F479346

General Info

Members Datasets Scaffolds Average Seq Length
756 242 756 271

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100357535|Ga0207675_1003575352
Length 308
Sequence MYPILFRIWNFPVNTYGVFLALGFLGAIYVTVRLGVRDGLPRERIYDLCLWLLLSSLIGSKLLMLFTEPEYRQNPRLLFSLDFLRSGGVFYGGLIGAVVVAYLLMRHWKLPWWKTADACAPGISLGLFFGRQGCFAAGCCWGKPTNLPWGVQFTQAGHDVTDVPINAHLHPTQLYESFAMLIVFCFLLWLHKKKKFSGQVILVYAVIYATVRFLIEFVRDDPRGDLLGLTSLTGLSTSQMIGLVVGVPALILLVIRWRRAVDDRRAQRLHDQPLRADPGHGPGETAALIPPLYRLGSAGWGTSLNSNV

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
189 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
213 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
214 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
215 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
220 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
221 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
226 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
227 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
228 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
229 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
230 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
231 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
232 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 1.59
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1818041 2162886006 Unclassified 1114
2 SwRhRL3b_contig_3769909 2162886006 Unclassified 1116
3 SwRhRL3b_contig_4315247 2162886006 Unclassified 1025
4 SwRhRL3b_contig_657186 2162886006 Unclassified 924
5 SwRhRL2b_contig_2665322 2162886007 Bacteria 1830
6 CNAas_1000304 3300000532 Bacteria 4722
7 JGI24034J14986_100233 3300001432 Unclassified 3022
8 JGI24748J21848_1000010 3300002074 Bacteria 166979
9 JGI24034J26672_10000001 3300002239 Bacteria 1118280
10 rootL2_10159794 3300003322 Bacteria 5065
11 Ga0065714_10064605 3300005288 Bacteria 29427
12 Ga0065704_10115131 3300005289 Unclassified 1877
13 Ga0065704_10195398 3300005289 Unclassified 1170
14 Ga0065712_10014908 3300005290 Bacteria 2758
15 Ga0065712_10067817 3300005290 Bacteria 29447
16 Ga0065715_10022399 3300005293 Bacteria 1503
17 Ga0065715_10040462 3300005293 Unclassified 1426
18 Ga0065715_10049877 3300005293 Bacteria 1266
19 Ga0065715_10090255 3300005293 Bacteria 7339
20 Ga0065715_10091791 3300005293 Bacteria 5537
21 Ga0065715_10111101 3300005293 Bacteria 2523
22 Ga0065715_10134000 3300005293 Bacteria 1962
23 Ga0065715_10172415 3300005293 Unclassified 1537
24 Ga0065707_10012515 3300005295 Bacteria 1919
25 Ga0065707_10094651 3300005295 Bacteria 3470
26 Ga0065707_10098569 3300005295 Bacteria 3075
27 Ga0065707_10184306 3300005295 Bacteria 1398
28 Ga0070690_100001562 3300005330 Bacteria 12009
29 Ga0070690_100029550 3300005330 Bacteria 3400
30 Ga0070690_100074788 3300005330 Bacteria 2207
31 Ga0070670_100003915 3300005331 Bacteria 12419
32 Ga0070670_100022633 3300005331 Bacteria 5408
33 Ga0070670_100222270 3300005331 Unclassified 1643
34 Ga0068869_100012844 3300005334 Bacteria 5544
35 Ga0068869_100021665 3300005334 Bacteria 4423
36 Ga0068869_100094004 3300005334 Bacteria 2259
37 Ga0068869_100127430 3300005334 Bacteria 1953
38 Ga0068869_100156164 3300005334 Unclassified 1773
39 Ga0068869_100202923 3300005334 Bacteria 1564
40 Ga0068869_100269679 3300005334 Unclassified 1365
41 Ga0070666_10405155 3300005335 Unclassified 981
42 Ga0070680_100068866 3300005336 Bacteria 2905
43 Ga0070682_100000048 3300005337 Bacteria 129542
44 Ga0070682_100433228 3300005337 Bacteria 1003
45 Ga0068868_100057771 3300005338 Bacteria 3066
46 Ga0070689_100001010 3300005340 Bacteria 17645
47 Ga0070689_100261285 3300005340 Bacteria 1431
48 Ga0070691_10219344 3300005341 Unclassified 1007
49 Ga0070687_100033725 3300005343 Bacteria 2529
50 Ga0070687_100110792 3300005343 Bacteria 1553
51 Ga0070687_100168368 3300005343 Bacteria 1302
52 Ga0070661_100157254 3300005344 Bacteria 1720
53 Ga0070661_100174773 3300005344 Bacteria 1632
54 Ga0070692_10047476 3300005345 Unclassified 2222
55 Ga0070692_10060861 3300005345 Bacteria 1989
56 Ga0070692_10095891 3300005345 Bacteria 1619
57 Ga0070692_10108091 3300005345 Unclassified 1535
58 Ga0070668_100001615 3300005347 Bacteria 16312
59 Ga0070669_100006486 3300005353 Bacteria 8426
60 Ga0070669_100006636 3300005353 Bacteria 8334
61 Ga0070669_100023676 3300005353 Unclassified 4399
62 Ga0070669_100083977 3300005353 Bacteria 2375
63 Ga0070669_100113465 3300005353 Bacteria 2059
64 Ga0070669_100511382 3300005353 Unclassified 997
65 Ga0070675_100109678 3300005354 Bacteria 2333
66 Ga0070675_100165738 3300005354 Bacteria 1903
67 Ga0070675_100216495 3300005354 Bacteria 1667
68 Ga0070671_100000822 3300005355 Bacteria 22486
69 Ga0070671_100065096 3300005355 Bacteria 3036
70 Ga0070671_100174259 3300005355 Bacteria 1820
71 Ga0070674_100061892 3300005356 Bacteria 2614
72 Ga0070673_100049770 3300005364 Bacteria 3273
73 Ga0070673_100051504 3300005364 Bacteria 3225
74 Ga0070673_100358862 3300005364 Unclassified 1295
75 Ga0070673_100370000 3300005364 Unclassified 1276
76 Ga0070673_100495983 3300005364 Unclassified 1104
77 Ga0070688_100015714 3300005365 Bacteria 4314
78 Ga0070688_100065383 3300005365 Bacteria 2311
79 Ga0070667_100149791 3300005367 Bacteria 2049
80 Ga0070703_10000070 3300005406 Bacteria 51916
81 Ga0070703_10002781 3300005406 Bacteria 5012
82 Ga0070709_10381179 3300005434 Bacteria 1048
83 Ga0070701_10029396 3300005438 Bacteria 2710
84 Ga0070701_10055113 3300005438 Bacteria 2075
85 Ga0070705_100005049 3300005440 Bacteria 6423
86 Ga0070705_100051410 3300005440 Bacteria 2403
87 Ga0070705_100153536 3300005440 Bacteria 1530
88 Ga0070700_100000055 3300005441 Bacteria 83561
89 Ga0070700_100132399 3300005441 Bacteria 1684
90 Ga0070700_100214623 3300005441 Bacteria 1360
91 Ga0070694_100008982 3300005444 Bacteria 6122
92 Ga0070694_100010819 3300005444 Bacteria 5644
93 Ga0070694_100012777 3300005444 Bacteria 5231
94 Ga0070694_100019372 3300005444 Bacteria 4326
95 Ga0070694_100051152 3300005444 Bacteria 2788
96 Ga0070694_100138108 3300005444 Bacteria 1768
97 Ga0070694_100257655 3300005444 Bacteria 1322
98 Ga0070694_100265247 3300005444 Bacteria 1304
99 Ga0070694_100311291 3300005444 Bacteria 1209
100 Ga0070708_100111246 3300005445 Bacteria 2518
101 Ga0070708_100125261 3300005445 Bacteria 2374
102 Ga0070708_100216027 3300005445 Bacteria 1797
103 Ga0070678_100106093 3300005456 Bacteria 2188
104 Ga0070678_100254832 3300005456 Bacteria 1473
105 Ga0070662_100038792 3300005457 Bacteria 3385
106 Ga0070662_100530766 3300005457 Unclassified 984
107 Ga0070681_10000523 3300005458 Bacteria 31450
108 Ga0070681_10001765 3300005458 Bacteria 19390
109 Ga0070681_10022640 3300005458 Bacteria 6311
110 Ga0068867_100024527 3300005459 Bacteria 4322
111 Ga0068867_100077899 3300005459 Unclassified 2492
112 Ga0068867_100091425 3300005459 Bacteria 2310
113 Ga0068867_100460414 3300005459 Bacteria 1086
114 Ga0070685_10016990 3300005466 Bacteria 3887
115 Ga0070706_100000138 3300005467 Bacteria 91724
116 Ga0070706_100001203 3300005467 Bacteria 27707
117 Ga0070706_100001891 3300005467 Bacteria 21615
118 Ga0070706_100131249 3300005467 Bacteria 2338
119 Ga0070706_100154941 3300005467 Unclassified 2139
120 Ga0070706_100176850 3300005467 Bacteria 1992
121 Ga0070706_100223324 3300005467 Bacteria 1758
122 Ga0070706_100516116 3300005467 Unclassified 1111
123 Ga0070707_100000197 3300005468 Bacteria 60425
124 Ga0070707_100018624 3300005468 Bacteria 6534
125 Ga0070707_100061112 3300005468 Bacteria 3613
126 Ga0070707_100096224 3300005468 Bacteria 2868
127 Ga0070707_100104173 3300005468 Bacteria 2750
128 Ga0070707_100188487 3300005468 Bacteria 2011
129 Ga0070707_100203006 3300005468 Bacteria 1932
130 Ga0070707_100297633 3300005468 Bacteria 1568
131 Ga0070698_100003095 3300005471 Bacteria 18340
132 Ga0070698_100005783 3300005471 Bacteria 13528
133 Ga0070698_100006823 3300005471 Bacteria 12375
134 Ga0070698_100008698 3300005471 Bacteria 10936
135 Ga0070698_100072848 3300005471 Bacteria 3442
136 Ga0070698_100133050 3300005471 Bacteria 2441
137 Ga0070698_100155226 3300005471 Bacteria 2234
138 Ga0070698_100180858 3300005471 Bacteria 2047
139 Ga0070698_100211080 3300005471 Unclassified 1876
140 Ga0070698_100345531 3300005471 Unclassified 1419
141 Ga0070698_100549674 3300005471 Bacteria 1094
142 Ga0070699_100036747 3300005518 Bacteria 4237
143 Ga0070699_100114781 3300005518 Bacteria 2366
144 Ga0070699_100240871 3300005518 Bacteria 1614
145 Ga0070699_100349043 3300005518 Unclassified 1333
146 Ga0070679_100001109 3300005530 Bacteria 23549
147 Ga0070679_100009165 3300005530 Bacteria 9344
148 Ga0070697_100000089 3300005536 Bacteria 76112
149 Ga0070697_100000839 3300005536 Bacteria 23076
150 Ga0070697_100006751 3300005536 Bacteria 8900
151 Ga0070697_100021115 3300005536 Bacteria 5157
152 Ga0070697_100030854 3300005536 Bacteria 4307
153 Ga0070697_100082386 3300005536 Bacteria 2652
154 Ga0070697_100130094 3300005536 Bacteria 2111
155 Ga0070697_100173736 3300005536 Bacteria 1824
156 Ga0068853_100034814 3300005539 Bacteria 4276
157 Ga0068853_100037988 3300005539 Bacteria 4100
158 Ga0068853_100141786 3300005539 Bacteria 2158
159 Ga0070672_100022167 3300005543 Unclassified 4659
160 Ga0070672_100037399 3300005543 Bacteria 3703
161 Ga0070686_100000559 3300005544 Bacteria 22205
162 Ga0070686_100002856 3300005544 Bacteria 9512
163 Ga0070686_100033399 3300005544 Unclassified 3161
164 Ga0070686_100058582 3300005544 Bacteria 2478
165 Ga0070695_100048122 3300005545 Unclassified 2726
166 Ga0070695_100069698 3300005545 Bacteria 2299
167 Ga0070695_100090543 3300005545 Unclassified 2041
168 Ga0070695_100101837 3300005545 Unclassified 1935
169 Ga0070695_100166542 3300005545 Unclassified 1552
170 Ga0070695_100264258 3300005545 Bacteria 1258
171 Ga0070696_100015591 3300005546 Bacteria 5106
172 Ga0070696_100019299 3300005546 Bacteria 4616
173 Ga0070696_100074018 3300005546 Unclassified 2401
174 Ga0070696_100082247 3300005546 Bacteria 2282
175 Ga0070696_100210271 3300005546 Unclassified 1456
176 Ga0070696_100348814 3300005546 Bacteria 1146
177 Ga0070696_100370023 3300005546 Bacteria 1114
178 Ga0070696_100389555 3300005546 Unclassified 1088
179 Ga0070693_100006979 3300005547 Bacteria 5497
180 Ga0070693_100063597 3300005547 Bacteria 2151
181 Ga0070693_100073333 3300005547 Unclassified 2022
182 Ga0070693_100100658 3300005547 Unclassified 1760
183 Ga0070693_100122238 3300005547 Bacteria 1616
184 Ga0070704_100001928 3300005549 Bacteria 11463
185 Ga0070704_100016807 3300005549 Bacteria 4635
186 Ga0070704_100060062 3300005549 Bacteria 2715
187 Ga0070704_100063819 3300005549 Bacteria 2645
188 Ga0070704_100065324 3300005549 Unclassified 2619
189 Ga0070704_100128477 3300005549 Bacteria 1960
190 Ga0070704_100293918 3300005549 Bacteria 1351
191 Ga0070704_100330648 3300005549 Unclassified 1280
192 Ga0070704_100377243 3300005549 Bacteria 1204
193 Ga0070704_100378662 3300005549 Unclassified 1202
194 Ga0070704_100441413 3300005549 Bacteria 1119
195 Ga0070704_100610852 3300005549 Unclassified 959
196 Ga0070664_100001715 3300005564 Bacteria 17549
197 Ga0070664_100355048 3300005564 Bacteria 1334
198 Ga0068857_100013452 3300005577 Bacteria 7128
199 Ga0068857_100039642 3300005577 Bacteria 4173
200 Ga0068857_100365267 3300005577 Bacteria 1338
201 Ga0068854_100081023 3300005578 Bacteria 2396
202 Ga0068854_100135728 3300005578 Unclassified 1883
203 Ga0068854_100327073 3300005578 Bacteria 1248
204 Ga0068856_100022591 3300005614 Bacteria 6115
205 Ga0070702_100005034 3300005615 Bacteria 6106
206 Ga0070702_100018033 3300005615 Bacteria 3653
207 Ga0070702_100120277 3300005615 Unclassified 1643
208 Ga0070702_100223035 3300005615 Bacteria 1262
209 Ga0070702_100232557 3300005615 Unclassified 1239
210 Ga0068852_100084959 3300005616 Bacteria 2818
211 Ga0068852_100112464 3300005616 Bacteria 2478
212 Ga0068852_100185520 3300005616 Archaea 1959
213 Ga0068859_100000586 3300005617 Bacteria 36318
214 Ga0068859_100003464 3300005617 Bacteria 16044
215 Ga0068859_100011486 3300005617 Bacteria 8903
216 Ga0068859_100020147 3300005617 Bacteria 6696
217 Ga0068859_100070691 3300005617 Bacteria 3526
218 Ga0068859_100085206 3300005617 Bacteria 3205
219 Ga0068859_100111118 3300005617 Bacteria 2803
220 Ga0068859_100196044 3300005617 Bacteria 2104
221 Ga0068859_100450996 3300005617 Bacteria 1382
222 Ga0068859_100652033 3300005617 Bacteria 1145
223 Ga0068859_100733458 3300005617 Unclassified 1078
224 Ga0068864_100003228 3300005618 Bacteria 13474
225 Ga0068864_100016132 3300005618 Bacteria 6216
226 Ga0068864_100021949 3300005618 Bacteria 5351
227 Ga0068864_100094593 3300005618 Bacteria 2641
228 Ga0068864_100399101 3300005618 Bacteria 1306
229 Ga0068861_100005663 3300005719 Bacteria 8471
230 Ga0068861_100010458 3300005719 Bacteria 6439
231 Ga0068861_100014204 3300005719 Bacteria 5586
232 Ga0068861_100016686 3300005719 Bacteria 5201
233 Ga0068861_100120544 3300005719 Bacteria 2115
234 Ga0068861_100137352 3300005719 Unclassified 1991
235 Ga0068861_100281957 3300005719 Bacteria 1431
236 Ga0068861_100438438 3300005719 Unclassified 1168
237 Ga0068851_10001570 3300005834 Bacteria 10023
238 Ga0068870_10061014 3300005840 Bacteria 2026
239 Ga0068863_100095379 3300005841 Bacteria 2823
240 Ga0068863_100113289 3300005841 Bacteria 2583
241 Ga0068863_100207162 3300005841 Bacteria 1888
242 Ga0068863_100294465 3300005841 Bacteria 1573
243 Ga0068863_100401607 3300005841 Unclassified 1340
244 Ga0068858_100000005 3300005842 Bacteria 305830
245 Ga0068858_100034796 3300005842 Bacteria 4673
246 Ga0068858_100043649 3300005842 Bacteria 4158
247 Ga0068858_100082453 3300005842 Bacteria 2989
248 Ga0068858_100101047 3300005842 Unclassified 2690
249 Ga0068858_100113066 3300005842 Unclassified 2536
250 Ga0068858_100126165 3300005842 Bacteria 2397
251 Ga0068858_100158410 3300005842 Bacteria 2131
252 Ga0068858_100274411 3300005842 Bacteria 1605
253 Ga0068858_100337666 3300005842 Unclassified 1441
254 Ga0068858_100537740 3300005842 Bacteria 1131
255 Ga0068860_100031983 3300005843 Bacteria 5058
256 Ga0068860_100048156 3300005843 Bacteria 4063
257 Ga0068860_100051120 3300005843 Bacteria 3933
258 Ga0068860_100074102 3300005843 Bacteria 3236
259 Ga0068860_100086317 3300005843 Bacteria 2986
260 Ga0068860_100088822 3300005843 Bacteria 2942
261 Ga0068860_100155505 3300005843 Unclassified 2203
262 Ga0068860_100227081 3300005843 Bacteria 1814
263 Ga0068860_100231649 3300005843 Bacteria 1795
264 Ga0068862_100005732 3300005844 Bacteria 10366
265 Ga0068862_100032812 3300005844 Unclassified 4386
266 Ga0068862_100132249 3300005844 Bacteria 2208
267 Ga0081539_10000279 3300005985 Bacteria 115766
268 Ga0081539_10000695 3300005985 Bacteria 67496
269 Ga0070715_10000020 3300006163 Bacteria 119605
270 Ga0070716_100000003 3300006173 Bacteria 312721
271 Ga0097621_100001987 3300006237 Bacteria 13937
272 Ga0097621_100005536 3300006237 Bacteria 8898
273 Ga0097621_100102914 3300006237 Bacteria 2405
274 Ga0097621_100178552 3300006237 Unclassified 1834
275 Ga0097621_100406621 3300006237 Unclassified 1219
276 Ga0068871_100012702 3300006358 Bacteria 6223
277 Ga0068871_100016720 3300006358 Bacteria 5535
278 Ga0068871_100020429 3300006358 Bacteria 5073
279 Ga0068871_100260611 3300006358 Bacteria 1512
280 Ga0075428_100096541 3300006844 Bacteria 3221
281 Ga0075430_100174292 3300006846 Unclassified 1789
282 Ga0075431_100158453 3300006847 Unclassified 2328
283 Ga0075431_100228684 3300006847 Unclassified 1896
284 Ga0075433_10009960 3300006852 Bacteria 7614
285 Ga0075433_10029567 3300006852 Bacteria 4670
286 Ga0075433_10055254 3300006852 Bacteria 3465
287 Ga0075433_10166003 3300006852 Bacteria 1965
288 Ga0075433_10214128 3300006852 Unclassified 1712
289 Ga0075433_10635207 3300006852 Unclassified 936
290 Ga0075434_100019006 3300006871 Bacteria 6642
291 Ga0075434_100040693 3300006871 Bacteria 4603
292 Ga0075434_100072207 3300006871 Bacteria 3443
293 Ga0075434_100103051 3300006871 Bacteria 2861
294 Ga0075434_100246323 3300006871 Unclassified 1807
295 Ga0075434_100298664 3300006871 Bacteria 1631
296 Ga0075434_100435859 3300006871 Bacteria 1332
297 Ga0075429_100046391 3300006880 Bacteria 3780
298 Ga0068865_100017990 3300006881 Bacteria 4554
299 Ga0068865_100162468 3300006881 Unclassified 1705
300 Ga0075436_100000013 3300006914 Bacteria 177118
301 Ga0075436_100028599 3300006914 Bacteria 3834
302 Ga0075436_100188675 3300006914 Bacteria 1458
303 Ga0097620_100000586 3300006931 Bacteria 36318
304 Ga0097620_100003464 3300006931 Bacteria 16044
305 Ga0097620_100011487 3300006931 Bacteria 8903
306 Ga0097620_100020148 3300006931 Bacteria 6696
307 Ga0097620_100070690 3300006931 Bacteria 3526
308 Ga0097620_100085205 3300006931 Bacteria 3205
309 Ga0097620_100111119 3300006931 Bacteria 2803
310 Ga0097620_100196045 3300006931 Bacteria 2104
311 Ga0097620_100451034 3300006931 Bacteria 1382
312 Ga0097620_100651971 3300006931 Bacteria 1145
313 Ga0097620_100733440 3300006931 Unclassified 1078
314 Ga0075435_100011221 3300007076 Bacteria 6577
315 Ga0075435_100288561 3300007076 Bacteria 1402
316 Ga0105240_10091078 3300009093 Unclassified 3726
317 Ga0105240_10452654 3300009093 Unclassified 1436
318 Ga0111539_10006864 3300009094 Bacteria 14627
319 Ga0111539_10106467 3300009094 Unclassified 3290
320 Ga0111539_10144800 3300009094 Unclassified 2782
321 Ga0111539_10191181 3300009094 Bacteria 2388
322 Ga0111539_10200139 3300009094 Bacteria 2329
323 Ga0111539_10522706 3300009094 Unclassified 1382
324 Ga0111539_10548888 3300009094 Unclassified 1346
325 Ga0111539_10778886 3300009094 Unclassified 1113
326 Ga0105245_10099496 3300009098 Unclassified 2688
327 Ga0105245_10152304 3300009098 Bacteria 2187
328 Ga0105245_10346381 3300009098 Bacteria 1471
329 Ga0105245_10460715 3300009098 Bacteria 1281
330 Ga0105247_10000002 3300009101 Bacteria 724587
331 Ga0105247_10031353 3300009101 Unclassified 3225
332 Ga0105247_10041130 3300009101 Unclassified 2827
333 Ga0114129_10005832 3300009147 Bacteria 17448
334 Ga0114129_10011843 3300009147 Bacteria 12405
335 Ga0114129_10042631 3300009147 Bacteria 6387
336 Ga0114129_10082347 3300009147 Bacteria 4471
337 Ga0114129_10130383 3300009147 Unclassified 3453
338 Ga0114129_10130794 3300009147 Bacteria 3447
339 Ga0114129_10207665 3300009147 Bacteria 2649
340 Ga0114129_10261157 3300009147 Bacteria 2321
341 Ga0114129_10509154 3300009147 Unclassified 1571
342 Ga0114129_10986673 3300009147 Unclassified 1062
343 Ga0105243_10000182 3300009148 Bacteria 73148
344 Ga0105243_10000792 3300009148 Bacteria 30316
345 Ga0105243_10011106 3300009148 Bacteria 6813
346 Ga0105243_10210884 3300009148 Unclassified 1710
347 Ga0105243_10238167 3300009148 Bacteria 1618
348 Ga0105243_10582858 3300009148 Unclassified 1074
349 Ga0105243_10631933 3300009148 Bacteria 1035
350 Ga0105243_10632729 3300009148 Unclassified 1034
351 Ga0105243_10632908 3300009148 Unclassified 1034
352 Ga0105241_10210850 3300009174 Unclassified 1627
353 Ga0105241_10314108 3300009174 Unclassified 1349
354 Ga0105241_10323466 3300009174 Unclassified 1331
355 Ga0105242_10000370 3300009176 Bacteria 35743
356 Ga0105242_10000767 3300009176 Bacteria 24990
357 Ga0105242_10060633 3300009176 Unclassified 3109
358 Ga0105242_10130640 3300009176 Bacteria 2168
359 Ga0105242_10164086 3300009176 Bacteria 1947
360 Ga0105248_10013649 3300009177 Bacteria 8943
361 Ga0105248_10036086 3300009177 Bacteria 5530
362 Ga0105248_10040235 3300009177 Bacteria 5240
363 Ga0105248_10042861 3300009177 Bacteria 5074
364 Ga0105248_10076353 3300009177 Bacteria 3766
365 Ga0105248_10161549 3300009177 Unclassified 2527
366 Ga0105248_10222274 3300009177 Bacteria 2126
367 Ga0105248_10275645 3300009177 Bacteria 1894
368 Ga0105248_10688533 3300009177 Bacteria 1153
369 Ga0105237_10001910 3300009545 Bacteria 26587
370 Ga0105237_10022887 3300009545 Bacteria 6408
371 Ga0105237_10093964 3300009545 Bacteria 2988
372 Ga0105237_10455528 3300009545 Unclassified 1285
373 Ga0105238_10019867 3300009551 Bacteria 6838
374 Ga0105249_10000003 3300009553 Bacteria 370855
375 Ga0105249_10010555 3300009553 Bacteria 8117
376 Ga0105249_10051054 3300009553 Bacteria 3771
377 Ga0105249_10230726 3300009553 Unclassified 1825
378 Ga0105249_10400831 3300009553 Unclassified 1402
379 Ga0105249_10539027 3300009553 Bacteria 1216
380 Ga0105239_10109632 3300010375 Bacteria 3059
381 Ga0105239_10333000 3300010375 Unclassified 1713
382 Ga0105246_10139604 3300011119 Bacteria 1821
383 Ga0105246_10210419 3300011119 Unclassified 1518
384 Ga0105246_10311504 3300011119 Bacteria 1275
385 Ga0105246_10540141 3300011119 Unclassified 997
386 Ga0157373_10026553 3300013100 Bacteria 4181
387 Ga0157373_10030718 3300013100 Bacteria 3866
388 Ga0157373_10459345 3300013100 Unclassified 917
389 Ga0157374_10064303 3300013296 Bacteria 3442
390 Ga0157374_10360317 3300013296 Bacteria 1446
391 Ga0157374_10524654 3300013296 Bacteria 1190
392 Ga0157378_10000342 3300013297 Bacteria 45875
393 Ga0157378_10008224 3300013297 Bacteria 9095
394 Ga0157378_10010432 3300013297 Bacteria 8113
395 Ga0157378_10067451 3300013297 Unclassified 3206
396 Ga0157378_10072703 3300013297 Unclassified 3090
397 Ga0157378_10098022 3300013297 Bacteria 2672
398 Ga0157378_10150749 3300013297 Bacteria 2166
399 Ga0157378_10214703 3300013297 Unclassified 1826
400 Ga0157378_10254782 3300013297 Unclassified 1681
401 Ga0157378_10757384 3300013297 Unclassified 994
402 Ga0157378_10764053 3300013297 Unclassified 990
403 Ga0163162_10000020 3300013306 Bacteria 220558
404 Ga0163162_10004174 3300013306 Bacteria 13880
405 Ga0163162_10009766 3300013306 Bacteria 9344
406 Ga0163162_10021352 3300013306 Bacteria 6375
407 Ga0163162_10045274 3300013306 Bacteria 4408
408 Ga0163162_10112897 3300013306 Bacteria 2816
409 Ga0163162_10166578 3300013306 Unclassified 2328
410 Ga0163162_10487603 3300013306 Bacteria 1364
411 Ga0157372_10006818 3300013307 Bacteria 12146
412 Ga0157372_10024822 3300013307 Bacteria 6515
413 Ga0157372_10544565 3300013307 Unclassified 1353
414 Ga0157375_10025425 3300013308 Bacteria 5501
415 Ga0157375_10080235 3300013308 Bacteria 3300
416 Ga0157375_10213775 3300013308 Bacteria 2086
417 Ga0157375_10388977 3300013308 Unclassified 1561
418 Ga0157375_10464767 3300013308 Bacteria 1431
419 Ga0157375_10767318 3300013308 Bacteria 1115
420 Ga0163163_10005683 3300014325 Bacteria 10812
421 Ga0163163_10028191 3300014325 Bacteria 5389
422 Ga0163163_10030744 3300014325 Bacteria 5177
423 Ga0163163_10043665 3300014325 Bacteria 4395
424 Ga0163163_10044443 3300014325 Unclassified 4358
425 Ga0163163_10181778 3300014325 Bacteria 2150
426 Ga0163163_10198815 3300014325 Bacteria 2053
427 Ga0163163_10333987 3300014325 Unclassified 1570
428 Ga0163163_10503600 3300014325 Bacteria 1273
429 Ga0157380_10013970 3300014326 Bacteria 5864
430 Ga0157380_10017360 3300014326 Bacteria 5325
431 Ga0157380_10032377 3300014326 Bacteria 4021
432 Ga0157380_10033291 3300014326 Bacteria 3969
433 Ga0157380_10039429 3300014326 Bacteria 3673
434 Ga0157380_10062342 3300014326 Bacteria 2987
435 Ga0157380_10070139 3300014326 Bacteria 2831
436 Ga0157380_10078527 3300014326 Unclassified 2693
437 Ga0157380_10094680 3300014326 Bacteria 2472
438 Ga0157380_10249271 3300014326 Bacteria 1606
439 Ga0157377_10080375 3300014745 Bacteria 1904
440 Ga0157379_10061460 3300014968 Unclassified 3359
441 Ga0157379_10374720 3300014968 Bacteria 1305
442 Ga0157376_10011232 3300014969 Bacteria 6592
443 Ga0157376_10154636 3300014969 Bacteria 2072
444 Ga0163161_10044122 3300017792 Bacteria 3211
445 Ga0163161_10057508 3300017792 Bacteria 2825
446 Ga0163161_10270006 3300017792 Unclassified 1331
447 Ga0207672_1000050 3300025223 Bacteria 15664
448 Ga0207656_10000959 3300025321 Bacteria 9441
449 Ga0207653_10000332 3300025885 Bacteria 24901
450 Ga0207682_10172915 3300025893 Unclassified 983
451 Ga0207642_10055729 3300025899 Unclassified 1810
452 Ga0207710_10000002 3300025900 Bacteria 1251998
453 Ga0207688_10276182 3300025901 Unclassified 1023
454 Ga0207680_10146329 3300025903 Bacteria 1571
455 Ga0207680_10271851 3300025903 Bacteria 1175
456 Ga0207685_10000008 3300025905 Bacteria 273136
457 Ga0207699_10261780 3300025906 Bacteria 1196
458 Ga0207645_10181273 3300025907 Unclassified 1382
459 Ga0207643_10005560 3300025908 Bacteria 6736
460 Ga0207643_10008153 3300025908 Bacteria 5620
461 Ga0207643_10043429 3300025908 Bacteria 2537
462 Ga0207684_10000023 3300025910 Bacteria 334838
463 Ga0207684_10006564 3300025910 Bacteria 10591
464 Ga0207684_10052534 3300025910 Bacteria 3458
465 Ga0207684_10058417 3300025910 Bacteria 3273
466 Ga0207684_10091968 3300025910 Bacteria 2586
467 Ga0207684_10095810 3300025910 Bacteria 2533
468 Ga0207684_10132301 3300025910 Unclassified 2141
469 Ga0207684_10138630 3300025910 Bacteria 2090
470 Ga0207684_10215367 3300025910 Bacteria 1657
471 Ga0207684_10375097 3300025910 Unclassified 1224
472 Ga0207684_10465379 3300025910 Unclassified 1085
473 Ga0207654_10019532 3300025911 Bacteria 3578
474 Ga0207654_10037005 3300025911 Bacteria 2730
475 Ga0207654_10147211 3300025911 Bacteria 1508
476 Ga0207707_10000006 3300025912 Bacteria 374131
477 Ga0207707_10009795 3300025912 Bacteria 8311
478 Ga0207707_10010819 3300025912 Bacteria 7929
479 Ga0207695_10067169 3300025913 Unclassified 3679
480 Ga0207695_10451972 3300025913 Unclassified 1168
481 Ga0207671_10009096 3300025914 Bacteria 8347
482 Ga0207660_10000971 3300025917 Bacteria 18966
483 Ga0207660_10114181 3300025917 Bacteria 2037
484 Ga0207662_10013770 3300025918 Bacteria 4526
485 Ga0207662_10030359 3300025918 Bacteria 3136
486 Ga0207662_10034077 3300025918 Unclassified 2971
487 Ga0207662_10071828 3300025918 Bacteria 2096
488 Ga0207662_10107120 3300025918 Bacteria 1739
489 Ga0207662_10228548 3300025918 Bacteria 1214
490 Ga0207662_10244213 3300025918 Unclassified 1176
491 Ga0207662_10253814 3300025918 Bacteria 1155
492 Ga0207657_10075018 3300025919 Bacteria 2855
493 Ga0207649_10068408 3300025920 Bacteria 2258
494 Ga0207652_10000216 3300025921 Bacteria 61049
495 Ga0207652_10016140 3300025921 Bacteria 6091
496 Ga0207652_10166483 3300025921 Bacteria 1977
497 Ga0207646_10006385 3300025922 Bacteria 12192
498 Ga0207646_10006845 3300025922 Bacteria 11719
499 Ga0207646_10015551 3300025922 Bacteria 7184
500 Ga0207646_10021644 3300025922 Bacteria 5936
501 Ga0207646_10069826 3300025922 Bacteria 3138
502 Ga0207646_10102666 3300025922 Bacteria 2564
503 Ga0207646_10138723 3300025922 Bacteria 2190
504 Ga0207646_10151956 3300025922 Bacteria 2088
505 Ga0207681_10000204 3300025923 Bacteria 47135
506 Ga0207681_10029307 3300025923 Bacteria 3573
507 Ga0207681_10080535 3300025923 Bacteria 2297
508 Ga0207681_10088152 3300025923 Unclassified 2209
509 Ga0207681_10096040 3300025923 Bacteria 2127
510 Ga0207694_10005775 3300025924 Bacteria 9482
511 Ga0207650_10004849 3300025925 Bacteria 9189
512 Ga0207650_10049137 3300025925 Bacteria 3113
513 Ga0207650_10052753 3300025925 Unclassified 3013
514 Ga0207650_10122064 3300025925 Bacteria 2030
515 Ga0207650_10198819 3300025925 Unclassified 1605
516 Ga0207659_10236189 3300025926 Bacteria 1477
517 Ga0207644_10000102 3300025931 Bacteria 61918
518 Ga0207644_10094620 3300025931 Unclassified 2232
519 Ga0207644_10141475 3300025931 Bacteria 1853
520 Ga0207706_10060738 3300025933 Bacteria 3329
521 Ga0207706_10629695 3300025933 Unclassified 920
522 Ga0207686_10000018 3300025934 Bacteria 189717
523 Ga0207686_10000021 3300025934 Bacteria 181793
524 Ga0207686_10001930 3300025934 Bacteria 11454
525 Ga0207686_10004855 3300025934 Bacteria 7227
526 Ga0207686_10101472 3300025934 Bacteria 1922
527 Ga0207686_10128500 3300025934 Unclassified 1735
528 Ga0207709_10000069 3300025935 Bacteria 183367
529 Ga0207709_10000595 3300025935 Bacteria 30171
530 Ga0207709_10007003 3300025935 Bacteria 6303
531 Ga0207709_10083688 3300025935 Bacteria 2064
532 Ga0207670_10000275 3300025936 Bacteria 31956
533 Ga0207670_10106787 3300025936 Bacteria 2009
534 Ga0207670_10167102 3300025936 Unclassified 1647
535 Ga0207670_10206873 3300025936 Bacteria 1494
536 Ga0207704_10035226 3300025938 Bacteria 2866
537 Ga0207704_10119732 3300025938 Unclassified 1799
538 Ga0207704_10518383 3300025938 Unclassified 964
539 Ga0207665_10000003 3300025939 Bacteria 220666
540 Ga0207691_10006319 3300025940 Bacteria 11440
541 Ga0207691_10066661 3300025940 Bacteria 3257
542 Ga0207691_10102248 3300025940 Bacteria 2556
543 Ga0207691_10145915 3300025940 Unclassified 2083
544 Ga0207711_10002579 3300025941 Bacteria 16125
545 Ga0207711_10047141 3300025941 Bacteria 3683
546 Ga0207711_10144384 3300025941 Bacteria 2143
547 Ga0207711_10395128 3300025941 Bacteria 1284
548 Ga0207711_10614697 3300025941 Bacteria 1014
549 Ga0207689_10000794 3300025942 Bacteria 30388
550 Ga0207689_10002977 3300025942 Bacteria 15628
551 Ga0207689_10008554 3300025942 Bacteria 8921
552 Ga0207689_10020733 3300025942 Bacteria 5527
553 Ga0207689_10142963 3300025942 Bacteria 1971
554 Ga0207689_10145370 3300025942 Bacteria 1954
555 Ga0207689_10217816 3300025942 Bacteria 1577
556 Ga0207689_10242056 3300025942 Unclassified 1491
557 Ga0207689_10268753 3300025942 Bacteria 1412
558 Ga0207679_10026276 3300025945 Bacteria 4013
559 Ga0207679_10111367 3300025945 Bacteria 2161
560 Ga0207651_10032451 3300025960 Bacteria 3354
561 Ga0207651_10034668 3300025960 Bacteria 3272
562 Ga0207651_10393002 3300025960 Unclassified 1178
563 Ga0207712_10000232 3300025961 Bacteria 54804
564 Ga0207668_10001515 3300025972 Bacteria 13576
565 Ga0207658_10042608 3300025986 Unclassified 3294
566 Ga0207658_10147216 3300025986 Bacteria 1914
567 Ga0207658_10191898 3300025986 Bacteria 1699
568 Ga0207677_10071687 3300026023 Bacteria 2446
569 Ga0207703_10000475 3300026035 Bacteria 42000
570 Ga0207703_10015260 3300026035 Bacteria 5994
571 Ga0207703_10054024 3300026035 Bacteria 3266
572 Ga0207703_10089392 3300026035 Bacteria 2587
573 Ga0207703_10127792 3300026035 Bacteria 2191
574 Ga0207639_10124116 3300026041 Bacteria 2127
575 Ga0207639_10308262 3300026041 Bacteria 1401
576 Ga0207678_10174757 3300026067 Bacteria 1834
577 Ga0207708_10000026 3300026075 Bacteria 168232
578 Ga0207708_10005206 3300026075 Bacteria 9591
579 Ga0207708_10103922 3300026075 Bacteria 2201
580 Ga0207708_10284612 3300026075 Bacteria 1340
581 Ga0207708_10650591 3300026075 Unclassified 897
582 Ga0207702_10055397 3300026078 Bacteria 3363
583 Ga0207641_10161155 3300026088 Bacteria 2039
584 Ga0207641_10177934 3300026088 Bacteria 1946
585 Ga0207641_10178794 3300026088 Unclassified 1942
586 Ga0207641_10668032 3300026088 Bacteria 1022
587 Ga0207641_10719672 3300026088 Bacteria 984
588 Ga0207648_10007763 3300026089 Bacteria 10479
589 Ga0207648_10061971 3300026089 Unclassified 3261
590 Ga0207648_10092849 3300026089 Bacteria 2639
591 Ga0207648_10107939 3300026089 Bacteria 2443
592 Ga0207648_10171358 3300026089 Unclassified 1919
593 Ga0207648_10268796 3300026089 Bacteria 1523
594 Ga0207648_10338214 3300026089 Bacteria 1355
595 Ga0207648_10521719 3300026089 Bacteria 1088
596 Ga0207676_10003407 3300026095 Bacteria 11240
597 Ga0207676_10016307 3300026095 Bacteria 5379
598 Ga0207676_10024106 3300026095 Bacteria 4499
599 Ga0207676_10030718 3300026095 Unclassified 4035
600 Ga0207676_10066690 3300026095 Unclassified 2872
601 Ga0207676_10071352 3300026095 Bacteria 2788
602 Ga0207676_10316303 3300026095 Bacteria 1431
603 Ga0207676_10379025 3300026095 Unclassified 1316
604 Ga0207676_10627352 3300026095 Bacteria 1035
605 Ga0207676_10809076 3300026095 Bacteria 914
606 Ga0207674_10000192 3300026116 Bacteria 75255
607 Ga0207674_10043919 3300026116 Unclassified 4606
608 Ga0207674_10052773 3300026116 Bacteria 4146
609 Ga0207674_10124936 3300026116 Bacteria 2539
610 Ga0207674_10224200 3300026116 Unclassified 1828
611 Ga0207674_10264235 3300026116 Bacteria 1668
612 Ga0207675_100000960 3300026118 Bacteria 28760
613 Ga0207675_100029991 3300026118 Bacteria 5063
614 Ga0207675_100173549 3300026118 Unclassified 2061
615 Ga0207675_100283030 3300026118 Bacteria 1611
616 Ga0207675_100357535 3300026118 Bacteria 1432
617 Ga0207675_100430969 3300026118 Unclassified 1304
618 Ga0207683_10209580 3300026121 Bacteria 1773
619 Ga0207698_10057444 3300026142 Bacteria 3011
620 Ga0207698_10129729 3300026142 Bacteria 2152
621 Ga0207698_10239983 3300026142 Unclassified 1651
622 Ga0207698_10276258 3300026142 Unclassified 1551
623 Ga0207428_10026037 3300027907 Bacteria 4887
624 Ga0207428_10122322 3300027907 Unclassified 1995
625 Ga0268266_10072750 3300028379 Bacteria 2982
626 Ga0268265_10021379 3300028380 Bacteria 4532
627 Ga0268265_10070955 3300028380 Bacteria 2711
628 Ga0268265_10075112 3300028380 Unclassified 2646
629 Ga0268265_10213512 3300028380 Unclassified 1683
630 Ga0268264_10123277 3300028381 Bacteria 2287
631 Ga0268264_10154925 3300028381 Bacteria 2058
632 Ga0268264_10154981 3300028381 Bacteria 2058
633 Ga0307408_100024802 3300031548 Unclassified 4099
634 Ga0307408_100164581 3300031548 Bacteria 1765
635 Ga0307408_100193129 3300031548 Bacteria 1642
636 Ga0307408_100361613 3300031548 Unclassified 1235
637 Ga0307405_10264114 3300031731 Unclassified 1287
638 Ga0307405_10278375 3300031731 Bacteria 1258
639 Ga0307413_10205849 3300031824 Unclassified 1425
640 Ga0307406_10022725 3300031901 Bacteria 3723
641 Ga0307407_10101320 3300031903 Bacteria 1788
642 Ga0307412_10030476 3300031911 Bacteria 3397
643 Ga0307412_10112261 3300031911 Bacteria 1948
644 Ga0307412_10145272 3300031911 Bacteria 1742
645 Ga0307412_10173837 3300031911 Bacteria 1613
646 Ga0307416_100102294 3300032002 Bacteria 2498
647 Ga0307416_100431372 3300032002 Unclassified 1365
648 Ga0307416_100558438 3300032002 Bacteria 1219
649 Ga0307416_100761940 3300032002 Bacteria 1061
650 Ga0307416_100819330 3300032002 Unclassified 1027
651 Ga0307414_10003383 3300032004 Bacteria 8519
652 Ga0307411_10351205 3300032005 Unclassified 1202
653 Ga0373951_0001364 3300035091 Bacteria 6417
654 Ga0373941_0032729 3300035115 Bacteria 1558
655 Ga0395900_0239699 3300037418 Bacteria 1820
656 Ga0395900_0741377 3300037418 Bacteria 913
657 Ga0395898_0133927 3300037466 Bacteria 2373
658 Ga0395898_0184418 3300037466 Bacteria 1994
659 Ga0395898_0289085 3300037466 Bacteria 1564
660 Ga0395898_0546565 3300037466 Bacteria 1100
661 Ga0395905_0000787 3300037471 Bacteria 41702
662 Ga0395905_0009249 3300037471 Bacteria 9645
663 Ga0395905_0154044 3300037471 Bacteria 2162
664 Ga0395901_0322819 3300038443 Bacteria 1597
665 Ga0242420_002795 3300038996 Bacteria 2525
666 Ga0242420_007936 3300038996 Bacteria 1713
667 Ga0400489_68120 3300039093 Unclassified 1796
668 Ga0436365_0206631 3300039437 Bacteria 2940
669 Ga0439448_0006017 3300042005 Bacteria 3476
670 Ga0439455_0003976 3300042012 Bacteria 2884
671 Ga0453683_0003384 3300044673 Bacteria 11770
672 Ga0453684_0146100 3300044712 Unclassified 2817
673 Ga0451576_0275503 3300045051 Bacteria 1759
674 Ga0495663_0000537 3300046525 Bacteria 13525
675 Ga0495598_0000409 3300046537 Bacteria 7723
676 Ga0495598_0115671 3300046537 Bacteria 904
677 Ga0495621_0000654 3300046539 Bacteria 8729
678 Ga0495621_0112519 3300046539 Bacteria 1045
679 Ga0495672_0012033 3300047320 Bacteria 6060
680 Ga0495684_0093790 3300047471 Bacteria 2273
681 Ga0496102_0159003 3300048905 Bacteria 2125
682 Ga0496103_0128839 3300048906 Bacteria 1615
683 Ga0496104_0058907 3300048907 Bacteria 3636
684 Ga0496104_0220891 3300048907 Bacteria 1807
685 Ga0496106_0026559 3300048909 Bacteria 4312
686 Ga0496106_0035942 3300048909 Bacteria 3705
687 Ga0496107_0248463 3300048910 Unclassified 1324
688 Ga0496108_0104517 3300048911 Bacteria 2417
689 Ga0496109_0353874 3300048912 Bacteria 1387
690 Ga0496110_0144319 3300048913 Bacteria 2153
691 Ga0496112_0115880 3300048915 Bacteria 2650
692 Ga0496112_0722773 3300048915 Bacteria 923
693 Ga0496126_0044283 3300048929 Bacteria 4100
694 Ga0501292_001906 3300049515 Bacteria 2623
695 Ga0501295_019888 3300049518 Bacteria 1210
696 Ga0501296_003320 3300049519 Unclassified 1712
697 Ga0501298_001045 3300049521 Bacteria 3971
698 Ga0501298_014548 3300049521 Bacteria 1407
699 Ga0501202_002243 3300049652 Bacteria 3229
700 Ga0501202_005068 3300049652 Bacteria 2325
701 Ga0501217_014533 3300049661 Bacteria 1780
702 Ga0501217_020678 3300049661 Bacteria 1548
703 Ga0501223_008576 3300049663 Bacteria 2082
704 Ga0501223_010404 3300049663 Bacteria 1872
705 Ga0501223_012618 3300049663 Bacteria 1688
706 Ga0501223_016828 3300049663 Bacteria 1445
707 Ga0501224_023886 3300049664 Unclassified 913
708 Ga0501227_004379 3300049665 Bacteria 3039
709 Ga0501227_047658 3300049665 Bacteria 1074
710 Ga0501230_001052 3300049667 Bacteria 3167
711 Ga0501233_004439 3300049668 Bacteria 2573
712 Ga0501235_035980 3300049669 Bacteria 1125
713 Ga0501243_008705 3300049675 Bacteria 1568
714 Ga0501243_019163 3300049675 Bacteria 1120
715 Ga0501249_011084 3300049679 Bacteria 1890
716 Ga0501251_005905 3300049681 Bacteria 1315
717 Ga0501225_0010071 3300049705 Bacteria 2684
718 Ga0501225_0011279 3300049705 Bacteria 2516
719 Ga0501225_0012182 3300049705 Bacteria 2416
720 Ga0501234_003723 3300049707 Bacteria 2398
721 Ga0501234_010506 3300049707 Bacteria 1443
722 Ga0501241_019925 3300049758 Bacteria 1233
723 Ga0501273_001028 3300049770 Bacteria 2517
724 Ga0501283_005330 3300049779 Bacteria 1766
725 Ga0501204_004382 3300049850 Bacteria 1520
726 Ga0501212_004155 3300049851 Bacteria 1852
727 nmdc:mga05p37_167155_c1 3300050507 Bacteria 2684
728 nmdc:mga05p37_20534_c1 3300050507 Bacteria 7991
729 nmdc:mga05p37_30117_c1 3300050507 Bacteria 6622
730 nmdc:mga05p37_572771_c1 3300050507 Bacteria 1280
731 nmdc:mga05p37_802923_c1 3300050507 Unclassified 1029
732 nmdc:mga05p37_89552_c1 3300050507 Bacteria 3792
733 nmdc:mga09592_158632_c1 3300050508 Bacteria 1953
734 nmdc:mga09592_47623_c1 3300050508 Bacteria 3613
735 nmdc:mga0qj67_34559_c1 3300050509 Unclassified 3949
736 nmdc:mga0qj67_76094_c1 3300050509 Unclassified 2684
737 nmdc:mga08y16_19882_c1 3300050511 Bacteria 7083
738 nmdc:mga08y16_251000_c1 3300050511 Unclassified 1828
739 nmdc:mga08y16_40139_c1 3300050511 Bacteria 4907
740 nmdc:mga08y16_45727_c1 3300050511 Bacteria 4586
741 nmdc:mga0n895_322262_c1 3300050512 Bacteria 1566
742 nmdc:mga0n895_364995_c1 3300050512 Unclassified 1462
743 nmdc:mga0n895_55020_c1 3300050512 Bacteria 3915
744 nmdc:mga0n895_719518_c1 3300050512 Unclassified 993
745 nmdc:mga0rr50_102_c1 3300050513 Bacteria 48211
746 nmdc:mga0rr50_85345_c1 3300050513 Bacteria 2447
747 nmdc:mga08x19_17997_c1 3300050514 Bacteria 4328
748 nmdc:mga08x19_195689_c1 3300050514 Bacteria 1384
749 nmdc:mga08x19_29_c1 3300050514 Bacteria 214647
750 nmdc:mga0a205_138337_c1 3300050515 Bacteria 2335
751 nmdc:mga0a205_16862_c1 3300050515 Bacteria 6837
752 nmdc:mga0a205_18763_c1 3300050515 Bacteria 5888
753 nmdc:mga0a205_370482_c1 3300050515 Unclassified 1298
754 nmdc:mga0a205_8373_c1 3300050515 Bacteria 9409
755 Ga0500643_006219 3300053087 Bacteria 5021
756 Ga0530510_0223263 3300061734 Unclassified 1400

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0546565 Ga0395898_0546565_420_1070 209
2 3300025893 Ga0207682_10172915 Ga0207682_101729151 218
3 3300003322 rootL2_10159794 rootL2_101597943 224
4 3300053087 Ga0500643_006219 Ga0500643_006219_239_1027 228
5 3300048929 Ga0496126_0044283 Ga0496126_0044283_2027_2848 233
6 3300005364 Ga0070673_100049770 Ga0070673_1000497703 249
7 3300005545 Ga0070695_100264258 Ga0070695_1002642581 249
8 3300006358 Ga0068871_100260611 Ga0068871_1002606112 249
9 3300025960 Ga0207651_10034668 Ga0207651_100346683 249
10 3300049681 Ga0501251_005905 Ga0501251_005905_311_1063 249
11 3300005347 Ga0070668_100001615 Ga0070668_10000161510 250
12 3300005365 Ga0070688_100015714 Ga0070688_1000157144 250
13 3300009553 Ga0105249_10000003 Ga0105249_10000003268 250
14 3300013306 Ga0163162_10000020 Ga0163162_1000002020 250
15 3300014326 Ga0157380_10078527 Ga0157380_100785272 250
16 3300025903 Ga0207680_10271851 Ga0207680_102718512 250
17 3300025961 Ga0207712_10000232 Ga0207712_1000023222 250
18 3300025972 Ga0207668_10001515 Ga0207668_100015159 250
19 3300026089 Ga0207648_10338214 Ga0207648_103382142 250
20 3300044673 Ga0453683_0003384 Ga0453683_0003384_7384_8187 250
21 3300009553 Ga0105249_10539027 Ga0105249_105390272 251
22 3300026116 Ga0207674_10124936 Ga0207674_101249362 251
23 3300005546 Ga0070696_100370023 Ga0070696_1003700232 252
24 3300009148 Ga0105243_10632729 Ga0105243_106327292 252
25 3300009553 Ga0105249_10051054 Ga0105249_100510543 252
26 3300037471 Ga0395905_0000787 Ga0395905_0000787_2510_3295 254
27 3300037471 Ga0395905_0009249 Ga0395905_0009249_360_1145 254
28 3300061734 Ga0530510_0223263 Ga0530510_0223263_448_1284 254
29 3300009148 Ga0105243_10210884 Ga0105243_102108842 255
30 3300037471 Ga0395905_0154044 Ga0395905_0154044_503_1291 255
31 3300039093 Ga0400489_68120 Ga0400489_68120_710_1498 255
32 3300005549 Ga0070704_100378662 Ga0070704_1003786622 256
33 3300037418 Ga0395900_0741377 Ga0395900_0741377_33_812 256
34 3300005334 Ga0068869_100021665 Ga0068869_1000216653 257
35 3300005719 Ga0068861_100014204 Ga0068861_1000142043 257
36 3300006852 Ga0075433_10055254 Ga0075433_100552543 257
37 3300006871 Ga0075434_100040693 Ga0075434_1000406933 257
38 3300009098 Ga0105245_10152304 Ga0105245_101523042 257
39 3300009147 Ga0114129_10261157 Ga0114129_102611572 257
40 3300010375 Ga0105239_10109632 Ga0105239_101096323 257
41 3300013297 Ga0157378_10254782 Ga0157378_102547822 257
42 3300013306 Ga0163162_10009766 Ga0163162_100097666 257
43 3300017792 Ga0163161_10057508 Ga0163161_100575083 257
44 3300025901 Ga0207688_10276182 Ga0207688_102761821 257
45 3300025942 Ga0207689_10000794 Ga0207689_1000079421 257
46 3300026118 Ga0207675_100000960 Ga0207675_1000009603 257
47 3300038996 Ga0242420_002795 Ga0242420_002795_87_917 257
48 3300005543 Ga0070672_100037399 Ga0070672_1000373993 258
49 3300005617 Ga0068859_100196044 Ga0068859_1001960442 258
50 3300006931 Ga0097620_100196045 Ga0097620_1001960452 258
51 3300009148 Ga0105243_10000792 Ga0105243_100007922 258
52 3300009176 Ga0105242_10000370 Ga0105242_1000037028 258
53 3300009177 Ga0105248_10222274 Ga0105248_102222742 258
54 3300013297 Ga0157378_10000342 Ga0157378_1000034212 258
55 3300025922 Ga0207646_10138723 Ga0207646_101387233 258
56 3300025934 Ga0207686_10004855 Ga0207686_100048552 258
57 3300025935 Ga0207709_10000595 Ga0207709_100005952 258
58 3300025940 Ga0207691_10066661 Ga0207691_100666614 258
59 3300025942 Ga0207689_10142963 Ga0207689_101429633 258
60 3300048909 Ga0496106_0035942 Ga0496106_0035942_51_881 258
61 3300005406 Ga0070703_10000070 Ga0070703_1000007034 259
62 3300005841 Ga0068863_100401607 Ga0068863_1004016071 259
63 3300025885 Ga0207653_10000332 Ga0207653_1000033220 259
64 3300046539 Ga0495621_0112519 Ga0495621_0112519_178_1008 259
65 3300001432 JGI24034J14986_100233 JGI24034J14986_1002332 260
66 3300002074 JGI24748J21848_1000010 JGI24748J21848_1000010114 260
67 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001568 260
68 3300005334 Ga0068869_100202923 Ga0068869_1002029231 260
69 3300005337 Ga0070682_100433228 Ga0070682_1004332281 260
70 3300005340 Ga0070689_100261285 Ga0070689_1002612852 260
71 3300005343 Ga0070687_100110792 Ga0070687_1001107922 260
72 3300005343 Ga0070687_100168368 Ga0070687_1001683682 260
73 3300005354 Ga0070675_100216495 Ga0070675_1002164952 260
74 3300005355 Ga0070671_100065096 Ga0070671_1000650963 260
75 3300005364 Ga0070673_100358862 Ga0070673_1003588622 260
76 3300005406 Ga0070703_10002781 Ga0070703_100027813 260
77 3300005440 Ga0070705_100005049 Ga0070705_1000050493 260
78 3300005440 Ga0070705_100051410 Ga0070705_1000514102 260
79 3300005444 Ga0070694_100012777 Ga0070694_1000127772 260
80 3300005444 Ga0070694_100051152 Ga0070694_1000511523 260
81 3300005444 Ga0070694_100311291 Ga0070694_1003112912 260
82 3300005459 Ga0068867_100460414 Ga0068867_1004604141 260
83 3300005468 Ga0070707_100018624 Ga0070707_1000186243 260
84 3300005471 Ga0070698_100008698 Ga0070698_1000086985 260
85 3300005544 Ga0070686_100033399 Ga0070686_1000333992 260
86 3300005547 Ga0070693_100006979 Ga0070693_1000069793 260
87 3300005549 Ga0070704_100016807 Ga0070704_1000168075 260
88 3300005549 Ga0070704_100441413 Ga0070704_1004414131 260
89 3300005615 Ga0070702_100005034 Ga0070702_1000050345 260
90 3300005615 Ga0070702_100120277 Ga0070702_1001202772 260
91 3300005719 Ga0068861_100281957 Ga0068861_1002819572 260
92 3300005834 Ga0068851_10001570 Ga0068851_100015706 260
93 3300005841 Ga0068863_100095379 Ga0068863_1000953792 260
94 3300005842 Ga0068858_100000005 Ga0068858_100000005171 260
95 3300005842 Ga0068858_100101047 Ga0068858_1001010472 260
96 3300005842 Ga0068858_100113066 Ga0068858_1001130663 260
97 3300005842 Ga0068858_100126165 Ga0068858_1001261653 260
98 3300005843 Ga0068860_100086317 Ga0068860_1000863173 260
99 3300005843 Ga0068860_100155505 Ga0068860_1001555052 260
100 3300006237 Ga0097621_100102914 Ga0097621_1001029141 260
101 3300006237 Ga0097621_100178552 Ga0097621_1001785523 260
102 3300009094 Ga0111539_10144800 Ga0111539_101448003 260
103 3300009101 Ga0105247_10000002 Ga0105247_10000002426 260
104 3300009101 Ga0105247_10041130 Ga0105247_100411303 260
105 3300009147 Ga0114129_10130383 Ga0114129_101303833 260
106 3300009148 Ga0105243_10000182 Ga0105243_100001825 260
107 3300009148 Ga0105243_10631933 Ga0105243_106319331 260
108 3300009148 Ga0105243_10632908 Ga0105243_106329081 260
109 3300009177 Ga0105248_10042861 Ga0105248_100428613 260
110 3300009545 Ga0105237_10001910 Ga0105237_100019109 260
111 3300009553 Ga0105249_10400831 Ga0105249_104008312 260
112 3300010375 Ga0105239_10333000 Ga0105239_103330003 260
113 3300013297 Ga0157378_10098022 Ga0157378_100980222 260
114 3300013306 Ga0163162_10045274 Ga0163162_100452743 260
115 3300013306 Ga0163162_10487603 Ga0163162_104876032 260
116 3300014326 Ga0157380_10249271 Ga0157380_102492712 260
117 3300014968 Ga0157379_10061460 Ga0157379_100614603 260
118 3300025223 Ga0207672_1000050 Ga0207672_10000509 260
119 3300025321 Ga0207656_10000959 Ga0207656_100009597 260
120 3300025900 Ga0207710_10000002 Ga0207710_10000002426 260
121 3300025914 Ga0207671_10009096 Ga0207671_100090964 260
122 3300025918 Ga0207662_10107120 Ga0207662_101071201 260
123 3300025918 Ga0207662_10244213 Ga0207662_102442132 260
124 3300025922 Ga0207646_10015551 Ga0207646_100155513 260
125 3300025931 Ga0207644_10000102 Ga0207644_1000010210 260
126 3300025934 Ga0207686_10000018 Ga0207686_10000018127 260
127 3300025934 Ga0207686_10000021 Ga0207686_1000002163 260
128 3300025935 Ga0207709_10000069 Ga0207709_1000006988 260
129 3300025936 Ga0207670_10167102 Ga0207670_101671021 260
130 3300025938 Ga0207704_10518383 Ga0207704_105183832 260
131 3300025940 Ga0207691_10145915 Ga0207691_101459152 260
132 3300025941 Ga0207711_10047141 Ga0207711_100471413 260
133 3300025942 Ga0207689_10217816 Ga0207689_102178163 260
134 3300025960 Ga0207651_10393002 Ga0207651_103930022 260
135 3300025986 Ga0207658_10042608 Ga0207658_100426083 260
136 3300026035 Ga0207703_10000475 Ga0207703_1000047510 260
137 3300026035 Ga0207703_10054024 Ga0207703_100540243 260
138 3300026035 Ga0207703_10127792 Ga0207703_101277922 260
139 3300026075 Ga0207708_10650591 Ga0207708_106505911 260
140 3300026088 Ga0207641_10177934 Ga0207641_101779343 260
141 3300026089 Ga0207648_10092849 Ga0207648_100928492 260
142 3300028380 Ga0268265_10070955 Ga0268265_100709551 260
143 3300028381 Ga0268264_10123277 Ga0268264_101232772 260
144 3300028381 Ga0268264_10154925 Ga0268264_101549253 260
145 3300049515 Ga0501292_001906 Ga0501292_001906_176_1006 260
146 3300049518 Ga0501295_019888 Ga0501295_019888_37_867 260
147 3300049521 Ga0501298_014548 Ga0501298_014548_207_1037 260
148 3300049652 Ga0501202_002243 Ga0501202_002243_473_1303 260
149 3300049661 Ga0501217_014533 Ga0501217_014533_723_1553 260
150 3300049663 Ga0501223_008576 Ga0501223_008576_1065_1895 260
151 3300049665 Ga0501227_004379 Ga0501227_004379_1665_2495 260
152 3300049675 Ga0501243_019163 Ga0501243_019163_75_905 260
153 3300049705 Ga0501225_0012182 Ga0501225_0012182_1408_2238 260
154 3300049758 Ga0501241_019925 Ga0501241_019925_180_1010 260
155 3300050507 nmdc:mga05p37_167155_c1 nmdc:mga05p37_167155_c1_814_1644 260
156 3300050511 nmdc:mga08y16_251000_c1 nmdc:mga08y16_251000_c1_286_1116 260
157 3300005344 Ga0070661_100157254 Ga0070661_1001572542 261
158 3300005444 Ga0070694_100019372 Ga0070694_1000193723 261
159 3300005536 Ga0070697_100021115 Ga0070697_1000211152 261
160 3300005546 Ga0070696_100015591 Ga0070696_1000155912 261
161 3300005577 Ga0068857_100039642 Ga0068857_1000396422 261
162 3300005618 Ga0068864_100094593 Ga0068864_1000945933 261
163 3300005842 Ga0068858_100537740 Ga0068858_1005377402 261
164 3300006871 Ga0075434_100072207 Ga0075434_1000722073 261
165 3300014325 Ga0163163_10333987 Ga0163163_103339872 261
166 3300025911 Ga0207654_10147211 Ga0207654_101472112 261
167 3300025925 Ga0207650_10122064 Ga0207650_101220642 261
168 3300026088 Ga0207641_10668032 Ga0207641_106680322 261
169 3300026095 Ga0207676_10030718 Ga0207676_100307183 261
170 3300026116 Ga0207674_10043919 Ga0207674_100439193 261
171 3300032002 Ga0307416_100819330 Ga0307416_1008193301 261
172 3300037418 Ga0395900_0239699 Ga0395900_0239699_432_1262 261
173 3300037466 Ga0395898_0184418 Ga0395898_0184418_837_1667 261
174 3300038443 Ga0395901_0322819 Ga0395901_0322819_421_1251 261
175 3300039437 Ga0436365_0206631 Ga0436365_0206631_1160_2005 261
176 3300042005 Ga0439448_0006017 Ga0439448_0006017_1497_2327 261
177 3300042012 Ga0439455_0003976 Ga0439455_0003976_1963_2793 261
178 3300005445 Ga0070708_100216027 Ga0070708_1002160272 262
179 3300005471 Ga0070698_100180858 Ga0070698_1001808582 262
180 3300005518 Ga0070699_100114781 Ga0070699_1001147813 262
181 3300005536 Ga0070697_100030854 Ga0070697_1000308541 262
182 3300005546 Ga0070696_100082247 Ga0070696_1000822472 262
183 3300005546 Ga0070696_100389555 Ga0070696_1003895552 262
184 3300009094 Ga0111539_10522706 Ga0111539_105227062 262
185 3300025910 Ga0207684_10138630 Ga0207684_101386301 262
186 3300031548 Ga0307408_100024802 Ga0307408_1000248022 262
187 3300031824 Ga0307413_10205849 Ga0307413_102058492 262
188 3300031901 Ga0307406_10022725 Ga0307406_100227252 262
189 3300031903 Ga0307407_10101320 Ga0307407_101013202 262
190 3300031911 Ga0307412_10030476 Ga0307412_100304763 262
191 3300032004 Ga0307414_10003383 Ga0307414_100033836 262
192 3300048915 Ga0496112_0115880 Ga0496112_0115880_1550_2380 262
193 3300049652 Ga0501202_005068 Ga0501202_005068_295_1125 262
194 3300049661 Ga0501217_020678 Ga0501217_020678_484_1314 262
195 3300049663 Ga0501223_012618 Ga0501223_012618_328_1158 262
196 3300049667 Ga0501230_001052 Ga0501230_001052_606_1436 262
197 3300049705 Ga0501225_0010071 Ga0501225_0010071_447_1277 262
198 3300049707 Ga0501234_010506 Ga0501234_010506_193_1023 262
199 3300049851 Ga0501212_004155 Ga0501212_004155_451_1281 262
200 3300005293 Ga0065715_10090255 Ga0065715_100902556 263
201 3300005293 Ga0065715_10134000 Ga0065715_101340001 263
202 3300005295 Ga0065707_10184306 Ga0065707_101843062 263
203 3300005330 Ga0070690_100001562 Ga0070690_1000015626 263
204 3300005343 Ga0070687_100033725 Ga0070687_1000337252 263
205 3300005345 Ga0070692_10095891 Ga0070692_100958912 263
206 3300005353 Ga0070669_100511382 Ga0070669_1005113822 263
207 3300005364 Ga0070673_100051504 Ga0070673_1000515042 263
208 3300005440 Ga0070705_100153536 Ga0070705_1001535362 263
209 3300005444 Ga0070694_100257655 Ga0070694_1002576552 263
210 3300005444 Ga0070694_100265247 Ga0070694_1002652472 263
211 3300005467 Ga0070706_100516116 Ga0070706_1005161162 263
212 3300005468 Ga0070707_100104173 Ga0070707_1001041732 263
213 3300005518 Ga0070699_100036747 Ga0070699_1000367473 263
214 3300005544 Ga0070686_100000559 Ga0070686_10000055918 263
215 3300005545 Ga0070695_100048122 Ga0070695_1000481222 263
216 3300005549 Ga0070704_100065324 Ga0070704_1000653243 263
217 3300005617 Ga0068859_100070691 Ga0068859_1000706913 263
218 3300005842 Ga0068858_100158410 Ga0068858_1001584102 263
219 3300006852 Ga0075433_10635207 Ga0075433_106352071 263
220 3300006931 Ga0097620_100070690 Ga0097620_1000706903 263
221 3300014326 Ga0157380_10094680 Ga0157380_100946802 263
222 3300025918 Ga0207662_10228548 Ga0207662_102285482 263
223 3300025921 Ga0207652_10166483 Ga0207652_101664832 263
224 3300025922 Ga0207646_10069826 Ga0207646_100698263 263
225 3300025960 Ga0207651_10032451 Ga0207651_100324512 263
226 3300026116 Ga0207674_10224200 Ga0207674_102242002 263
227 2162886007 SwRhRL2b_contig_2665322 SwRhRL2b_0235.00006870 264
228 3300005295 Ga0065707_10012515 Ga0065707_100125152 264
229 3300005441 Ga0070700_100000055 Ga0070700_10000005538 264
230 3300005536 Ga0070697_100082386 Ga0070697_1000823862 264
231 3300005617 Ga0068859_100000586 Ga0068859_1000005864 264
232 3300005719 Ga0068861_100016686 Ga0068861_1000166863 264
233 3300006931 Ga0097620_100000586 Ga0097620_1000005864 264
234 3300009147 Ga0114129_10042631 Ga0114129_100426312 264
235 3300009174 Ga0105241_10323466 Ga0105241_103234662 264
236 3300009177 Ga0105248_10013649 Ga0105248_100136495 264
237 3300013296 Ga0157374_10360317 Ga0157374_103603172 264
238 3300013308 Ga0157375_10464767 Ga0157375_104647671 264
239 3300014325 Ga0163163_10005683 Ga0163163_100056833 264
240 3300025926 Ga0207659_10236189 Ga0207659_102361892 264
241 3300025941 Ga0207711_10002579 Ga0207711_1000257912 264
242 3300026075 Ga0207708_10000026 Ga0207708_1000002632 264
243 3300026118 Ga0207675_100029991 Ga0207675_1000299913 264
244 3300031548 Ga0307408_100164581 Ga0307408_1001645812 264
245 3300031731 Ga0307405_10278375 Ga0307405_102783752 264
246 3300031911 Ga0307412_10112261 Ga0307412_101122613 264
247 3300032002 Ga0307416_100558438 Ga0307416_1005584382 264
248 3300032002 Ga0307416_100761940 Ga0307416_1007619402 264
249 3300049663 Ga0501223_010404 Ga0501223_010404_152_982 264
250 3300049664 Ga0501224_023886 Ga0501224_023886_25_855 264
251 3300049665 Ga0501227_047658 Ga0501227_047658_154_984 264
252 3300049668 Ga0501233_004439 Ga0501233_004439_1610_2440 264
253 3300049669 Ga0501235_035980 Ga0501235_035980_106_936 264
254 3300049675 Ga0501243_008705 Ga0501243_008705_52_882 264
255 3300049679 Ga0501249_011084 Ga0501249_011084_344_1174 264
256 3300049705 Ga0501225_0011279 Ga0501225_0011279_276_1106 264
257 3300049707 Ga0501234_003723 Ga0501234_003723_913_1743 264
258 3300049770 Ga0501273_001028 Ga0501273_001028_1241_2071 264
259 3300049850 Ga0501204_004382 Ga0501204_004382_91_921 264
260 3300050511 nmdc:mga08y16_19882_c1 nmdc:mga08y16_19882_c1_3431_4264 264
261 3300000532 CNAas_1000304 CNAas_10003044 265
262 3300005289 Ga0065704_10115131 Ga0065704_101151312 265
263 3300005334 Ga0068869_100156164 Ga0068869_1001561642 265
264 3300005340 Ga0070689_100001010 Ga0070689_10000101012 265
265 3300005341 Ga0070691_10219344 Ga0070691_102193441 265
266 3300005345 Ga0070692_10047476 Ga0070692_100474763 265
267 3300005353 Ga0070669_100006636 Ga0070669_1000066363 265
268 3300005459 Ga0068867_100077899 Ga0068867_1000778993 265
269 3300005543 Ga0070672_100022167 Ga0070672_1000221672 265
270 3300005578 Ga0068854_100135728 Ga0068854_1001357281 265
271 3300005578 Ga0068854_100327073 Ga0068854_1003270732 265
272 3300005719 Ga0068861_100005663 Ga0068861_1000056633 265
273 3300005841 Ga0068863_100294465 Ga0068863_1002944652 265
274 3300005844 Ga0068862_100005732 Ga0068862_1000057327 265
275 3300009094 Ga0111539_10106467 Ga0111539_101064673 265
276 3300009174 Ga0105241_10210850 Ga0105241_102108501 265
277 3300009177 Ga0105248_10275645 Ga0105248_102756452 265
278 3300009553 Ga0105249_10010555 Ga0105249_100105553 265
279 3300011119 Ga0105246_10139604 Ga0105246_101396042 265
280 3300013297 Ga0157378_10764053 Ga0157378_107640531 265
281 3300013306 Ga0163162_10166578 Ga0163162_101665781 265
282 3300013308 Ga0157375_10080235 Ga0157375_100802353 265
283 3300014326 Ga0157380_10017360 Ga0157380_100173602 265
284 3300017792 Ga0163161_10270006 Ga0163161_102700062 265
285 3300025907 Ga0207645_10181273 Ga0207645_101812732 265
286 3300025908 Ga0207643_10008153 Ga0207643_100081533 265
287 3300025911 Ga0207654_10037005 Ga0207654_100370052 265
288 3300025918 Ga0207662_10253814 Ga0207662_102538142 265
289 3300025923 Ga0207681_10088152 Ga0207681_100881522 265
290 3300025936 Ga0207670_10000275 Ga0207670_1000027524 265
291 3300025942 Ga0207689_10242056 Ga0207689_102420562 265
292 3300026075 Ga0207708_10005206 Ga0207708_100052066 265
293 3300026089 Ga0207648_10061971 Ga0207648_100619712 265
294 3300026095 Ga0207676_10379025 Ga0207676_103790251 265
295 3300028380 Ga0268265_10075112 Ga0268265_100751122 265
296 3300031548 Ga0307408_100193129 Ga0307408_1001931292 265
297 3300031731 Ga0307405_10264114 Ga0307405_102641141 265
298 3300031911 Ga0307412_10173837 Ga0307412_101738372 265
299 3300032002 Ga0307416_100431372 Ga0307416_1004313722 265
300 3300035115 Ga0373941_0032729 Ga0373941_0032729_142_972 265
301 2162886006 SwRhRL3b_contig_4315247 SwRhRL3b_0675.00000300 266
302 3300005288 Ga0065714_10064605 Ga0065714_1006460511 266
303 3300005290 Ga0065712_10067817 Ga0065712_1006781711 266
304 3300005293 Ga0065715_10091791 Ga0065715_100917912 266
305 3300005345 Ga0070692_10108091 Ga0070692_101080912 266
306 3300005441 Ga0070700_100132399 Ga0070700_1001323992 266
307 3300005539 Ga0068853_100034814 Ga0068853_1000348143 266
308 3300005545 Ga0070695_100166542 Ga0070695_1001665421 266
309 3300005549 Ga0070704_100610852 Ga0070704_1006108521 266
310 3300005615 Ga0070702_100018033 Ga0070702_1000180332 266
311 3300005616 Ga0068852_100185520 Ga0068852_1001855202 266
312 3300005843 Ga0068860_100051120 Ga0068860_1000511203 266
313 3300006237 Ga0097621_100001987 Ga0097621_1000019873 266
314 3300006358 Ga0068871_100012702 Ga0068871_1000127022 266
315 3300006852 Ga0075433_10029567 Ga0075433_100295673 266
316 3300009094 Ga0111539_10006864 Ga0111539_1000686413 266
317 3300009147 Ga0114129_10011843 Ga0114129_100118436 266
318 3300025938 Ga0207704_10119732 Ga0207704_101197322 266
319 3300026041 Ga0207639_10124116 Ga0207639_101241163 266
320 3300026142 Ga0207698_10129729 Ga0207698_101297293 266
321 3300050507 nmdc:mga05p37_20534_c1 nmdc:mga05p37_20534_c1_5662_6492 266
322 3300050511 nmdc:mga08y16_40139_c1 nmdc:mga08y16_40139_c1_4019_4855 266
323 3300050512 nmdc:mga0n895_322262_c1 nmdc:mga0n895_322262_c1_571_1401 266
324 3300005295 Ga0065707_10094651 Ga0065707_100946511 267
325 3300005353 Ga0070669_100113465 Ga0070669_1001134653 267
326 3300005457 Ga0070662_100530766 Ga0070662_1005307661 267
327 3300005546 Ga0070696_100210271 Ga0070696_1002102712 267
328 3300005547 Ga0070693_100100658 Ga0070693_1001006583 267
329 3300005615 Ga0070702_100223035 Ga0070702_1002230352 267
330 3300005616 Ga0068852_100112464 Ga0068852_1001124642 267
331 3300005617 Ga0068859_100652033 Ga0068859_1006520332 267
332 3300005617 Ga0068859_100733458 Ga0068859_1007334581 267
333 3300005843 Ga0068860_100031983 Ga0068860_1000319833 267
334 3300005843 Ga0068860_100231649 Ga0068860_1002316492 267
335 3300005985 Ga0081539_10000279 Ga0081539_1000027980 267
336 3300006931 Ga0097620_100651971 Ga0097620_1006519712 267
337 3300006931 Ga0097620_100733440 Ga0097620_1007334401 267
338 3300009148 Ga0105243_10582858 Ga0105243_105828582 267
339 3300009174 Ga0105241_10314108 Ga0105241_103141081 267
340 3300009177 Ga0105248_10076353 Ga0105248_100763531 267
341 3300009551 Ga0105238_10019867 Ga0105238_100198676 267
342 3300011119 Ga0105246_10540141 Ga0105246_105401411 267
343 3300013306 Ga0163162_10004174 Ga0163162_1000417412 267
344 3300014325 Ga0163163_10181778 Ga0163163_101817782 267
345 3300014326 Ga0157380_10062342 Ga0157380_100623423 267
346 3300014968 Ga0157379_10374720 Ga0157379_103747201 267
347 3300025923 Ga0207681_10029307 Ga0207681_100293072 267
348 3300025924 Ga0207694_10005775 Ga0207694_100057756 267
349 3300025934 Ga0207686_10128500 Ga0207686_101285002 267
350 3300025935 Ga0207709_10083688 Ga0207709_100836882 267
351 3300025936 Ga0207670_10206873 Ga0207670_102068731 267
352 3300026075 Ga0207708_10284612 Ga0207708_102846122 267
353 3300026089 Ga0207648_10268796 Ga0207648_102687962 267
354 3300026095 Ga0207676_10316303 Ga0207676_103163032 267
355 3300026095 Ga0207676_10627352 Ga0207676_106273521 267
356 3300026116 Ga0207674_10264235 Ga0207674_102642352 267
357 3300026118 Ga0207675_100283030 Ga0207675_1002830302 267
358 3300026118 Ga0207675_100357535 Ga0207675_1003575352 267
359 3300026142 Ga0207698_10057444 Ga0207698_100574443 267
360 3300026142 Ga0207698_10276258 Ga0207698_102762582 267
361 3300038996 Ga0242420_007936 Ga0242420_007936_630_1460 267
362 3300005842 Ga0068858_100043649 Ga0068858_1000436493 268
363 3300005985 Ga0081539_10000695 Ga0081539_1000069529 268
364 3300009147 Ga0114129_10986673 Ga0114129_109866732 268
365 3300026035 Ga0207703_10015260 Ga0207703_100152603 268
366 3300050507 nmdc:mga05p37_802923_c1 nmdc:mga05p37_802923_c1_147_977 268
367 3300005536 Ga0070697_100006751 Ga0070697_1000067516 269
368 3300005364 Ga0070673_100370000 Ga0070673_1003700002 270
369 3300005438 Ga0070701_10029396 Ga0070701_100293962 270
370 3300005471 Ga0070698_100005783 Ga0070698_1000057834 270
371 3300005544 Ga0070686_100002856 Ga0070686_1000028567 270
372 3300005547 Ga0070693_100073333 Ga0070693_1000733332 270
373 3300005549 Ga0070704_100330648 Ga0070704_1003306482 270
374 3300009147 Ga0114129_10509154 Ga0114129_105091542 270
375 3300009176 Ga0105242_10000767 Ga0105242_1000076711 270
376 3300014326 Ga0157380_10013970 Ga0157380_100139701 270
377 3300025934 Ga0207686_10001930 Ga0207686_100019305 270
378 3300005719 Ga0068861_100010458 Ga0068861_1000104588 271
379 3300006871 Ga0075434_100246323 Ga0075434_1002463232 271
380 3300009147 Ga0114129_10130794 Ga0114129_101307941 271
381 3300009177 Ga0105248_10036086 Ga0105248_100360863 271
382 3300013297 Ga0157378_10067451 Ga0157378_100674511 271
383 3300013297 Ga0157378_10072703 Ga0157378_100727033 271
384 3300026118 Ga0207675_100430969 Ga0207675_1004309692 271
385 3300046537 Ga0495598_0115671 Ga0495598_0115671_11_832 271
386 3300050507 nmdc:mga05p37_30117_c1 nmdc:mga05p37_30117_c1_3991_4815 271
387 3300005334 Ga0068869_100269679 Ga0068869_1002696792 272
388 3300005344 Ga0070661_100174773 Ga0070661_1001747732 272
389 3300005457 Ga0070662_100038792 Ga0070662_1000387922 272
390 3300005458 Ga0070681_10001765 Ga0070681_100017656 272
391 3300005467 Ga0070706_100154941 Ga0070706_1001549412 272
392 3300005530 Ga0070679_100009165 Ga0070679_1000091654 272
393 3300005539 Ga0068853_100037988 Ga0068853_1000379883 272
394 3300005549 Ga0070704_100060062 Ga0070704_1000600622 272
395 3300005564 Ga0070664_100001715 Ga0070664_1000017154 272
396 3300005577 Ga0068857_100013452 Ga0068857_1000134524 272
397 3300009147 Ga0114129_10005832 Ga0114129_100058327 272
398 3300013100 Ga0157373_10026553 Ga0157373_100265533 272
399 3300013297 Ga0157378_10214703 Ga0157378_102147032 272
400 3300013307 Ga0157372_10544565 Ga0157372_105445651 272
401 3300013308 Ga0157375_10025425 Ga0157375_100254253 272
402 3300013308 Ga0157375_10767318 Ga0157375_107673181 272
403 3300014325 Ga0163163_10043665 Ga0163163_100436653 272
404 3300014325 Ga0163163_10503600 Ga0163163_105036002 272
405 3300025910 Ga0207684_10132301 Ga0207684_101323013 272
406 3300025912 Ga0207707_10010819 Ga0207707_100108196 272
407 3300025919 Ga0207657_10075018 Ga0207657_100750183 272
408 3300025920 Ga0207649_10068408 Ga0207649_100684082 272
409 3300025921 Ga0207652_10016140 Ga0207652_100161403 272
410 3300025933 Ga0207706_10060738 Ga0207706_100607382 272
411 3300025941 Ga0207711_10395128 Ga0207711_103951282 272
412 3300025941 Ga0207711_10614697 Ga0207711_106146971 272
413 3300025942 Ga0207689_10268753 Ga0207689_102687532 272
414 3300025945 Ga0207679_10026276 Ga0207679_100262763 272
415 3300026067 Ga0207678_10174757 Ga0207678_101747572 272
416 3300026095 Ga0207676_10071352 Ga0207676_100713523 272
417 3300026116 Ga0207674_10000192 Ga0207674_1000019249 272
418 3300031911 Ga0307412_10145272 Ga0307412_101452722 272
419 3300048909 Ga0496106_0026559 Ga0496106_0026559_2387_3211 272
420 3300049519 Ga0501296_003320 Ga0501296_003320_529_1380 272
421 3300049521 Ga0501298_001045 Ga0501298_001045_2782_3633 272
422 3300049663 Ga0501223_016828 Ga0501223_016828_128_979 272
423 3300049779 Ga0501283_005330 Ga0501283_005330_300_1151 272
424 3300050507 nmdc:mga05p37_89552_c1 nmdc:mga05p37_89552_c1_1994_2824 272
425 3300005293 Ga0065715_10022399 Ga0065715_100223991 273
426 3300005293 Ga0065715_10049877 Ga0065715_100498772 273
427 3300005293 Ga0065715_10111101 Ga0065715_101111013 273
428 3300005295 Ga0065707_10098569 Ga0065707_100985692 273
429 3300005330 Ga0070690_100029550 Ga0070690_1000295501 273
430 3300005331 Ga0070670_100003915 Ga0070670_1000039159 273
431 3300005334 Ga0068869_100094004 Ga0068869_1000940041 273
432 3300005334 Ga0068869_100127430 Ga0068869_1001274302 273
433 3300005335 Ga0070666_10405155 Ga0070666_104051551 273
434 3300005338 Ga0068868_100057771 Ga0068868_1000577713 273
435 3300005345 Ga0070692_10060861 Ga0070692_100608612 273
436 3300005353 Ga0070669_100006486 Ga0070669_1000064863 273
437 3300005353 Ga0070669_100083977 Ga0070669_1000839773 273
438 3300005355 Ga0070671_100000822 Ga0070671_1000008229 273
439 3300005355 Ga0070671_100174259 Ga0070671_1001742591 273
440 3300005356 Ga0070674_100061892 Ga0070674_1000618922 273
441 3300005365 Ga0070688_100065383 Ga0070688_1000653832 273
442 3300005367 Ga0070667_100149791 Ga0070667_1001497912 273
443 3300005434 Ga0070709_10381179 Ga0070709_103811791 273
444 3300005444 Ga0070694_100008982 Ga0070694_1000089821 273
445 3300005444 Ga0070694_100138108 Ga0070694_1001381082 273
446 3300005456 Ga0070678_100106093 Ga0070678_1001060931 273
447 3300005458 Ga0070681_10000523 Ga0070681_1000052312 273
448 3300005458 Ga0070681_10022640 Ga0070681_100226404 273
449 3300005459 Ga0068867_100024527 Ga0068867_1000245271 273
450 3300005459 Ga0068867_100091425 Ga0068867_1000914253 273
451 3300005466 Ga0070685_10016990 Ga0070685_100169902 273
452 3300005467 Ga0070706_100000138 Ga0070706_10000013835 273
453 3300005468 Ga0070707_100000197 Ga0070707_1000001972 273
454 3300005471 Ga0070698_100549674 Ga0070698_1005496741 273
455 3300005530 Ga0070679_100001109 Ga0070679_10000110919 273
456 3300005539 Ga0068853_100141786 Ga0068853_1001417862 273
457 3300005544 Ga0070686_100058582 Ga0070686_1000585822 273
458 3300005545 Ga0070695_100069698 Ga0070695_1000696982 273
459 3300005545 Ga0070695_100090543 Ga0070695_1000905432 273
460 3300005545 Ga0070695_100101837 Ga0070695_1001018372 273
461 3300005546 Ga0070696_100019299 Ga0070696_1000192992 273
462 3300005547 Ga0070693_100063597 Ga0070693_1000635973 273
463 3300005549 Ga0070704_100001928 Ga0070704_1000019289 273
464 3300005549 Ga0070704_100063819 Ga0070704_1000638192 273
465 3300005549 Ga0070704_100377243 Ga0070704_1003772432 273
466 3300005564 Ga0070664_100355048 Ga0070664_1003550481 273
467 3300005578 Ga0068854_100081023 Ga0068854_1000810232 273
468 3300005614 Ga0068856_100022591 Ga0068856_1000225914 273
469 3300005615 Ga0070702_100232557 Ga0070702_1002325571 273
470 3300005616 Ga0068852_100084959 Ga0068852_1000849591 273
471 3300005617 Ga0068859_100020147 Ga0068859_1000201473 273
472 3300005617 Ga0068859_100085206 Ga0068859_1000852063 273
473 3300005617 Ga0068859_100450996 Ga0068859_1004509962 273
474 3300005618 Ga0068864_100003228 Ga0068864_10000322811 273
475 3300005618 Ga0068864_100021949 Ga0068864_1000219491 273
476 3300005618 Ga0068864_100399101 Ga0068864_1003991012 273
477 3300005719 Ga0068861_100120544 Ga0068861_1001205442 273
478 3300005719 Ga0068861_100438438 Ga0068861_1004384382 273
479 3300005840 Ga0068870_10061014 Ga0068870_100610142 273
480 3300005841 Ga0068863_100113289 Ga0068863_1001132892 273
481 3300005842 Ga0068858_100034796 Ga0068858_1000347962 273
482 3300005842 Ga0068858_100082453 Ga0068858_1000824533 273
483 3300005843 Ga0068860_100048156 Ga0068860_1000481563 273
484 3300005843 Ga0068860_100074102 Ga0068860_1000741023 273
485 3300005843 Ga0068860_100088822 Ga0068860_1000888224 273
486 3300005843 Ga0068860_100227081 Ga0068860_1002270812 273
487 3300006237 Ga0097621_100005536 Ga0097621_1000055362 273
488 3300006237 Ga0097621_100406621 Ga0097621_1004066211 273
489 3300006358 Ga0068871_100016720 Ga0068871_1000167202 273
490 3300006358 Ga0068871_100020429 Ga0068871_1000204293 273
491 3300006852 Ga0075433_10166003 Ga0075433_101660032 273
492 3300006852 Ga0075433_10214128 Ga0075433_102141282 273
493 3300006871 Ga0075434_100103051 Ga0075434_1001030512 273
494 3300006871 Ga0075434_100298664 Ga0075434_1002986642 273
495 3300006881 Ga0068865_100017990 Ga0068865_1000179902 273
496 3300006881 Ga0068865_100162468 Ga0068865_1001624682 273
497 3300006914 Ga0075436_100028599 Ga0075436_1000285993 273
498 3300006931 Ga0097620_100020148 Ga0097620_1000201484 273
499 3300006931 Ga0097620_100085205 Ga0097620_1000852053 273
500 3300006931 Ga0097620_100451034 Ga0097620_1004510342 273
501 3300009093 Ga0105240_10452654 Ga0105240_104526542 273
502 3300009094 Ga0111539_10191181 Ga0111539_101911812 273
503 3300009094 Ga0111539_10200139 Ga0111539_102001392 273
504 3300009098 Ga0105245_10099496 Ga0105245_100994963 273
505 3300009147 Ga0114129_10207665 Ga0114129_102076653 273
506 3300009148 Ga0105243_10238167 Ga0105243_102381672 273
507 3300009176 Ga0105242_10060633 Ga0105242_100606332 273
508 3300009176 Ga0105242_10130640 Ga0105242_101306402 273
509 3300009177 Ga0105248_10040235 Ga0105248_100402354 273
510 3300009177 Ga0105248_10161549 Ga0105248_101615492 273
511 3300009545 Ga0105237_10022887 Ga0105237_100228875 273
512 3300009545 Ga0105237_10093964 Ga0105237_100939643 273
513 3300011119 Ga0105246_10311504 Ga0105246_103115042 273
514 3300013296 Ga0157374_10064303 Ga0157374_100643033 273
515 3300013296 Ga0157374_10524654 Ga0157374_105246542 273
516 3300013297 Ga0157378_10008224 Ga0157378_100082246 273
517 3300013297 Ga0157378_10010432 Ga0157378_100104321 273
518 3300013297 Ga0157378_10757384 Ga0157378_107573841 273
519 3300013306 Ga0163162_10021352 Ga0163162_100213522 273
520 3300013306 Ga0163162_10112897 Ga0163162_101128972 273
521 3300013307 Ga0157372_10024822 Ga0157372_100248225 273
522 3300013308 Ga0157375_10213775 Ga0157375_102137752 273
523 3300013308 Ga0157375_10388977 Ga0157375_103889771 273
524 3300014325 Ga0163163_10028191 Ga0163163_100281912 273
525 3300014325 Ga0163163_10044443 Ga0163163_100444433 273
526 3300014325 Ga0163163_10198815 Ga0163163_101988151 273
527 3300014326 Ga0157380_10033291 Ga0157380_100332912 273
528 3300014745 Ga0157377_10080375 Ga0157377_100803751 273
529 3300014969 Ga0157376_10011232 Ga0157376_100112326 273
530 3300014969 Ga0157376_10154636 Ga0157376_101546361 273
531 3300017792 Ga0163161_10044122 Ga0163161_100441223 273
532 3300025899 Ga0207642_10055729 Ga0207642_100557292 273
533 3300025903 Ga0207680_10146329 Ga0207680_101463292 273
534 3300025906 Ga0207699_10261780 Ga0207699_102617801 273
535 3300025908 Ga0207643_10005560 Ga0207643_100055606 273
536 3300025908 Ga0207643_10043429 Ga0207643_100434292 273
537 3300025910 Ga0207684_10000023 Ga0207684_1000002343 273
538 3300025912 Ga0207707_10000006 Ga0207707_10000006157 273
539 3300025912 Ga0207707_10009795 Ga0207707_100097957 273
540 3300025913 Ga0207695_10451972 Ga0207695_104519722 273
541 3300025917 Ga0207660_10000971 Ga0207660_1000097115 273
542 3300025918 Ga0207662_10013770 Ga0207662_100137703 273
543 3300025921 Ga0207652_10000216 Ga0207652_1000021619 273
544 3300025922 Ga0207646_10006385 Ga0207646_100063852 273
545 3300025923 Ga0207681_10000204 Ga0207681_1000020411 273
546 3300025923 Ga0207681_10080535 Ga0207681_100805352 273
547 3300025925 Ga0207650_10004849 Ga0207650_100048492 273
548 3300025925 Ga0207650_10049137 Ga0207650_100491373 273
549 3300025931 Ga0207644_10094620 Ga0207644_100946202 273
550 3300025931 Ga0207644_10141475 Ga0207644_101414752 273
551 3300025933 Ga0207706_10629695 Ga0207706_106296951 273
552 3300025934 Ga0207686_10101472 Ga0207686_101014722 273
553 3300025936 Ga0207670_10106787 Ga0207670_101067872 273
554 3300025938 Ga0207704_10035226 Ga0207704_100352262 273
555 3300025940 Ga0207691_10006319 Ga0207691_100063192 273
556 3300025940 Ga0207691_10102248 Ga0207691_101022483 273
557 3300025941 Ga0207711_10144384 Ga0207711_101443842 273
558 3300025942 Ga0207689_10002977 Ga0207689_1000297713 273
559 3300025942 Ga0207689_10145370 Ga0207689_101453702 273
560 3300025945 Ga0207679_10111367 Ga0207679_101113672 273
561 3300025986 Ga0207658_10147216 Ga0207658_101472161 273
562 3300025986 Ga0207658_10191898 Ga0207658_101918982 273
563 3300026023 Ga0207677_10071687 Ga0207677_100716871 273
564 3300026035 Ga0207703_10089392 Ga0207703_100893922 273
565 3300026041 Ga0207639_10308262 Ga0207639_103082622 273
566 3300026078 Ga0207702_10055397 Ga0207702_100553973 273
567 3300026088 Ga0207641_10161155 Ga0207641_101611552 273
568 3300026089 Ga0207648_10007763 Ga0207648_100077632 273
569 3300026089 Ga0207648_10171358 Ga0207648_101713582 273
570 3300026095 Ga0207676_10003407 Ga0207676_100034076 273
571 3300026095 Ga0207676_10024106 Ga0207676_100241063 273
572 3300026095 Ga0207676_10066690 Ga0207676_100666903 273
573 3300026095 Ga0207676_10809076 Ga0207676_108090761 273
574 3300026118 Ga0207675_100173549 Ga0207675_1001735491 273
575 3300026142 Ga0207698_10239983 Ga0207698_102399832 273
576 3300027907 Ga0207428_10122322 Ga0207428_101223222 273
577 3300028379 Ga0268266_10072750 Ga0268266_100727502 273
578 3300037466 Ga0395898_0133927 Ga0395898_0133927_1087_1914 273
579 3300037466 Ga0395898_0289085 Ga0395898_0289085_36_866 273
580 3300048905 Ga0496102_0159003 Ga0496102_0159003_879_1709 273
581 3300048906 Ga0496103_0128839 Ga0496103_0128839_704_1534 273
582 3300048907 Ga0496104_0058907 Ga0496104_0058907_839_1669 273
583 3300048910 Ga0496107_0248463 Ga0496107_0248463_480_1310 273
584 3300048911 Ga0496108_0104517 Ga0496108_0104517_858_1688 273
585 3300048912 Ga0496109_0353874 Ga0496109_0353874_278_1108 273
586 3300048913 Ga0496110_0144319 Ga0496110_0144319_889_1719 273
587 3300048915 Ga0496112_0722773 Ga0496112_0722773_10_840 273
588 3300050507 nmdc:mga05p37_572771_c1 nmdc:mga05p37_572771_c1_442_1269 273
589 3300050512 nmdc:mga0n895_364995_c1 nmdc:mga0n895_364995_c1_379_1209 273
590 3300050512 nmdc:mga0n895_719518_c1 nmdc:mga0n895_719518_c1_58_888 273
591 3300050513 nmdc:mga0rr50_85345_c1 nmdc:mga0rr50_85345_c1_124_951 273
592 3300050514 nmdc:mga08x19_17997_c1 nmdc:mga08x19_17997_c1_169_999 273
593 3300050515 nmdc:mga0a205_16862_c1 nmdc:mga0a205_16862_c1_3857_4687 273
594 3300050515 nmdc:mga0a205_18763_c1 nmdc:mga0a205_18763_c1_384_1214 273
595 2162886006 SwRhRL3b_contig_1818041 SwRhRL3b_0309.00002090 274
596 2162886006 SwRhRL3b_contig_3769909 SwRhRL3b_0206.00000460 274
597 2162886006 SwRhRL3b_contig_657186 SwRhRL3b_0687.00000180 274
598 3300005289 Ga0065704_10195398 Ga0065704_101953981 274
599 3300005290 Ga0065712_10014908 Ga0065712_100149082 274
600 3300005293 Ga0065715_10040462 Ga0065715_100404622 274
601 3300005293 Ga0065715_10172415 Ga0065715_101724152 274
602 3300005330 Ga0070690_100074788 Ga0070690_1000747883 274
603 3300005331 Ga0070670_100022633 Ga0070670_1000226335 274
604 3300005331 Ga0070670_100222270 Ga0070670_1002222702 274
605 3300005334 Ga0068869_100012844 Ga0068869_1000128447 274
606 3300005336 Ga0070680_100068866 Ga0070680_1000688663 274
607 3300005337 Ga0070682_100000048 Ga0070682_10000004898 274
608 3300005353 Ga0070669_100023676 Ga0070669_1000236762 274
609 3300005354 Ga0070675_100109678 Ga0070675_1001096782 274
610 3300005354 Ga0070675_100165738 Ga0070675_1001657383 274
611 3300005364 Ga0070673_100495983 Ga0070673_1004959831 274
612 3300005438 Ga0070701_10055113 Ga0070701_100551132 274
613 3300005441 Ga0070700_100214623 Ga0070700_1002146232 274
614 3300005444 Ga0070694_100010819 Ga0070694_1000108193 274
615 3300005445 Ga0070708_100111246 Ga0070708_1001112462 274
616 3300005445 Ga0070708_100125261 Ga0070708_1001252612 274
617 3300005456 Ga0070678_100254832 Ga0070678_1002548322 274
618 3300005467 Ga0070706_100001203 Ga0070706_10000120319 274
619 3300005467 Ga0070706_100001891 Ga0070706_10000189115 274
620 3300005467 Ga0070706_100131249 Ga0070706_1001312493 274
621 3300005467 Ga0070706_100176850 Ga0070706_1001768502 274
622 3300005467 Ga0070706_100223324 Ga0070706_1002233242 274
623 3300005468 Ga0070707_100061112 Ga0070707_1000611123 274
624 3300005468 Ga0070707_100096224 Ga0070707_1000962243 274
625 3300005468 Ga0070707_100188487 Ga0070707_1001884871 274
626 3300005468 Ga0070707_100203006 Ga0070707_1002030062 274
627 3300005468 Ga0070707_100297633 Ga0070707_1002976332 274
628 3300005471 Ga0070698_100003095 Ga0070698_1000030958 274
629 3300005471 Ga0070698_100006823 Ga0070698_1000068233 274
630 3300005471 Ga0070698_100072848 Ga0070698_1000728481 274
631 3300005471 Ga0070698_100133050 Ga0070698_1001330502 274
632 3300005471 Ga0070698_100155226 Ga0070698_1001552262 274
633 3300005471 Ga0070698_100211080 Ga0070698_1002110801 274
634 3300005471 Ga0070698_100345531 Ga0070698_1003455311 274
635 3300005518 Ga0070699_100240871 Ga0070699_1002408712 274
636 3300005518 Ga0070699_100349043 Ga0070699_1003490432 274
637 3300005536 Ga0070697_100000089 Ga0070697_10000008956 274
638 3300005536 Ga0070697_100000839 Ga0070697_10000083918 274
639 3300005536 Ga0070697_100130094 Ga0070697_1001300941 274
640 3300005536 Ga0070697_100173736 Ga0070697_1001737362 274
641 3300005546 Ga0070696_100074018 Ga0070696_1000740183 274
642 3300005546 Ga0070696_100348814 Ga0070696_1003488142 274
643 3300005547 Ga0070693_100122238 Ga0070693_1001222382 274
644 3300005549 Ga0070704_100128477 Ga0070704_1001284771 274
645 3300005549 Ga0070704_100293918 Ga0070704_1002939182 274
646 3300005577 Ga0068857_100365267 Ga0068857_1003652672 274
647 3300005617 Ga0068859_100003464 Ga0068859_10000346410 274
648 3300005617 Ga0068859_100011486 Ga0068859_1000114866 274
649 3300005617 Ga0068859_100111118 Ga0068859_1001111183 274
650 3300005618 Ga0068864_100016132 Ga0068864_1000161323 274
651 3300005719 Ga0068861_100137352 Ga0068861_1001373522 274
652 3300005841 Ga0068863_100207162 Ga0068863_1002071622 274
653 3300005842 Ga0068858_100274411 Ga0068858_1002744112 274
654 3300005842 Ga0068858_100337666 Ga0068858_1003376662 274
655 3300005844 Ga0068862_100032812 Ga0068862_1000328123 274
656 3300005844 Ga0068862_100132249 Ga0068862_1001322492 274
657 3300006163 Ga0070715_10000020 Ga0070715_1000002017 274
658 3300006173 Ga0070716_100000003 Ga0070716_10000000373 274
659 3300006844 Ga0075428_100096541 Ga0075428_1000965412 274
660 3300006846 Ga0075430_100174292 Ga0075430_1001742922 274
661 3300006847 Ga0075431_100158453 Ga0075431_1001584533 274
662 3300006847 Ga0075431_100228684 Ga0075431_1002286843 274
663 3300006852 Ga0075433_10009960 Ga0075433_100099603 274
664 3300006871 Ga0075434_100019006 Ga0075434_1000190063 274
665 3300006871 Ga0075434_100435859 Ga0075434_1004358592 274
666 3300006880 Ga0075429_100046391 Ga0075429_1000463913 274
667 3300006914 Ga0075436_100000013 Ga0075436_10000001387 274
668 3300006914 Ga0075436_100188675 Ga0075436_1001886752 274
669 3300006931 Ga0097620_100003464 Ga0097620_10000346410 274
670 3300006931 Ga0097620_100011487 Ga0097620_1000114873 274
671 3300006931 Ga0097620_100111119 Ga0097620_1001111192 274
672 3300007076 Ga0075435_100011221 Ga0075435_1000112212 274
673 3300007076 Ga0075435_100288561 Ga0075435_1002885612 274
674 3300009093 Ga0105240_10091078 Ga0105240_100910783 274
675 3300009094 Ga0111539_10548888 Ga0111539_105488882 274
676 3300009094 Ga0111539_10778886 Ga0111539_107788862 274
677 3300009098 Ga0105245_10346381 Ga0105245_103463812 274
678 3300009098 Ga0105245_10460715 Ga0105245_104607152 274
679 3300009101 Ga0105247_10031353 Ga0105247_100313533 274
680 3300009147 Ga0114129_10082347 Ga0114129_100823473 274
681 3300009148 Ga0105243_10011106 Ga0105243_100111065 274
682 3300009176 Ga0105242_10164086 Ga0105242_101640861 274
683 3300009177 Ga0105248_10688533 Ga0105248_106885331 274
684 3300009545 Ga0105237_10455528 Ga0105237_104555281 274
685 3300009553 Ga0105249_10230726 Ga0105249_102307262 274
686 3300011119 Ga0105246_10210419 Ga0105246_102104192 274
687 3300013100 Ga0157373_10030718 Ga0157373_100307183 274
688 3300013100 Ga0157373_10459345 Ga0157373_104593451 274
689 3300013297 Ga0157378_10150749 Ga0157378_101507493 274
690 3300013307 Ga0157372_10006818 Ga0157372_100068185 274
691 3300014325 Ga0163163_10030744 Ga0163163_100307443 274
692 3300014326 Ga0157380_10032377 Ga0157380_100323773 274
693 3300014326 Ga0157380_10039429 Ga0157380_100394293 274
694 3300014326 Ga0157380_10070139 Ga0157380_100701392 274
695 3300025905 Ga0207685_10000008 Ga0207685_10000008157 274
696 3300025910 Ga0207684_10006564 Ga0207684_100065648 274
697 3300025910 Ga0207684_10052534 Ga0207684_100525343 274
698 3300025910 Ga0207684_10058417 Ga0207684_100584173 274
699 3300025910 Ga0207684_10091968 Ga0207684_100919683 274
700 3300025910 Ga0207684_10095810 Ga0207684_100958102 274
701 3300025910 Ga0207684_10215367 Ga0207684_102153672 274
702 3300025910 Ga0207684_10375097 Ga0207684_103750971 274
703 3300025910 Ga0207684_10465379 Ga0207684_104653791 274
704 3300025911 Ga0207654_10019532 Ga0207654_100195323 274
705 3300025913 Ga0207695_10067169 Ga0207695_100671693 274
706 3300025917 Ga0207660_10114181 Ga0207660_101141812 274
707 3300025918 Ga0207662_10030359 Ga0207662_100303593 274
708 3300025918 Ga0207662_10034077 Ga0207662_100340772 274
709 3300025918 Ga0207662_10071828 Ga0207662_100718281 274
710 3300025922 Ga0207646_10006845 Ga0207646_100068452 274
711 3300025922 Ga0207646_10021644 Ga0207646_100216443 274
712 3300025922 Ga0207646_10102666 Ga0207646_101026663 274
713 3300025922 Ga0207646_10151956 Ga0207646_101519561 274
714 3300025923 Ga0207681_10096040 Ga0207681_100960402 274
715 3300025925 Ga0207650_10052753 Ga0207650_100527532 274
716 3300025925 Ga0207650_10198819 Ga0207650_101988191 274
717 3300025935 Ga0207709_10007003 Ga0207709_100070034 274
718 3300025939 Ga0207665_10000003 Ga0207665_1000000346 274
719 3300025942 Ga0207689_10008554 Ga0207689_100085543 274
720 3300025942 Ga0207689_10020733 Ga0207689_100207337 274
721 3300026075 Ga0207708_10103922 Ga0207708_101039223 274
722 3300026088 Ga0207641_10178794 Ga0207641_101787941 274
723 3300026088 Ga0207641_10719672 Ga0207641_107196721 274
724 3300026089 Ga0207648_10107939 Ga0207648_101079392 274
725 3300026089 Ga0207648_10521719 Ga0207648_105217192 274
726 3300026095 Ga0207676_10016307 Ga0207676_100163074 274
727 3300026116 Ga0207674_10052773 Ga0207674_100527732 274
728 3300026121 Ga0207683_10209580 Ga0207683_102095802 274
729 3300027907 Ga0207428_10026037 Ga0207428_100260373 274
730 3300028380 Ga0268265_10021379 Ga0268265_100213792 274
731 3300028380 Ga0268265_10213512 Ga0268265_102135121 274
732 3300028381 Ga0268264_10154981 Ga0268264_101549812 274
733 3300031548 Ga0307408_100361613 Ga0307408_1003616132 274
734 3300032002 Ga0307416_100102294 Ga0307416_1001022942 274
735 3300032005 Ga0307411_10351205 Ga0307411_103512052 274
736 3300035091 Ga0373951_0001364 Ga0373951_0001364_2043_2873 274
737 3300044712 Ga0453684_0146100 Ga0453684_0146100_1332_2165 274
738 3300045051 Ga0451576_0275503 Ga0451576_0275503_568_1395 274
739 3300046525 Ga0495663_0000537 Ga0495663_0000537_11895_12722 274
740 3300046537 Ga0495598_0000409 Ga0495598_0000409_2014_2841 274
741 3300046539 Ga0495621_0000654 Ga0495621_0000654_3489_4316 274
742 3300047320 Ga0495672_0012033 Ga0495672_0012033_5175_6002 274
743 3300047471 Ga0495684_0093790 Ga0495684_0093790_296_1129 274
744 3300048907 Ga0496104_0220891 Ga0496104_0220891_712_1560 274
745 3300050508 nmdc:mga09592_158632_c1 nmdc:mga09592_158632_c1_219_1049 274
746 3300050508 nmdc:mga09592_47623_c1 nmdc:mga09592_47623_c1_1905_2744 274
747 3300050509 nmdc:mga0qj67_34559_c1 nmdc:mga0qj67_34559_c1_1348_2187 274
748 3300050509 nmdc:mga0qj67_76094_c1 nmdc:mga0qj67_76094_c1_1094_1927 274
749 3300050511 nmdc:mga08y16_45727_c1 nmdc:mga08y16_45727_c1_3583_4407 274
750 3300050512 nmdc:mga0n895_55020_c1 nmdc:mga0n895_55020_c1_1878_2708 274
751 3300050513 nmdc:mga0rr50_102_c1 nmdc:mga0rr50_102_c1_22446_23279 274
752 3300050514 nmdc:mga08x19_195689_c1 nmdc:mga08x19_195689_c1_244_1071 274
753 3300050514 nmdc:mga08x19_29_c1 nmdc:mga08x19_29_c1_122554_123387 274
754 3300050515 nmdc:mga0a205_138337_c1 nmdc:mga0a205_138337_c1_1331_2161 274
755 3300050515 nmdc:mga0a205_370482_c1 nmdc:mga0a205_370482_c1_65_895 274
756 3300050515 nmdc:mga0a205_8373_c1 nmdc:mga0a205_8373_c1_1560_2390 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

3

255

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.8035 3 259
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7544 3 259
2eba-assembly2.cif.gz_H crystal structure of the putative glutaryl-coa dehydrogenase from thermus thermophilus 0.5187 113 218
2r0n-assembly1.cif.gz_A the effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate 0.4875 113 220
5lnx-assembly1.cif.gz_B crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.4777 113 216
ID Description Score Start End Superfamily
af_F0JAT1_1_141_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.456 113 267 1.20.120.350
4ck0A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.4249 158 264 1.10.287.3610
af_Q9VDT1_256_405_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4235 111 251 1.20.140.10
af_F0JAT1_1_141_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.4208 113 267 1.20.120.350
3eomC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4093 113 263 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A6L4ZSN8-F1-model_v4 Phosphatidylglycerol:prolipoprotein diacylglycerol transferase 0.96 105 259 GO:0005886
GO:0008961
GO:0042158
AF-A0A7V8Z7K5-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9579 140 267 GO:0005886
GO:0008961
GO:0042158
AF-A0A2V8RZG5-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9436 1 263 GO:0005886
GO:0008961
GO:0042158
AF-A0A2V8R7A5-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9363 1 274 GO:0005886
GO:0008961
GO:0042158
AF-A0A7C4MWZ8-F1-model_v4 Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (EC 2.5.1.145) 0.9351 1 268 GO:0005886
GO:0008961
GO:0042158

Feature Viewer

pLDDT pTM Quality
86.77 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map