Ga0070690_100001562 | Ga0070690_1000015626 | 263 |
| 204 | 3300005343 | Ga0070687_100033725 | Ga0070687_1000337252 | 263 |
| 205 | 3300005345 | Ga0070692_10095891 | Ga0070692_100958912 | 263 |
| 206 | 3300005353 | Ga0070669_100511382 | Ga0070669_1005113822 | 263 |
| 207 | 3300005364 | Ga0070673_100051504 | Ga0070673_1000515042 | 263 |
| 208 | 3300005440 | Ga0070705_100153536 | Ga0070705_1001535362 | 263 |
| 209 | 3300005444 | Ga0070694_100257655 | Ga0070694_1002576552 | 263 |
| 210 | 3300005444 | Ga0070694_100265247 | Ga0070694_1002652472 | 263 |
| 211 | 3300005467 | Ga0070706_100516116 | Ga0070706_1005161162 | 263 |
| 212 | 3300005468 | Ga0070707_100104173 | Ga0070707_1001041732 | 263 |
| 213 | 3300005518 | Ga0070699_100036747 | Ga0070699_1000367473 | 263 |
| 214 | 3300005544 | Ga0070686_100000559 | Ga0070686_10000055918 | 263 |
| 215 | 3300005545 | Ga0070695_100048122 | Ga0070695_1000481222 | 263 |
| 216 | 3300005549 | Ga0070704_100065324 | Ga0070704_1000653243 | 263 |
| 217 | 3300005617 | Ga0068859_100070691 | Ga0068859_1000706913 | 263 |
| 218 | 3300005842 | Ga0068858_100158410 | Ga0068858_1001584102 | 263 |
| 219 | 3300006852 | Ga0075433_10635207 | Ga0075433_106352071 | 263 |
| 220 | 3300006931 | Ga0097620_100070690 | Ga0097620_1000706903 | 263 |
| 221 | 3300014326 | Ga0157380_10094680 | Ga0157380_100946802 | 263 |
| 222 | 3300025918 | Ga0207662_10228548 | Ga0207662_102285482 | 263 |
| 223 | 3300025921 | Ga0207652_10166483 | Ga0207652_101664832 | 263 |
| 224 | 3300025922 | Ga0207646_10069826 | Ga0207646_100698263 | 263 |
| 225 | 3300025960 | Ga0207651_10032451 | Ga0207651_100324512 | 263 |
| 226 | 3300026116 | Ga0207674_10224200 | Ga0207674_102242002 | 263 |
| 227 | 2162886007 | SwRhRL2b_contig_2665322 | SwRhRL2b_0235.00006870 | 264 |
| 228 | 3300005295 | Ga0065707_10012515 | Ga0065707_100125152 | 264 |
| 229 | 3300005441 | Ga0070700_100000055 | Ga0070700_10000005538 | 264 |
| 230 | 3300005536 | Ga0070697_100082386 | Ga0070697_1000823862 | 264 |
| 231 | 3300005617 | Ga0068859_100000586 | Ga0068859_1000005864 | 264 |
| 232 | 3300005719 | Ga0068861_100016686 | Ga0068861_1000166863 | 264 |
| 233 | 3300006931 | Ga0097620_100000586 | Ga0097620_1000005864 | 264 |
| 234 | 3300009147 | Ga0114129_10042631 | Ga0114129_100426312 | 264 |
| 235 | 3300009174 | Ga0105241_10323466 | Ga0105241_103234662 | 264 |
| 236 | 3300009177 | Ga0105248_10013649 | Ga0105248_100136495 | 264 |
| 237 | 3300013296 | Ga0157374_10360317 | Ga0157374_103603172 | 264 |
| 238 | 3300013308 | Ga0157375_10464767 | Ga0157375_104647671 | 264 |
| 239 | 3300014325 | Ga0163163_10005683 | Ga0163163_100056833 | 264 |
| 240 | 3300025926 | Ga0207659_10236189 | Ga0207659_102361892 | 264 |
| 241 | 3300025941 | Ga0207711_10002579 | Ga0207711_1000257912 | 264 |
| 242 | 3300026075 | Ga0207708_10000026 | Ga0207708_1000002632 | 264 |
| 243 | 3300026118 | Ga0207675_100029991 | Ga0207675_1000299913 | 264 |
| 244 | 3300031548 | Ga0307408_100164581 | Ga0307408_1001645812 | 264 |
| 245 | 3300031731 | Ga0307405_10278375 | Ga0307405_102783752 | 264 |
| 246 | 3300031911 | Ga0307412_10112261 | Ga0307412_101122613 | 264 |
| 247 | 3300032002 | Ga0307416_100558438 | Ga0307416_1005584382 | 264 |
| 248 | 3300032002 | Ga0307416_100761940 | Ga0307416_1007619402 | 264 |
| 249 | 3300049663 | Ga0501223_010404 | Ga0501223_010404_152_982 | 264 |
| 250 | 3300049664 | Ga0501224_023886 | Ga0501224_023886_25_855 | 264 |
| 251 | 3300049665 | Ga0501227_047658 | Ga0501227_047658_154_984 | 264 |
| 252 | 3300049668 | Ga0501233_004439 | Ga0501233_004439_1610_2440 | 264 |
| 253 | 3300049669 | Ga0501235_035980 | Ga0501235_035980_106_936 | 264 |
| 254 | 3300049675 | Ga0501243_008705 | Ga0501243_008705_52_882 | 264 |
| 255 | 3300049679 | Ga0501249_011084 | Ga0501249_011084_344_1174 | 264 |
| 256 | 3300049705 | Ga0501225_0011279 | Ga0501225_0011279_276_1106 | 264 |
| 257 | 3300049707 | Ga0501234_003723 | Ga0501234_003723_913_1743 | 264 |
| 258 | 3300049770 | Ga0501273_001028 | Ga0501273_001028_1241_2071 | 264 |
| 259 | 3300049850 | Ga0501204_004382 | Ga0501204_004382_91_921 | 264 |
| 260 | 3300050511 | nmdc:mga08y16_19882_c1 | nmdc:mga08y16_19882_c1_3431_4264 | 264 |
| 261 | 3300000532 | CNAas_1000304 | CNAas_10003044 | 265 |
| 262 | 3300005289 | Ga0065704_10115131 | Ga0065704_101151312 | 265 |
| 263 | 3300005334 | Ga0068869_100156164 | Ga0068869_1001561642 | 265 |
| 264 | 3300005340 | Ga0070689_100001010 | Ga0070689_10000101012 | 265 |
| 265 | 3300005341 | Ga0070691_10219344 | Ga0070691_102193441 | 265 |
| 266 | 3300005345 | Ga0070692_10047476 | Ga0070692_100474763 | 265 |
| 267 | 3300005353 | Ga0070669_100006636 | Ga0070669_1000066363 | 265 |
| 268 | 3300005459 | Ga0068867_100077899 | Ga0068867_1000778993 | 265 |
| 269 | 3300005543 | Ga0070672_100022167 | Ga0070672_1000221672 | 265 |
| 270 | 3300005578 | Ga0068854_100135728 | Ga0068854_1001357281 | 265 |
| 271 | 3300005578 | Ga0068854_100327073 | Ga0068854_1003270732 | 265 |
| 272 | 3300005719 | Ga0068861_100005663 | Ga0068861_1000056633 | 265 |
| 273 | 3300005841 | Ga0068863_100294465 | Ga0068863_1002944652 | 265 |
| 274 | 3300005844 | Ga0068862_100005732 | Ga0068862_1000057327 | 265 |
| 275 | 3300009094 | Ga0111539_10106467 | Ga0111539_101064673 | 265 |
| 276 | 3300009174 | Ga0105241_10210850 | Ga0105241_102108501 | 265 |
| 277 | 3300009177 | Ga0105248_10275645 | Ga0105248_102756452 | 265 |
| 278 | 3300009553 | Ga0105249_10010555 | Ga0105249_100105553 | 265 |
| 279 | 3300011119 | Ga0105246_10139604 | Ga0105246_101396042 | 265 |
| 280 | 3300013297 | Ga0157378_10764053 | Ga0157378_107640531 | 265 |
| 281 | 3300013306 | Ga0163162_10166578 | Ga0163162_101665781 | 265 |
| 282 | 3300013308 | Ga0157375_10080235 | Ga0157375_100802353 | 265 |
| 283 | 3300014326 | Ga0157380_10017360 | Ga0157380_100173602 | 265 |
| 284 | 3300017792 | Ga0163161_10270006 | Ga0163161_102700062 | 265 |
| 285 | 3300025907 | Ga0207645_10181273 | Ga0207645_101812732 | 265 |
| 286 | 3300025908 | Ga0207643_10008153 | Ga0207643_100081533 | 265 |
| 287 | 3300025911 | Ga0207654_10037005 | Ga0207654_100370052 | 265 |
| 288 | 3300025918 | Ga0207662_10253814 | Ga0207662_102538142 | 265 |
| 289 | 3300025923 | Ga0207681_10088152 | Ga0207681_100881522 | 265 |
| 290 | 3300025936 | Ga0207670_10000275 | Ga0207670_1000027524 | 265 |
| 291 | 3300025942 | Ga0207689_10242056 | Ga0207689_102420562 | 265 |
| 292 | 3300026075 | Ga0207708_10005206 | Ga0207708_100052066 | 265 |
| 293 | 3300026089 | Ga0207648_10061971 | Ga0207648_100619712 | 265 |
| 294 | 3300026095 | Ga0207676_10379025 | Ga0207676_103790251 | 265 |
| 295 | 3300028380 | Ga0268265_10075112 | Ga0268265_100751122 | 265 |
| 296 | 3300031548 | Ga0307408_100193129 | Ga0307408_1001931292 | 265 |
| 297 | 3300031731 | Ga0307405_10264114 | Ga0307405_102641141 | 265 |
| 298 | 3300031911 | Ga0307412_10173837 | Ga0307412_101738372 | 265 |
| 299 | 3300032002 | Ga0307416_100431372 | Ga0307416_1004313722 | 265 |
| 300 | 3300035115 | Ga0373941_0032729 | Ga0373941_0032729_142_972 | 265 |
| 301 | 2162886006 | SwRhRL3b_contig_4315247 | SwRhRL3b_0675.00000300 | 266 |
| 302 | 3300005288 | Ga0065714_10064605 | Ga0065714_1006460511 | 266 |
| 303 | 3300005290 | Ga0065712_10067817 | Ga0065712_1006781711 | 266 |
| 304 | 3300005293 | Ga0065715_10091791 | Ga0065715_100917912 | 266 |
| 305 | 3300005345 | Ga0070692_10108091 | Ga0070692_101080912 | 266 |
| 306 | 3300005441 | Ga0070700_100132399 | Ga0070700_1001323992 | 266 |
| 307 | 3300005539 | Ga0068853_100034814 | Ga0068853_1000348143 | 266 |
| 308 | 3300005545 | Ga0070695_100166542 | Ga0070695_1001665421 | 266 |
| 309 | 3300005549 | Ga0070704_100610852 | Ga0070704_1006108521 | 266 |
| 310 | 3300005615 | Ga0070702_100018033 | Ga0070702_1000180332 | 266 |
| 311 | 3300005616 | Ga0068852_100185520 | Ga0068852_1001855202 | 266 |
| 312 | 3300005843 | Ga0068860_100051120 | Ga0068860_1000511203 | 266 |
| 313 | 3300006237 | Ga0097621_100001987 | Ga0097621_1000019873 | 266 |
| 314 | 3300006358 | Ga0068871_100012702 | Ga0068871_1000127022 | 266 |
| 315 | 3300006852 | Ga0075433_10029567 | Ga0075433_100295673 | 266 |
| 316 | 3300009094 | Ga0111539_10006864 | Ga0111539_1000686413 | 266 |
| 317 | 3300009147 | Ga0114129_10011843 | Ga0114129_100118436 | 266 |
| 318 | 3300025938 | Ga0207704_10119732 | Ga0207704_101197322 | 266 |
| 319 | 3300026041 | Ga0207639_10124116 | Ga0207639_101241163 | 266 |
| 320 | 3300026142 | Ga0207698_10129729 | Ga0207698_101297293 | 266 |
| 321 | 3300050507 | nmdc:mga05p37_20534_c1 | nmdc:mga05p37_20534_c1_5662_6492 | 266 |
| 322 | 3300050511 | nmdc:mga08y16_40139_c1 | nmdc:mga08y16_40139_c1_4019_4855 | 266 |
| 323 | 3300050512 | nmdc:mga0n895_322262_c1 | nmdc:mga0n895_322262_c1_571_1401 | 266 |
| 324 | 3300005295 | Ga0065707_10094651 | Ga0065707_100946511 | 267 |
| 325 | 3300005353 | Ga0070669_100113465 | Ga0070669_1001134653 | 267 |
| 326 | 3300005457 | Ga0070662_100530766 | Ga0070662_1005307661 | 267 |
| 327 | 3300005546 | Ga0070696_100210271 | Ga0070696_1002102712 | 267 |
| 328 | 3300005547 | Ga0070693_100100658 | Ga0070693_1001006583 | 267 |
| 329 | 3300005615 | Ga0070702_100223035 | Ga0070702_1002230352 | 267 |
| 330 | 3300005616 | Ga0068852_100112464 | Ga0068852_1001124642 | 267 |
| 331 | 3300005617 | Ga0068859_100652033 | Ga0068859_1006520332 | 267 |
| 332 | 3300005617 | Ga0068859_100733458 | Ga0068859_1007334581 | 267 |
| 333 | 3300005843 | Ga0068860_100031983 | Ga0068860_1000319833 | 267 |
| 334 | 3300005843 | Ga0068860_100231649 | Ga0068860_1002316492 | 267 |
| 335 | 3300005985 | Ga0081539_10000279 | Ga0081539_1000027980 | 267 |
| 336 | 3300006931 | Ga0097620_100651971 | Ga0097620_1006519712 | 267 |
| 337 | 3300006931 | Ga0097620_100733440 | Ga0097620_1007334401 | 267 |
| 338 | 3300009148 | Ga0105243_10582858 | Ga0105243_105828582 | 267 |
| 339 | 3300009174 | Ga0105241_10314108 | Ga0105241_103141081 | 267 |
| 340 | 3300009177 | Ga0105248_10076353 | Ga0105248_100763531 | 267 |
| 341 | 3300009551 | Ga0105238_10019867 | Ga0105238_100198676 | 267 |
| 342 | 3300011119 | Ga0105246_10540141 | Ga0105246_105401411 | 267 |
| 343 | 3300013306 | Ga0163162_10004174 | Ga0163162_1000417412 | 267 |
| 344 | 3300014325 | Ga0163163_10181778 | Ga0163163_101817782 | 267 |
| 345 | 3300014326 | Ga0157380_10062342 | Ga0157380_100623423 | 267 |
| 346 | 3300014968 | Ga0157379_10374720 | Ga0157379_103747201 | 267 |
| 347 | 3300025923 | Ga0207681_10029307 | Ga0207681_100293072 | 267 |
| 348 | 3300025924 | Ga0207694_10005775 | Ga0207694_100057756 | 267 |
| 349 | 3300025934 | Ga0207686_10128500 | Ga0207686_101285002 | 267 |
| 350 | 3300025935 | Ga0207709_10083688 | Ga0207709_100836882 | 267 |
| 351 | 3300025936 | Ga0207670_10206873 | Ga0207670_102068731 | 267 |
| 352 | 3300026075 | Ga0207708_10284612 | Ga0207708_102846122 | 267 |
| 353 | 3300026089 | Ga0207648_10268796 | Ga0207648_102687962 | 267 |
| 354 | 3300026095 | Ga0207676_10316303 | Ga0207676_103163032 | 267 |
| 355 | 3300026095 | Ga0207676_10627352 | Ga0207676_106273521 | 267 |
| 356 | 3300026116 | Ga0207674_10264235 | Ga0207674_102642352 | 267 |
| 357 | 3300026118 | Ga0207675_100283030 | Ga0207675_1002830302 | 267 |
| 358 | 3300026118 | Ga0207675_100357535 | Ga0207675_1003575352 | 267 |
| 359 | 3300026142 | Ga0207698_10057444 | Ga0207698_100574443 | 267 |
| 360 | 3300026142 | Ga0207698_10276258 | Ga0207698_102762582 | 267 |
| 361 | 3300038996 | Ga0242420_007936 | Ga0242420_007936_630_1460 | 267 |
| 362 | 3300005842 | Ga0068858_100043649 | Ga0068858_1000436493 | 268 |
| 363 | 3300005985 | Ga0081539_10000695 | Ga0081539_1000069529 | 268 |
| 364 | 3300009147 | Ga0114129_10986673 | Ga0114129_109866732 | 268 |
| 365 | 3300026035 | Ga0207703_10015260 | Ga0207703_100152603 | 268 |
| 366 | 3300050507 | nmdc:mga05p37_802923_c1 | nmdc:mga05p37_802923_c1_147_977 | 268 |
| 367 | 3300005536 | Ga0070697_100006751 | Ga0070697_1000067516 | 269 |
| 368 | 3300005364 | Ga0070673_100370000 | Ga0070673_1003700002 | 270 |
| 369 | 3300005438 | Ga0070701_10029396 | Ga0070701_100293962 | 270 |
| 370 | 3300005471 | Ga0070698_100005783 | Ga0070698_1000057834 | 270 |
| 371 | 3300005544 | Ga0070686_100002856 | Ga0070686_1000028567 | 270 |
| 372 | 3300005547 | Ga0070693_100073333 | Ga0070693_1000733332 | 270 |
| 373 | 3300005549 | Ga0070704_100330648 | Ga0070704_1003306482 | 270 |
| 374 | 3300009147 | Ga0114129_10509154 | Ga0114129_105091542 | 270 |
| 375 | 3300009176 | Ga0105242_10000767 | Ga0105242_1000076711 | 270 |
| 376 | 3300014326 | Ga0157380_10013970 | Ga0157380_100139701 | 270 |
| 377 | 3300025934 | Ga0207686_10001930 | Ga0207686_100019305 | 270 |
| 378 | 3300005719 | Ga0068861_100010458 | Ga0068861_1000104588 | 271 |
| 379 | 3300006871 | Ga0075434_100246323 | Ga0075434_1002463232 | 271 |
| 380 | 3300009147 | Ga0114129_10130794 | Ga0114129_101307941 | 271 |
| 381 | 3300009177 | Ga0105248_10036086 | Ga0105248_100360863 | 271 |
| 382 | 3300013297 | Ga0157378_10067451 | Ga0157378_100674511 | 271 |
| 383 | 3300013297 | Ga0157378_10072703 | Ga0157378_100727033 | 271 |
| 384 | 3300026118 | Ga0207675_100430969 | Ga0207675_1004309692 | 271 |
| 385 | 3300046537 | Ga0495598_0115671 | Ga0495598_0115671_11_832 | 271 |
| 386 | 3300050507 | nmdc:mga05p37_30117_c1 | nmdc:mga05p37_30117_c1_3991_4815 | 271 |
| 387 | 3300005334 | Ga0068869_100269679 | Ga0068869_1002696792 | 272 |
| 388 | 3300005344 | Ga0070661_100174773 | Ga0070661_1001747732 | 272 |
| 389 | 3300005457 | Ga0070662_100038792 | Ga0070662_1000387922 | 272 |
| 390 | 3300005458 | Ga0070681_10001765 | Ga0070681_100017656 | 272 |
| 391 | 3300005467 | Ga0070706_100154941 | Ga0070706_1001549412 | 272 |
| 392 | 3300005530 | Ga0070679_100009165 | Ga0070679_1000091654 | 272 |
| 393 | 3300005539 | Ga0068853_100037988 | Ga0068853_1000379883 | 272 |
| 394 | 3300005549 | Ga0070704_100060062 | Ga0070704_1000600622 | 272 |
| 395 | 3300005564 | Ga0070664_100001715 | Ga0070664_1000017154 | 272 |
| 396 | 3300005577 | Ga0068857_100013452 | Ga0068857_1000134524 | 272 |
| 397 | 3300009147 | Ga0114129_10005832 | Ga0114129_100058327 | 272 |
| 398 | 3300013100 | Ga0157373_10026553 | Ga0157373_100265533 | 272 |
| 399 | 3300013297 | Ga0157378_10214703 | Ga0157378_102147032 | 272 |
| 400 | 3300013307 | Ga0157372_10544565 | Ga0157372_105445651 | 272 |
| 401 | 3300013308 | Ga0157375_10025425 | Ga0157375_100254253 | 272 |
| 402 | 3300013308 | Ga0157375_10767318 | Ga0157375_107673181 | 272 |
| 403 | 3300014325 | Ga0163163_10043665 | Ga0163163_100436653 | 272 |
| 404 | 3300014325 | Ga0163163_10503600 | Ga0163163_105036002 | 272 |
| 405 | 3300025910 | Ga0207684_10132301 | Ga0207684_101323013 | 272 |
| 406 | 3300025912 | Ga0207707_10010819 | Ga0207707_100108196 | 272 |
| 407 | 3300025919 | Ga0207657_10075018 | Ga0207657_100750183 | 272 |
| 408 | 3300025920 | Ga0207649_10068408 | Ga0207649_100684082 | 272 |
| 409 | 3300025921 | Ga0207652_10016140 | Ga0207652_100161403 | 272 |
| 410 | 3300025933 | Ga0207706_10060738 | Ga0207706_100607382 | 272 |
| 411 | 3300025941 | Ga0207711_10395128 | Ga0207711_103951282 | 272 |
| 412 | 3300025941 | Ga0207711_10614697 | Ga0207711_106146971 | 272 |
| 413 | 3300025942 | Ga0207689_10268753 | Ga0207689_102687532 | 272 |
| 414 | 3300025945 | Ga0207679_10026276 | Ga0207679_100262763 | 272 |
| 415 | 3300026067 | Ga0207678_10174757 | Ga0207678_101747572 | 272 |
| 416 | 3300026095 | Ga0207676_10071352 | Ga0207676_100713523 | 272 |
| 417 | 3300026116 | Ga0207674_10000192 | Ga0207674_1000019249 | 272 |
| 418 | 3300031911 | Ga0307412_10145272 | Ga0307412_101452722 | 272 |
| 419 | 3300048909 | Ga0496106_0026559 | Ga0496106_0026559_2387_3211 | 272 |
| 420 | 3300049519 | Ga0501296_003320 | Ga0501296_003320_529_1380 | 272 |
| 421 | 3300049521 | Ga0501298_001045 | Ga0501298_001045_2782_3633 | 272 |
| 422 | 3300049663 | Ga0501223_016828 | Ga0501223_016828_128_979 | 272 |
| 423 | 3300049779 | Ga0501283_005330 | Ga0501283_005330_300_1151 | 272 |
| 424 | 3300050507 | nmdc:mga05p37_89552_c1 | nmdc:mga05p37_89552_c1_1994_2824 | 272 |
| 425 | 3300005293 | Ga0065715_10022399 | Ga0065715_100223991 | 273 |
| 426 | 3300005293 | Ga0065715_10049877 | Ga0065715_100498772 | 273 |
| 427 | 3300005293 | Ga0065715_10111101 | Ga0065715_101111013 | 273 |
| 428 | 3300005295 | Ga0065707_10098569 | Ga0065707_100985692 | 273 |
| 429 | 3300005330 | Ga0070690_100029550 | Ga0070690_1000295501 | 273 |
| 430 | 3300005331 | Ga0070670_100003915 | Ga0070670_1000039159 | 273 |
| 431 | 3300005334 | Ga0068869_100094004 | Ga0068869_1000940041 | 273 |
| 432 | 3300005334 | Ga0068869_100127430 | Ga0068869_1001274302 | 273 |
| 433 | 3300005335 | Ga0070666_10405155 | Ga0070666_104051551 | 273 |
| 434 | 3300005338 | Ga0068868_100057771 | Ga0068868_1000577713 | 273 |
| 435 | 3300005345 | Ga0070692_10060861 | Ga0070692_100608612 | 273 |
| 436 | 3300005353 | Ga0070669_100006486 | Ga0070669_1000064863 | 273 |
| 437 | 3300005353 | Ga0070669_100083977 | Ga0070669_1000839773 | 273 |
| 438 | 3300005355 | Ga0070671_100000822 | Ga0070671_1000008229 | 273 |
| 439 | 3300005355 | Ga0070671_100174259 | Ga0070671_1001742591 | 273 |
| 440 | 3300005356 | Ga0070674_100061892 | Ga0070674_1000618922 | 273 |
| 441 | 3300005365 | Ga0070688_100065383 | Ga0070688_1000653832 | 273 |
| 442 | 3300005367 | Ga0070667_100149791 | Ga0070667_1001497912 | 273 |
| 443 | 3300005434 | Ga0070709_10381179 | Ga0070709_103811791 | 273 |
| 444 | 3300005444 | Ga0070694_100008982 | Ga0070694_1000089821 | 273 |
| 445 | 3300005444 | Ga0070694_100138108 | Ga0070694_1001381082 | 273 |
| 446 | 3300005456 | Ga0070678_100106093 | Ga0070678_1001060931 | 273 |
| 447 | 3300005458 | Ga0070681_10000523 | Ga0070681_1000052312 | 273 |
| 448 | 3300005458 | Ga0070681_10022640 | Ga0070681_100226404 | 273 |
| 449 | 3300005459 | Ga0068867_100024527 | Ga0068867_1000245271 | 273 |
| 450 | 3300005459 | Ga0068867_100091425 | Ga0068867_1000914253 | 273 |
| 451 | 3300005466 | Ga0070685_10016990 | Ga0070685_100169902 | 273 |
| 452 | 3300005467 | Ga0070706_100000138 | Ga0070706_10000013835 | 273 |
| 453 | 3300005468 | Ga0070707_100000197 | Ga0070707_1000001972 | 273 |
| 454 | 3300005471 | Ga0070698_100549674 | Ga0070698_1005496741 | 273 |
| 455 | 3300005530 | Ga0070679_100001109 | Ga0070679_10000110919 | 273 |
| 456 | 3300005539 | Ga0068853_100141786 | Ga0068853_1001417862 | 273 |
| 457 | 3300005544 | Ga0070686_100058582 | Ga0070686_1000585822 | 273 |
| 458 | 3300005545 | Ga0070695_100069698 | Ga0070695_1000696982 | 273 |
| 459 | 3300005545 | Ga0070695_100090543 | Ga0070695_1000905432 | 273 |
| 460 | 3300005545 | Ga0070695_100101837 | Ga0070695_1001018372 | 273 |
| 461 | 3300005546 | Ga0070696_100019299 | Ga0070696_1000192992 | 273 |
| 462 | 3300005547 | Ga0070693_100063597 | Ga0070693_1000635973 | 273 |
| 463 | 3300005549 | Ga0070704_100001928 | Ga0070704_1000019289 | 273 |
| 464 | 3300005549 | Ga0070704_100063819 | Ga0070704_1000638192 | 273 |
| 465 | 3300005549 | Ga0070704_100377243 | Ga0070704_1003772432 | 273 |
| 466 | 3300005564 | Ga0070664_100355048 | Ga0070664_1003550481 | 273 |
| 467 | 3300005578 | Ga0068854_100081023 | Ga0068854_1000810232 | 273 |
| 468 | 3300005614 | Ga0068856_100022591 | Ga0068856_1000225914 | 273 |
| 469 | 3300005615 | Ga0070702_100232557 | Ga0070702_1002325571 | 273 |
| 470 | 3300005616 | Ga0068852_100084959 | Ga0068852_1000849591 | 273 |
| 471 | 3300005617 | Ga0068859_100020147 | Ga0068859_1000201473 | 273 |
| 472 | 3300005617 | Ga0068859_100085206 | Ga0068859_1000852063 | 273 |
| 473 | 3300005617 | Ga0068859_100450996 | Ga0068859_1004509962 | 273 |
| 474 | 3300005618 | Ga0068864_100003228 | Ga0068864_10000322811 | 273 |
| 475 | 3300005618 | Ga0068864_100021949 | Ga0068864_1000219491 | 273 |
| 476 | 3300005618 | Ga0068864_100399101 | Ga0068864_1003991012 | 273 |
| 477 | 3300005719 | Ga0068861_100120544 | Ga0068861_1001205442 | 273 |
| 478 | 3300005719 | Ga0068861_100438438 | Ga0068861_1004384382 | 273 |
| 479 | 3300005840 | Ga0068870_10061014 | Ga0068870_100610142 | 273 |
| 480 | 3300005841 | Ga0068863_100113289 | Ga0068863_1001132892 | 273 |
| 481 | 3300005842 | Ga0068858_100034796 | Ga0068858_1000347962 | 273 |
| 482 | 3300005842 | Ga0068858_100082453 | Ga0068858_1000824533 | 273 |
| 483 | 3300005843 | Ga0068860_100048156 | Ga0068860_1000481563 | 273 |
| 484 | 3300005843 | Ga0068860_100074102 | Ga0068860_1000741023 | 273 |
| 485 | 3300005843 | Ga0068860_100088822 | Ga0068860_1000888224 | 273 |
| 486 | 3300005843 | Ga0068860_100227081 | Ga0068860_1002270812 | 273 |
| 487 | 3300006237 | Ga0097621_100005536 | Ga0097621_1000055362 | 273 |
| 488 | 3300006237 | Ga0097621_100406621 | Ga0097621_1004066211 | 273 |
| 489 | 3300006358 | Ga0068871_100016720 | Ga0068871_1000167202 | 273 |
| 490 | 3300006358 | Ga0068871_100020429 | Ga0068871_1000204293 | 273 |
| 491 | 3300006852 | Ga0075433_10166003 | Ga0075433_101660032 | 273 |
| 492 | 3300006852 | Ga0075433_10214128 | Ga0075433_102141282 | 273 |
| 493 | 3300006871 | Ga0075434_100103051 | Ga0075434_1001030512 | 273 |
| 494 | 3300006871 | Ga0075434_100298664 | Ga0075434_1002986642 | 273 |
| 495 | 3300006881 | Ga0068865_100017990 | Ga0068865_1000179902 | 273 |
| 496 | 3300006881 | Ga0068865_100162468 | Ga0068865_1001624682 | 273 |
| 497 | 3300006914 | Ga0075436_100028599 | Ga0075436_1000285993 | 273 |
| 498 | 3300006931 | Ga0097620_100020148 | Ga0097620_1000201484 | 273 |
| 499 | 3300006931 | Ga0097620_100085205 | Ga0097620_1000852053 | 273 |
| 500 | 3300006931 | Ga0097620_100451034 | Ga0097620_1004510342 | 273 |
| 501 | 3300009093 | Ga0105240_10452654 | Ga0105240_104526542 | 273 |
| 502 | 3300009094 | Ga0111539_10191181 | Ga0111539_101911812 | 273 |
| 503 | 3300009094 | Ga0111539_10200139 | Ga0111539_102001392 | 273 |
| 504 | 3300009098 | Ga0105245_10099496 | Ga0105245_100994963 | 273 |
| 505 | 3300009147 | Ga0114129_10207665 | Ga0114129_102076653 | 273 |
| 506 | 3300009148 | Ga0105243_10238167 | Ga0105243_102381672 | 273 |
| 507 | 3300009176 | Ga0105242_10060633 | Ga0105242_100606332 | 273 |
| 508 | 3300009176 | Ga0105242_10130640 | Ga0105242_101306402 | 273 |
| 509 | 3300009177 | Ga0105248_10040235 | Ga0105248_100402354 | 273 |
| 510 | 3300009177 | Ga0105248_10161549 | Ga0105248_101615492 | 273 |
| 511 | 3300009545 | Ga0105237_10022887 | Ga0105237_100228875 | 273 |
| 512 | 3300009545 | Ga0105237_10093964 | Ga0105237_100939643 | 273 |
| 513 | 3300011119 | Ga0105246_10311504 | Ga0105246_103115042 | 273 |
| 514 | 3300013296 | Ga0157374_10064303 | Ga0157374_100643033 | 273 |
| 515 | 3300013296 | Ga0157374_10524654 | Ga0157374_105246542 | 273 |
| 516 | 3300013297 | Ga0157378_10008224 | Ga0157378_100082246 | 273 |
| 517 | 3300013297 | Ga0157378_10010432 | Ga0157378_100104321 | 273 |
| 518 | 3300013297 | Ga0157378_10757384 | Ga0157378_107573841 | 273 |
| 519 | 3300013306 | Ga0163162_10021352 | Ga0163162_100213522 | 273 |
| 520 | 3300013306 | Ga0163162_10112897 | Ga0163162_101128972 | 273 |
| 521 | 3300013307 | Ga0157372_10024822 | Ga0157372_100248225 | 273 |
| 522 | 3300013308 | Ga0157375_10213775 | Ga0157375_102137752 | 273 |
| 523 | 3300013308 | Ga0157375_10388977 | Ga0157375_103889771 | 273 |
| 524 | 3300014325 | Ga0163163_10028191 | Ga0163163_100281912 | 273 |
| 525 | 3300014325 | Ga0163163_10044443 | Ga0163163_100444433 | 273 |
| 526 | 3300014325 | Ga0163163_10198815 | Ga0163163_101988151 | 273 |
| 527 | 3300014326 | Ga0157380_10033291 | Ga0157380_100332912 | 273 |
| 528 | 3300014745 | Ga0157377_10080375 | Ga0157377_100803751 | 273 |
| 529 | 3300014969 | Ga0157376_10011232 | Ga0157376_100112326 | 273 |
| 530 | 3300014969 | Ga0157376_10154636 | Ga0157376_101546361 | 273 |
| 531 | 3300017792 | Ga0163161_10044122 | Ga0163161_100441223 | 273 |
| 532 | 3300025899 | Ga0207642_10055729 | Ga0207642_100557292 | 273 |
| 533 | 3300025903 | Ga0207680_10146329 | Ga0207680_101463292 | 273 |
| 534 | 3300025906 | Ga0207699_10261780 | Ga0207699_102617801 | 273 |
| 535 | 3300025908 | Ga0207643_10005560 | Ga0207643_100055606 | 273 |
| 536 | 3300025908 | Ga0207643_10043429 | Ga0207643_100434292 | 273 |
| 537 | 3300025910 | Ga0207684_10000023 | Ga0207684_1000002343 | 273 |
| 538 | 3300025912 | Ga0207707_10000006 | Ga0207707_10000006157 | 273 |
| 539 | 3300025912 | Ga0207707_10009795 | Ga0207707_100097957 | 273 |
| 540 | 3300025913 | Ga0207695_10451972 | Ga0207695_104519722 | 273 |
| 541 | 3300025917 | Ga0207660_10000971 | Ga0207660_1000097115 | 273 |
| 542 | 3300025918 | Ga0207662_10013770 | Ga0207662_100137703 | 273 |
| 543 | 3300025921 | Ga0207652_10000216 | Ga0207652_1000021619 | 273 |
| 544 | 3300025922 | Ga0207646_10006385 | Ga0207646_100063852 | 273 |
| 545 | 3300025923 | Ga0207681_10000204 | Ga0207681_1000020411 | 273 |
| 546 | 3300025923 | Ga0207681_10080535 | Ga0207681_100805352 | 273 |
| 547 | 3300025925 | Ga0207650_10004849 | Ga0207650_100048492 | 273 |
| 548 | 3300025925 | Ga0207650_10049137 | Ga0207650_100491373 | 273 |
| 549 | 3300025931 | Ga0207644_10094620 | Ga0207644_100946202 | 273 |
| 550 | 3300025931 | Ga0207644_10141475 | Ga0207644_101414752 | 273 |
| 551 | 3300025933 | Ga0207706_10629695 | Ga0207706_106296951 | 273 |
| 552 | 3300025934 | Ga0207686_10101472 | Ga0207686_101014722 | 273 |
| 553 | 3300025936 | Ga0207670_10106787 | Ga0207670_101067872 | 273 |
| 554 | 3300025938 | Ga0207704_10035226 | Ga0207704_100352262 | 273 |
| 555 | 3300025940 | Ga0207691_10006319 | Ga0207691_100063192 | 273 |
| 556 | 3300025940 | Ga0207691_10102248 | Ga0207691_101022483 | 273 |
| 557 | 3300025941 | Ga0207711_10144384 | Ga0207711_101443842 | 273 |
| 558 | 3300025942 | Ga0207689_10002977 | Ga0207689_1000297713 | 273 |
| 559 | 3300025942 | Ga0207689_10145370 | Ga0207689_101453702 | 273 |
| 560 | 3300025945 | Ga0207679_10111367 | Ga0207679_101113672 | 273 |
| 561 | 3300025986 | Ga0207658_10147216 | Ga0207658_101472161 | 273 |
| 562 | 3300025986 | Ga0207658_10191898 | Ga0207658_101918982 | 273 |
| 563 | 3300026023 | Ga0207677_10071687 | Ga0207677_100716871 | 273 |
| 564 | 3300026035 | Ga0207703_10089392 | Ga0207703_100893922 | 273 |
| 565 | 3300026041 | Ga0207639_10308262 | Ga0207639_103082622 | 273 |
| 566 | 3300026078 | Ga0207702_10055397 | Ga0207702_100553973 | 273 |
| 567 | 3300026088 | Ga0207641_10161155 | Ga0207641_101611552 | 273 |
| 568 | 3300026089 | Ga0207648_10007763 | Ga0207648_100077632 | 273 |
| 569 | 3300026089 | Ga0207648_10171358 | Ga0207648_101713582 | 273 |
| 570 | 3300026095 | Ga0207676_10003407 | Ga0207676_100034076 | 273 |
| 571 | 3300026095 | Ga0207676_10024106 | Ga0207676_100241063 | 273 |
| 572 | 3300026095 | Ga0207676_10066690 | Ga0207676_100666903 | 273 |
| 573 | 3300026095 | Ga0207676_10809076 | Ga0207676_108090761 | 273 |
| 574 | 3300026118 | Ga0207675_100173549 | Ga0207675_1001735491 | 273 |
| 575 | 3300026142 | Ga0207698_10239983 | Ga0207698_102399832 | 273 |
| 576 | 3300027907 | Ga0207428_10122322 | Ga0207428_101223222 | 273 |
| 577 | 3300028379 | Ga0268266_10072750 | Ga0268266_100727502 | 273 |
| 578 | 3300037466 | Ga0395898_0133927 | Ga0395898_0133927_1087_1914 | 273 |
| 579 | 3300037466 | Ga0395898_0289085 | Ga0395898_0289085_36_866 | 273 |
| 580 | 3300048905 | Ga0496102_0159003 | Ga0496102_0159003_879_1709 | 273 |
| 581 | 3300048906 | Ga0496103_0128839 | Ga0496103_0128839_704_1534 | 273 |
| 582 | 3300048907 | Ga0496104_0058907 | Ga0496104_0058907_839_1669 | 273 |
| 583 | 3300048910 | Ga0496107_0248463 | Ga0496107_0248463_480_1310 | 273 |
| 584 | 3300048911 | Ga0496108_0104517 | Ga0496108_0104517_858_1688 | 273 |
| 585 | 3300048912 | Ga0496109_0353874 | Ga0496109_0353874_278_1108 | 273 |
| 586 | 3300048913 | Ga0496110_0144319 | Ga0496110_0144319_889_1719 | 273 |
| 587 | 3300048915 | Ga0496112_0722773 | Ga0496112_0722773_10_840 | 273 |
| 588 | 3300050507 | nmdc:mga05p37_572771_c1 | nmdc:mga05p37_572771_c1_442_1269 | 273 |
| 589 | 3300050512 | nmdc:mga0n895_364995_c1 | nmdc:mga0n895_364995_c1_379_1209 | 273 |
| 590 | 3300050512 | nmdc:mga0n895_719518_c1 | nmdc:mga0n895_719518_c1_58_888 | 273 |
| 591 | 3300050513 | nmdc:mga0rr50_85345_c1 | nmdc:mga0rr50_85345_c1_124_951 | 273 |
| 592 | 3300050514 | nmdc:mga08x19_17997_c1 | nmdc:mga08x19_17997_c1_169_999 | 273 |
| 593 | 3300050515 | nmdc:mga0a205_16862_c1 | nmdc:mga0a205_16862_c1_3857_4687 | 273 |
| 594 | 3300050515 | nmdc:mga0a205_18763_c1 | nmdc:mga0a205_18763_c1_384_1214 | 273 |
| 595 | 2162886006 | SwRhRL3b_contig_1818041 | SwRhRL3b_0309.00002090 | 274 |
| 596 | 2162886006 | SwRhRL3b_contig_3769909 | SwRhRL3b_0206.00000460 | 274 |
| 597 | 2162886006 | SwRhRL3b_contig_657186 | SwRhRL3b_0687.00000180 | 274 |
| 598 | 3300005289 | Ga0065704_10195398 | Ga0065704_101953981 | 274 |
| 599 | 3300005290 | Ga0065712_10014908 | Ga0065712_100149082 | 274 |
| 600 | 3300005293 | Ga0065715_10040462 | Ga0065715_100404622 | 274 |
| 601 | 3300005293 | Ga0065715_10172415 | Ga0065715_101724152 | 274 |
| 602 | 3300005330 | Ga0070690_100074788 | Ga0070690_1000747883 | 274 |
| 603 | 3300005331 | Ga0070670_100022633 | Ga0070670_1000226335 | 274 |
| 604 | 3300005331 | Ga0070670_100222270 | Ga0070670_1002222702 | 274 |
| 605 | 3300005334 | Ga0068869_100012844 | Ga0068869_1000128447 | 274 |
| 606 | 3300005336 | Ga0070680_100068866 | Ga0070680_1000688663 | 274 |
| 607 | 3300005337 | Ga0070682_100000048 | Ga0070682_10000004898 | 274 |
| 608 | 3300005353 | Ga0070669_100023676 | Ga0070669_1000236762 | 274 |
| 609 | 3300005354 | Ga0070675_100109678 | Ga0070675_1001096782 | 274 |
| 610 | 3300005354 | Ga0070675_100165738 | Ga0070675_1001657383 | 274 |
| 611 | 3300005364 | Ga0070673_100495983 | Ga0070673_1004959831 | 274 |
| 612 | 3300005438 | Ga0070701_10055113 | Ga0070701_100551132 | 274 |
| 613 | 3300005441 | Ga0070700_100214623 | Ga0070700_1002146232 | 274 |
| 614 | 3300005444 | Ga0070694_100010819 | Ga0070694_1000108193 | 274 |
| 615 | 3300005445 | Ga0070708_100111246 | Ga0070708_1001112462 | 274 |
| 616 | 3300005445 | Ga0070708_100125261 | Ga0070708_1001252612 | 274 |
| 617 | 3300005456 | Ga0070678_100254832 | Ga0070678_1002548322 | 274 |
| 618 | 3300005467 | Ga0070706_100001203 | Ga0070706_10000120319 | 274 |
| 619 | 3300005467 | Ga0070706_100001891 | Ga0070706_10000189115 | 274 |
| 620 | 3300005467 | Ga0070706_100131249 | Ga0070706_1001312493 | 274 |
| 621 | 3300005467 | Ga0070706_100176850 | Ga0070706_1001768502 | 274 |
| 622 | 3300005467 | Ga0070706_100223324 | Ga0070706_1002233242 | 274 |
| 623 | 3300005468 | Ga0070707_100061112 | Ga0070707_1000611123 | 274 |
| 624 | 3300005468 | Ga0070707_100096224 | Ga0070707_1000962243 | 274 |
| 625 | 3300005468 | Ga0070707_100188487 | Ga0070707_1001884871 | 274 |
| 626 | 3300005468 | Ga0070707_100203006 | Ga0070707_1002030062 | 274 |
| 627 | 3300005468 | Ga0070707_100297633 | Ga0070707_1002976332 | 274 |
| 628 | 3300005471 | Ga0070698_100003095 | Ga0070698_1000030958 | 274 |
| 629 | 3300005471 | Ga0070698_100006823 | Ga0070698_1000068233 | 274 |
| 630 | 3300005471 | Ga0070698_100072848 | Ga0070698_1000728481 | 274 |
| 631 | 3300005471 | Ga0070698_100133050 | Ga0070698_1001330502 | 274 |
| 632 | 3300005471 | Ga0070698_100155226 | Ga0070698_1001552262 | 274 |
| 633 | 3300005471 | Ga0070698_100211080 | Ga0070698_1002110801 | 274 |
| 634 | 3300005471 | Ga0070698_100345531 | Ga0070698_1003455311 | 274 |
| 635 | 3300005518 | Ga0070699_100240871 | Ga0070699_1002408712 | 274 |
| 636 | 3300005518 | Ga0070699_100349043 | Ga0070699_1003490432 | 274 |
| 637 | 3300005536 | Ga0070697_100000089 | Ga0070697_10000008956 | 274 |
| 638 | 3300005536 | Ga0070697_100000839 | Ga0070697_10000083918 | 274 |
| 639 | 3300005536 | Ga0070697_100130094 | Ga0070697_1001300941 | 274 |
| 640 | 3300005536 | Ga0070697_100173736 | Ga0070697_1001737362 | 274 |
| 641 | 3300005546 | Ga0070696_100074018 | Ga0070696_1000740183 | 274 |
| 642 | 3300005546 | Ga0070696_100348814 | Ga0070696_1003488142 | 274 |
| 643 | 3300005547 | Ga0070693_100122238 | Ga0070693_1001222382 | 274 |
| 644 | 3300005549 | Ga0070704_100128477 | Ga0070704_1001284771 | 274 |
| 645 | 3300005549 | Ga0070704_100293918 | Ga0070704_1002939182 | 274 |
| 646 | 3300005577 | Ga0068857_100365267 | Ga0068857_1003652672 | 274 |
| 647 | 3300005617 | Ga0068859_100003464 | Ga0068859_10000346410 | 274 |
| 648 | 3300005617 | Ga0068859_100011486 | Ga0068859_1000114866 | 274 |
| 649 | 3300005617 | Ga0068859_100111118 | Ga0068859_1001111183 | 274 |
| 650 | 3300005618 | Ga0068864_100016132 | Ga0068864_1000161323 | 274 |
| 651 | 3300005719 | Ga0068861_100137352 | Ga0068861_1001373522 | 274 |
| 652 | 3300005841 | Ga0068863_100207162 | Ga0068863_1002071622 | 274 |
| 653 | 3300005842 | Ga0068858_100274411 | Ga0068858_1002744112 | 274 |
| 654 | 3300005842 | Ga0068858_100337666 | Ga0068858_1003376662 | 274 |
| 655 | 3300005844 | Ga0068862_100032812 | Ga0068862_1000328123 | 274 |
| 656 | 3300005844 | Ga0068862_100132249 | Ga0068862_1001322492 | 274 |
| 657 | 3300006163 | Ga0070715_10000020 | Ga0070715_1000002017 | 274 |
| 658 | 3300006173 | Ga0070716_100000003 | Ga0070716_10000000373 | 274 |
| 659 | 3300006844 | Ga0075428_100096541 | Ga0075428_1000965412 | 274 |
| 660 | 3300006846 | Ga0075430_100174292 | Ga0075430_1001742922 | 274 |
| 661 | 3300006847 | Ga0075431_100158453 | Ga0075431_1001584533 | 274 |
| 662 | 3300006847 | Ga0075431_100228684 | Ga0075431_1002286843 | 274 |
| 663 | 3300006852 | Ga0075433_10009960 | Ga0075433_100099603 | 274 |
| 664 | 3300006871 | Ga0075434_100019006 | Ga0075434_1000190063 | 274 |
| 665 | 3300006871 | Ga0075434_100435859 | Ga0075434_1004358592 | 274 |
| 666 | 3300006880 | Ga0075429_100046391 | Ga0075429_1000463913 | 274 |
| 667 | 3300006914 | Ga0075436_100000013 | Ga0075436_10000001387 | 274 |
| 668 | 3300006914 | Ga0075436_100188675 | Ga0075436_1001886752 | 274 |
| 669 | 3300006931 | Ga0097620_100003464 | Ga0097620_10000346410 | 274 |
| 670 | 3300006931 | Ga0097620_100011487 | Ga0097620_1000114873 | 274 |
| 671 | 3300006931 | Ga0097620_100111119 | Ga0097620_1001111192 | 274 |
| 672 | 3300007076 | Ga0075435_100011221 | Ga0075435_1000112212 | 274 |
| 673 | 3300007076 | Ga0075435_100288561 | Ga0075435_1002885612 | 274 |
| 674 | 3300009093 | Ga0105240_10091078 | Ga0105240_100910783 | 274 |
| 675 | 3300009094 | Ga0111539_10548888 | Ga0111539_105488882 | 274 |
| 676 | 3300009094 | Ga0111539_10778886 | Ga0111539_107788862 | 274 |
| 677 | 3300009098 | Ga0105245_10346381 | Ga0105245_103463812 | 274 |
| 678 | 3300009098 | Ga0105245_10460715 | Ga0105245_104607152 | 274 |
| 679 | 3300009101 | Ga0105247_10031353 | Ga0105247_100313533 | 274 |
| 680 | 3300009147 | Ga0114129_10082347 | Ga0114129_100823473 | 274 |
| 681 | 3300009148 | Ga0105243_10011106 | Ga0105243_100111065 | 274 |
| 682 | 3300009176 | Ga0105242_10164086 | Ga0105242_101640861 | 274 |
| 683 | 3300009177 | Ga0105248_10688533 | Ga0105248_106885331 | 274 |
| 684 | 3300009545 | Ga0105237_10455528 | Ga0105237_104555281 | 274 |
| 685 | 3300009553 | Ga0105249_10230726 | Ga0105249_102307262 | 274 |
| 686 | 3300011119 | Ga0105246_10210419 | Ga0105246_102104192 | 274 |
| 687 | 3300013100 | Ga0157373_10030718 | Ga0157373_100307183 | 274 |
| 688 | 3300013100 | Ga0157373_10459345 | Ga0157373_104593451 | 274 |
| 689 | 3300013297 | Ga0157378_10150749 | Ga0157378_101507493 | 274 |
| 690 | 3300013307 | Ga0157372_10006818 | Ga0157372_100068185 | 274 |
| 691 | 3300014325 | Ga0163163_10030744 | Ga0163163_100307443 | 274 |
| 692 | 3300014326 | Ga0157380_10032377 | Ga0157380_100323773 | 274 |
| 693 | 3300014326 | Ga0157380_10039429 | Ga0157380_100394293 | 274 |
| 694 | 3300014326 | Ga0157380_10070139 | Ga0157380_100701392 | 274 |
| 695 | 3300025905 | Ga0207685_10000008 | Ga0207685_10000008157 | 274 |
| 696 | 3300025910 | Ga0207684_10006564 | Ga0207684_100065648 | 274 |
| 697 | 3300025910 | Ga0207684_10052534 | Ga0207684_100525343 | 274 |
| 698 | 3300025910 | Ga0207684_10058417 | Ga0207684_100584173 | 274 |
| 699 | 3300025910 | Ga0207684_10091968 | Ga0207684_100919683 | 274 |
| 700 | 3300025910 | Ga0207684_10095810 | Ga0207684_100958102 | 274 |
| 701 | 3300025910 | Ga0207684_10215367 | Ga0207684_102153672 | 274 |
| 702 | 3300025910 | Ga0207684_10375097 | Ga0207684_103750971 | 274 |
| 703 | 3300025910 | Ga0207684_10465379 | Ga0207684_104653791 | 274 |
| 704 | 3300025911 | Ga0207654_10019532 | Ga0207654_100195323 | 274 |
| 705 | 3300025913 | Ga0207695_10067169 | Ga0207695_100671693 | 274 |
| 706 | 3300025917 | Ga0207660_10114181 | Ga0207660_101141812 | 274 |
| 707 | 3300025918 | Ga0207662_10030359 | Ga0207662_100303593 | 274 |
| 708 | 3300025918 | Ga0207662_10034077 | Ga0207662_100340772 | 274 |
| 709 | 3300025918 | Ga0207662_10071828 | Ga0207662_100718281 | 274 |
| 710 | 3300025922 | Ga0207646_10006845 | Ga0207646_100068452 | 274 |
| 711 | 3300025922 | Ga0207646_10021644 | Ga0207646_100216443 | 274 |
| 712 | 3300025922 | Ga0207646_10102666 | Ga0207646_101026663 | 274 |
| 713 | 3300025922 | Ga0207646_10151956 | Ga0207646_101519561 | 274 |
| 714 | 3300025923 | Ga0207681_10096040 | Ga0207681_100960402 | 274 |
| 715 | 3300025925 | Ga0207650_10052753 | Ga0207650_100527532 | 274 |
| 716 | 3300025925 | Ga0207650_10198819 | Ga0207650_101988191 | 274 |
| 717 | 3300025935 | Ga0207709_10007003 | Ga0207709_100070034 | 274 |
| 718 | 3300025939 | Ga0207665_10000003 | Ga0207665_1000000346 | 274 |
| 719 | 3300025942 | Ga0207689_10008554 | Ga0207689_100085543 | 274 |
| 720 | 3300025942 | Ga0207689_10020733 | Ga0207689_100207337 | 274 |
| 721 | 3300026075 | Ga0207708_10103922 | Ga0207708_101039223 | 274 |
| 722 | 3300026088 | Ga0207641_10178794 | Ga0207641_101787941 | 274 |
| 723 | 3300026088 | Ga0207641_10719672 | Ga0207641_107196721 | 274 |
| 724 | 3300026089 | Ga0207648_10107939 | Ga0207648_101079392 | 274 |
| 725 | 3300026089 | Ga0207648_10521719 | Ga0207648_105217192 | 274 |
| 726 | 3300026095 | Ga0207676_10016307 | Ga0207676_100163074 | 274 |
| 727 | 3300026116 | Ga0207674_10052773 | Ga0207674_100527732 | 274 |
| 728 | 3300026121 | Ga0207683_10209580 | Ga0207683_102095802 | 274 |
| 729 | 3300027907 | Ga0207428_10026037 | Ga0207428_100260373 | 274 |
| 730 | 3300028380 | Ga0268265_10021379 | Ga0268265_100213792 | 274 |
| 731 | 3300028380 | Ga0268265_10213512 | Ga0268265_102135121 | 274 |
| 732 | 3300028381 | Ga0268264_10154981 | Ga0268264_101549812 | 274 |
| 733 | 3300031548 | Ga0307408_100361613 | Ga0307408_1003616132 | 274 |
| 734 | 3300032002 | Ga0307416_100102294 | Ga0307416_1001022942 | 274 |
| 735 | 3300032005 | Ga0307411_10351205 | Ga0307411_103512052 | 274 |
| 736 | 3300035091 | Ga0373951_0001364 | Ga0373951_0001364_2043_2873 | 274 |
| 737 | 3300044712 | Ga0453684_0146100 | Ga0453684_0146100_1332_2165 | 274 |
| 738 | 3300045051 | Ga0451576_0275503 | Ga0451576_0275503_568_1395 | 274 |
| 739 | 3300046525 | Ga0495663_0000537 | Ga0495663_0000537_11895_12722 | 274 |
| 740 | 3300046537 | Ga0495598_0000409 | Ga0495598_0000409_2014_2841 | 274 |
| 741 | 3300046539 | Ga0495621_0000654 | Ga0495621_0000654_3489_4316 | 274 |
| 742 | 3300047320 | Ga0495672_0012033 | Ga0495672_0012033_5175_6002 | 274 |
| 743 | 3300047471 | Ga0495684_0093790 | Ga0495684_0093790_296_1129 | 274 |
| 744 | 3300048907 | Ga0496104_0220891 | Ga0496104_0220891_712_1560 | 274 |
| 745 | 3300050508 | nmdc:mga09592_158632_c1 | nmdc:mga09592_158632_c1_219_1049 | 274 |
| 746 | 3300050508 | nmdc:mga09592_47623_c1 | nmdc:mga09592_47623_c1_1905_2744 | 274 |
| 747 | 3300050509 | nmdc:mga0qj67_34559_c1 | nmdc:mga0qj67_34559_c1_1348_2187 | 274 |
| 748 | 3300050509 | nmdc:mga0qj67_76094_c1 | nmdc:mga0qj67_76094_c1_1094_1927 | 274 |
| 749 | 3300050511 | nmdc:mga08y16_45727_c1 | nmdc:mga08y16_45727_c1_3583_4407 | 274 |
| 750 | 3300050512 | nmdc:mga0n895_55020_c1 | nmdc:mga0n895_55020_c1_1878_2708 | 274 |
| 751 | 3300050513 | nmdc:mga0rr50_102_c1 | nmdc:mga0rr50_102_c1_22446_23279 | 274 |
| 752 | 3300050514 | nmdc:mga08x19_195689_c1 | nmdc:mga08x19_195689_c1_244_1071 | 274 |
| 753 | 3300050514 | nmdc:mga08x19_29_c1 | nmdc:mga08x19_29_c1_122554_123387 | 274 |
| 754 | 3300050515 | nmdc:mga0a205_138337_c1 | nmdc:mga0a205_138337_c1_1331_2161 | 274 |
| 755 | 3300050515 | nmdc:mga0a205_370482_c1 | nmdc:mga0a205_370482_c1_65_895 | 274 |
| 756 | 3300050515 | nmdc:mga0a205_8373_c1 | nmdc:mga0a205_8373_c1_1560_2390 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5azc-assembly1.cif.gz_A | crystal structure of escherichia coli lgt in complex with phosphatidylglycerol | 0.8035 | 3 | 259 |
| 5azc-assembly1.cif.gz_A | crystal structure of escherichia coli lgt in complex with phosphatidylglycerol | 0.7544 | 3 | 259 |
| 2eba-assembly2.cif.gz_H | crystal structure of the putative glutaryl-coa dehydrogenase from thermus thermophilus | 0.5187 | 113 | 218 |
| 2r0n-assembly1.cif.gz_A | the effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate | 0.4875 | 113 | 220 |
| 5lnx-assembly1.cif.gz_B | crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. | 0.4777 | 113 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F0JAT1_1_141_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.456 | 113 | 267 | 1.20.120.350 |
| 4ck0A00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.4249 | 158 | 264 | 1.10.287.3610 |
| af_Q9VDT1_256_405_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.4235 | 111 | 251 | 1.20.140.10 |
| af_F0JAT1_1_141_1.20.120.350 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C | 0.4208 | 113 | 267 | 1.20.120.350 |
| 3eomC03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.4093 | 113 | 263 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L4ZSN8-F1-model_v4 | Phosphatidylglycerol:prolipoprotein diacylglycerol transferase | 0.96 | 105 | 259 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A7V8Z7K5-F1-model_v4 | Prolipoprotein diacylglyceryl transferase | 0.9579 | 140 | 267 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A2V8RZG5-F1-model_v4 | Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) | 0.9436 | 1 | 263 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A2V8R7A5-F1-model_v4 | Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) | 0.9363 | 1 | 274 |
GO:0005886
GO:0008961 GO:0042158 |
| AF-A0A7C4MWZ8-F1-model_v4 | Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) | 0.9351 | 1 | 268 |
GO:0005886
GO:0008961 GO:0042158 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar