F479196

General Info

Members Datasets Scaffolds Average Seq Length
753 326 738 261

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100264061|Ga0068855_1002640612
Length 310
Sequence MTTASAGQSLSGPERASQHSDQDRKIVRPYGDTTGDGRVQLSFTLPVPYGTSEQRARAEGAALQLAAKMGMDPAMVVHAKGMGPDFTFFIVYGRVAHLVDLSEVIVAEREFPLLPAAEINLRIRSALGRKLVVVGACIGTDAHTVGIDAILNVKGHAGEKGLEYYREMRIVNLGAQVAVPDLVARARAEQADAVLVSQVVTQRDAHLNNTREMAAAFRAAGPPQPLLVVGGPRFAPGTEAGLGVDKIFGKGTGPGEVASYLAHALAPASAKAAALPGLTSDEGARREGGASKRPEHELNSTAGAGGSGGR

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2643221679 Angustibacter sp. Root456 Isolate Unclassified
3 2643221711 Terrabacter sp. Root85 Isolate Unclassified
4 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
5 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
6 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
7 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
8 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
9 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
10 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
11 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
12 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
13 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
14 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
155 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
175 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
239 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
240 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
271 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
272 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
325 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
326 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.21
Metatranscriptomes 0.8
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 5.84
Rhizosphere 92.03
Stem 0
Stem Tuber 0
Unclassified 1.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1005059 3300000549 Bacteria 1685
2 JGI25406J46586_10011340 3300003203 Bacteria 3914
3 JGI25404J52841_10004335 3300003659 Bacteria 2867
4 Ga0070658_10010707 3300005327 Bacteria 7347
5 Ga0070658_10059220 3300005327 Bacteria 3119
6 Ga0070658_10123451 3300005327 Bacteria 2153
7 Ga0070676_10124606 3300005328 Bacteria 1621
8 Ga0070683_100053379 3300005329 Bacteria 3745
9 Ga0070690_100028460 3300005330 Bacteria 3462
10 Ga0070682_100196382 3300005337 Bacteria 1420
11 Ga0070689_100111574 3300005340 Bacteria 2175
12 Ga0070687_100164203 3300005343 Bacteria 1316
13 Ga0070661_100046183 3300005344 Bacteria 3186
14 Ga0070692_10042979 3300005345 Bacteria 2323
15 Ga0070692_10161264 3300005345 Bacteria 1285
16 Ga0070671_100024167 3300005355 Bacteria 4973
17 Ga0070674_100314731 3300005356 Bacteria 1253
18 Ga0070674_100353782 3300005356 Bacteria 1187
19 Ga0070673_100102503 3300005364 Bacteria 2359
20 Ga0070688_100035000 3300005365 Bacteria 3048
21 Ga0070659_100127615 3300005366 Bacteria 2064
22 Ga0070659_100129965 3300005366 Bacteria 2045
23 Ga0070659_100704001 3300005366 Bacteria 874
24 Ga0070667_100051490 3300005367 Bacteria 3472
25 Ga0070709_10000198 3300005434 Bacteria 38521
26 Ga0070709_10443742 3300005434 Bacteria 976
27 Ga0070714_100003316 3300005435 Bacteria 12006
28 Ga0070714_100008683 3300005435 Bacteria 7945
29 Ga0070714_100179288 3300005435 Bacteria 1927
30 Ga0070714_100283418 3300005435 Bacteria 1540
31 Ga0070713_100025012 3300005436 Bacteria 4661
32 Ga0070713_100233704 3300005436 Bacteria 1672
33 Ga0070710_10003510 3300005437 Bacteria 7431
34 Ga0070710_10049041 3300005437 Bacteria 2360
35 Ga0070710_10082152 3300005437 Bacteria 1883
36 Ga0070710_10117965 3300005437 Bacteria 1602
37 Ga0070710_10204129 3300005437 Bacteria 1249
38 Ga0070711_100009129 3300005439 Bacteria 6093
39 Ga0070711_100039016 3300005439 Bacteria 3196
40 Ga0070711_100323697 3300005439 Bacteria 1232
41 Ga0070705_100001031 3300005440 Bacteria 15524
42 Ga0070705_100106053 3300005440 Bacteria 1785
43 Ga0070708_100181706 3300005445 Bacteria 1966
44 Ga0070708_100853291 3300005445 Bacteria 855
45 Ga0070678_100491116 3300005456 Bacteria 1082
46 Ga0070681_10078952 3300005458 Bacteria 3248
47 Ga0070706_100005940 3300005467 Bacteria 11542
48 Ga0070706_100016022 3300005467 Bacteria 6923
49 Ga0070706_100056829 3300005467 Bacteria 3610
50 Ga0070706_100132282 3300005467 Bacteria 2328
51 Ga0070707_100087282 3300005468 Bacteria 3017
52 Ga0070707_100144402 3300005468 Bacteria 2316
53 Ga0070698_100001515 3300005471 Bacteria 25747
54 Ga0070698_100001616 3300005471 Bacteria 25085
55 Ga0070698_100109039 3300005471 Bacteria 2735
56 Ga0070699_100000578 3300005518 Bacteria 34737
57 Ga0070699_100325164 3300005518 Bacteria 1383
58 Ga0070699_100418972 3300005518 Bacteria 1212
59 Ga0070679_100074346 3300005530 Bacteria 3389
60 Ga0070679_100190272 3300005530 Bacteria 2021
61 Ga0070679_100724094 3300005530 Bacteria 938
62 Ga0070684_100079780 3300005535 Bacteria 2894
63 Ga0070684_100159237 3300005535 Bacteria 2047
64 Ga0070684_100215054 3300005535 Bacteria 1753
65 Ga0070684_100264206 3300005535 Bacteria 1575
66 Ga0070697_100003261 3300005536 Bacteria 12465
67 Ga0070697_100549754 3300005536 Bacteria 1012
68 Ga0068853_100339466 3300005539 Bacteria 1395
69 Ga0070686_100048347 3300005544 Bacteria 2694
70 Ga0070693_100116170 3300005547 Bacteria 1654
71 Ga0070704_100143008 3300005549 Bacteria 1870
72 Ga0068855_100264061 3300005563 Bacteria 1917
73 Ga0070664_100071861 3300005564 Bacteria 2966
74 Ga0070664_100353640 3300005564 Bacteria 1337
75 Ga0068857_100180481 3300005577 Bacteria 1921
76 Ga0070702_100020323 3300005615 Bacteria 3476
77 Ga0070702_100077130 3300005615 Bacteria 1985
78 Ga0070702_100511370 3300005615 Bacteria 884
79 Ga0068852_100216176 3300005616 Bacteria 1821
80 Ga0068859_100260772 3300005617 Bacteria 1824
81 Ga0068864_100107526 3300005618 Bacteria 2481
82 Ga0068864_100356716 3300005618 Bacteria 1381
83 Ga0068863_100030070 3300005841 Bacteria 5188
84 Ga0068858_100027567 3300005842 Bacteria 5277
85 Ga0068858_100090185 3300005842 Bacteria 2852
86 Ga0068858_100892930 3300005842 Bacteria 869
87 Ga0081455_10004970 3300005937 Bacteria 14708
88 Ga0081540_1000074 3300005983 Bacteria 107172
89 Ga0081540_1001512 3300005983 Bacteria 19996
90 Ga0081539_10000421 3300005985 Bacteria 90163
91 Ga0081539_10044133 3300005985 Bacteria 2576
92 Ga0070717_10000010 3300006028 Bacteria 283501
93 Ga0070717_10082257 3300006028 Bacteria 2705
94 Ga0070717_10117030 3300006028 Bacteria 2279
95 Ga0070717_10298981 3300006028 Bacteria 1431
96 Ga0070717_10506124 3300006028 Bacteria 1092
97 Ga0070715_10001650 3300006163 Bacteria 6609
98 Ga0070715_10004966 3300006163 Bacteria 4407
99 Ga0070716_100000184 3300006173 Bacteria 24485
100 Ga0070716_100017725 3300006173 Bacteria 3697
101 Ga0070716_100049276 3300006173 Bacteria 2385
102 Ga0070712_100054075 3300006175 Bacteria 2805
103 Ga0070712_100349679 3300006175 Bacteria 1209
104 Ga0075428_100050071 3300006844 Bacteria 4582
105 Ga0075433_10043688 3300006852 Bacteria 3891
106 Ga0075434_100037030 3300006871 Bacteria 4828
107 Ga0075429_100015337 3300006880 Bacteria 6640
108 Ga0075429_100268463 3300006880 Bacteria 1494
109 Ga0068865_100135885 3300006881 Bacteria 1848
110 Ga0075436_100055144 3300006914 Bacteria 2744
111 Ga0075436_100124083 3300006914 Bacteria 1808
112 Ga0097620_100260786 3300006931 Bacteria 1824
113 Ga0075435_100109014 3300007076 Bacteria 2301
114 Ga0075435_100229163 3300007076 Bacteria 1578
115 Ga0075435_100449846 3300007076 Bacteria 1111
116 Ga0099795_10080728 3300007788 Bacteria 1244
117 Ga0105245_10072114 3300009098 Bacteria 3137
118 Ga0105245_10100901 3300009098 Bacteria 2671
119 Ga0105245_10151002 3300009098 Bacteria 2197
120 Ga0105247_10028545 3300009101 Bacteria 3377
121 Ga0114129_10043767 3300009147 Bacteria 6300
122 Ga0105243_10018288 3300009148 Bacteria 5307
123 Ga0105243_10029708 3300009148 Bacteria 4205
124 Ga0105243_10373435 3300009148 Bacteria 1316
125 Ga0105241_10020146 3300009174 Bacteria 4927
126 Ga0105241_10405854 3300009174 Bacteria 1196
127 Ga0105242_10036596 3300009176 Bacteria 3939
128 Ga0105242_10059768 3300009176 Bacteria 3129
129 Ga0105248_10078501 3300009177 Bacteria 3711
130 Ga0105237_10324604 3300009545 Bacteria 1543
131 Ga0105238_10033058 3300009551 Bacteria 5263
132 Ga0105238_10126613 3300009551 Bacteria 2533
133 Ga0105238_10391132 3300009551 Bacteria 1383
134 Ga0105238_10472690 3300009551 Bacteria 1252
135 Ga0105238_10864944 3300009551 Bacteria 921
136 Ga0105249_10033268 3300009553 Bacteria 4667
137 Ga0105249_10234369 3300009553 Bacteria 1812
138 Ga0105246_10003753 3300011119 Bacteria 9204
139 Ga0105246_10018223 3300011119 Bacteria 4474
140 Ga0157371_10027044 3300013102 Bacteria 4164
141 Ga0157371_10032175 3300013102 Bacteria 3776
142 Ga0157370_10191124 3300013104 Bacteria 1900
143 Ga0157369_10118212 3300013105 Bacteria 2814
144 Ga0157369_10365266 3300013105 Bacteria 1498
145 Ga0157369_10624857 3300013105 Bacteria 1111
146 Ga0157374_10528145 3300013296 Bacteria 1186
147 Ga0157378_10013756 3300013297 Bacteria 7078
148 Ga0157378_10048437 3300013297 Bacteria 3779
149 Ga0163162_10394642 3300013306 Bacteria 1516
150 Ga0157372_11077247 3300013307 Bacteria 930
151 Ga0157375_10048920 3300013308 Bacteria 4139
152 Ga0157375_10094505 3300013308 Bacteria 3058
153 Ga0157375_10450910 3300013308 Bacteria 1452
154 Ga0163163_10042895 3300014325 Bacteria 4433
155 Ga0163163_10061786 3300014325 Bacteria 3712
156 Ga0163163_10079433 3300014325 Bacteria 3279
157 Ga0157380_10545556 3300014326 Bacteria 1136
158 Ga0157380_10904340 3300014326 Bacteria 909
159 Ga0157377_10015569 3300014745 Bacteria 3895
160 Ga0157379_10209688 3300014968 Bacteria 1763
161 Ga0157376_10097371 3300014969 Bacteria 2563
162 Ga0157376_10467377 3300014969 Bacteria 1234
163 Ga0206350_10114685 3300020080 Bacteria 2569
164 Ga0206353_10923945 3300020082 Bacteria 1837
165 Ga0206353_11135489 3300020082 Bacteria 2017
166 Ga0206353_11320916 3300020082 Bacteria 2018
167 Ga0213875_10000246 3300021388 Bacteria 54368
168 Ga0213875_10015906 3300021388 Bacteria 3655
169 Ga0224712_10029195 3300022467 Bacteria 1978
170 Ga0224712_10031501 3300022467 Bacteria 1924
171 Ga0207692_10000151 3300025898 Bacteria 21926
172 Ga0207692_10000912 3300025898 Bacteria 10677
173 Ga0207692_10053047 3300025898 Bacteria 2063
174 Ga0207692_10127797 3300025898 Bacteria 1431
175 Ga0207692_10175423 3300025898 Bacteria 1245
176 Ga0207642_10020865 3300025899 Bacteria 2568
177 Ga0207710_10062505 3300025900 Bacteria 1692
178 Ga0207688_10010067 3300025901 Bacteria 5142
179 Ga0207688_10160785 3300025901 Bacteria 1331
180 Ga0207647_10051605 3300025904 Bacteria 2541
181 Ga0207685_10043655 3300025905 Bacteria 1691
182 Ga0207699_10000357 3300025906 Bacteria 24151
183 Ga0207699_10008137 3300025906 Bacteria 5161
184 Ga0207699_10020192 3300025906 Bacteria 3565
185 Ga0207699_10119325 3300025906 Bacteria 1703
186 Ga0207699_10210466 3300025906 Bacteria 1322
187 Ga0207699_10269658 3300025906 Bacteria 1179
188 Ga0207645_10030978 3300025907 Bacteria 3445
189 Ga0207684_10005619 3300025910 Bacteria 11532
190 Ga0207684_10045396 3300025910 Bacteria 3728
191 Ga0207684_10063805 3300025910 Bacteria 3127
192 Ga0207684_10110666 3300025910 Bacteria 2351
193 Ga0207684_10290658 3300025910 Bacteria 1409
194 Ga0207707_10291145 3300025912 Bacteria 1413
195 Ga0207693_10016510 3300025915 Bacteria 5899
196 Ga0207693_10101953 3300025915 Bacteria 2251
197 Ga0207663_10003484 3300025916 Bacteria 7702
198 Ga0207663_10011212 3300025916 Bacteria 4805
199 Ga0207663_10131254 3300025916 Bacteria 1731
200 Ga0207663_10222518 3300025916 Bacteria 1374
201 Ga0207657_10010958 3300025919 Bacteria 9017
202 Ga0207652_10198611 3300025921 Bacteria 1805
203 Ga0207652_10434379 3300025921 Bacteria 1184
204 Ga0207646_10033173 3300025922 Bacteria 4672
205 Ga0207646_10156719 3300025922 Bacteria 2054
206 Ga0207646_10314678 3300025922 Bacteria 1415
207 Ga0207694_10072412 3300025924 Bacteria 2694
208 Ga0207659_10488413 3300025926 Bacteria 1041
209 Ga0207687_10109198 3300025927 Bacteria 2049
210 Ga0207700_10000404 3300025928 Bacteria 25243
211 Ga0207700_10047188 3300025928 Bacteria 3191
212 Ga0207700_10225360 3300025928 Bacteria 1591
213 Ga0207700_10250710 3300025928 Bacteria 1512
214 Ga0207700_10258258 3300025928 Bacteria 1491
215 Ga0207700_10354516 3300025928 Bacteria 1278
216 Ga0207700_10523641 3300025928 Bacteria 1051
217 Ga0207700_10551826 3300025928 Bacteria 1023
218 Ga0207664_10000484 3300025929 Bacteria 28320
219 Ga0207664_10000644 3300025929 Bacteria 24188
220 Ga0207664_10001557 3300025929 Bacteria 15047
221 Ga0207664_10015225 3300025929 Bacteria 5577
222 Ga0207664_10020568 3300025929 Bacteria 4894
223 Ga0207664_10044030 3300025929 Bacteria 3493
224 Ga0207664_10094408 3300025929 Bacteria 2458
225 Ga0207664_10134335 3300025929 Bacteria 2086
226 Ga0207664_10207160 3300025929 Bacteria 1695
227 Ga0207664_10251096 3300025929 Bacteria 1544
228 Ga0207664_10349597 3300025929 Bacteria 1308
229 Ga0207664_10650528 3300025929 Bacteria 947
230 Ga0207690_10011248 3300025932 Bacteria 5344
231 Ga0207706_10021574 3300025933 Bacteria 5782
232 Ga0207686_10211175 3300025934 Bacteria 1395
233 Ga0207665_10000042 3300025939 Bacteria 82783
234 Ga0207665_10004055 3300025939 Bacteria 9776
235 Ga0207665_10005391 3300025939 Bacteria 8540
236 Ga0207665_10105239 3300025939 Bacteria 1976
237 Ga0207691_10021065 3300025940 Bacteria 6160
238 Ga0207711_10095258 3300025941 Bacteria 2625
239 Ga0207689_10018569 3300025942 Bacteria 5866
240 Ga0207661_10111374 3300025944 Bacteria 2316
241 Ga0207667_10216254 3300025949 Bacteria 1964
242 Ga0207668_10440511 3300025972 Bacteria 1110
243 Ga0207658_10067006 3300025986 Bacteria 2703
244 Ga0207703_10089636 3300026035 Bacteria 2583
245 Ga0207703_10332427 3300026035 Bacteria 1394
246 Ga0207678_10000752 3300026067 Bacteria 29608
247 Ga0207678_10401187 3300026067 Bacteria 1187
248 Ga0207708_10030540 3300026075 Bacteria 4086
249 Ga0207702_10026614 3300026078 Bacteria 4802
250 Ga0207702_10258128 3300026078 Bacteria 1640
251 Ga0207702_10345493 3300026078 Bacteria 1422
252 Ga0207702_10460060 3300026078 Bacteria 1236
253 Ga0207641_10046249 3300026088 Bacteria 3668
254 Ga0207676_10091777 3300026095 Bacteria 2496
255 Ga0207676_10205945 3300026095 Bacteria 1741
256 Ga0207674_10061630 3300026116 Bacteria 3789
257 Ga0207675_100020030 3300026118 Bacteria 6242
258 Ga0207683_10012993 3300026121 Bacteria 7106
259 Ga0207683_10090790 3300026121 Bacteria 2721
260 Ga0207683_10259273 3300026121 Bacteria 1587
261 Ga0207428_10114133 3300027907 Bacteria 2076
262 Ga0268266_10338612 3300028379 Bacteria 1412
263 Ga0268265_10032110 3300028380 Bacteria 3800
264 Ga0268264_10797672 3300028381 Bacteria 943
265 Ga0265326_10000008 3300028558 Bacteria 210923
266 Ga0265319_1001253 3300028563 Bacteria 15479
267 Ga0265334_10000152 3300028573 Bacteria 42908
268 Ga0265336_10013374 3300028666 Bacteria 2738
269 Ga0265336_10013987 3300028666 Bacteria 2667
270 Ga0265338_10001861 3300028800 Bacteria 33146
271 Ga0265338_10008474 3300028800 Bacteria 12479
272 Ga0265324_10003605 3300029957 Bacteria 7285
273 Ga0265320_10073255 3300031240 Bacteria 1610
274 Ga0265327_10014535 3300031251 Bacteria 5143
275 Ga0307513_10015320 3300031456 Bacteria 9298
276 Ga0307408_100640688 3300031548 Bacteria 949
277 Ga0316575_10005740 3300031665 Bacteria 4432
278 Ga0316575_10062298 3300031665 Bacteria 1491
279 Ga0316579_10025305 3300031691 Bacteria 2678
280 Ga0316579_10036343 3300031691 Bacteria 2272
281 Ga0316576_10156747 3300031727 Bacteria 1716
282 Ga0316578_10003554 3300031728 Bacteria 7158
283 Ga0307405_10288906 3300031731 Bacteria 1238
284 Ga0307405_10320123 3300031731 Bacteria 1184
285 Ga0307413_10032019 3300031824 Bacteria 2975
286 Ga0307413_10071465 3300031824 Bacteria 2187
287 Ga0307413_10289124 3300031824 Bacteria 1237
288 Ga0307410_10006399 3300031852 Bacteria 6354
289 Ga0307406_10042549 3300031901 Bacteria 2836
290 Ga0307407_10018572 3300031903 Bacteria 3520
291 Ga0307407_10129827 3300031903 Bacteria 1610
292 Ga0307407_10158111 3300031903 Bacteria 1480
293 Ga0307407_10432911 3300031903 Bacteria 951
294 Ga0307412_10083650 3300031911 Bacteria 2213
295 Ga0307412_10377997 3300031911 Bacteria 1146
296 Ga0307409_100017289 3300031995 Bacteria 4802
297 Ga0307409_100026214 3300031995 Bacteria 4106
298 Ga0307409_100050997 3300031995 Bacteria 3164
299 Ga0307409_100054320 3300031995 Bacteria 3084
300 Ga0307409_100245395 3300031995 Bacteria 1633
301 Ga0307409_100289150 3300031995 Bacteria 1519
302 Ga0307409_100342953 3300031995 Bacteria 1406
303 Ga0307409_100674669 3300031995 Bacteria 1030
304 Ga0307416_100179539 3300032002 Bacteria 1982
305 Ga0307416_100280868 3300032002 Bacteria 1641
306 Ga0307416_100349572 3300032002 Bacteria 1495
307 Ga0307416_100790717 3300032002 Bacteria 1044
308 Ga0307414_10382740 3300032004 Bacteria 1217
309 Ga0307414_10838568 3300032004 Bacteria 840
310 Ga0307411_10272949 3300032005 Bacteria 1342
311 Ga0307415_100034933 3300032126 Bacteria 3278
312 Ga0307415_100155672 3300032126 Bacteria 1764
313 Ga0307415_100155731 3300032126 Bacteria 1764
314 Ga0316583_10018043 3300032133 Bacteria 2534
315 Ga0316580_10010623 3300032139 Bacteria 2787
316 Ga0316580_10038578 3300032139 Bacteria 1476
317 Ga0373926_0018669 3300035083 Bacteria 2387
318 Ga0373926_0056493 3300035083 Bacteria 1424
319 Ga0373928_0004087 3300035084 Bacteria 2781
320 Ga0373934_0000025 3300035086 Bacteria 49119
321 Ga0373934_0012177 3300035086 Bacteria 3246
322 Ga0373934_0019874 3300035086 Bacteria 2581
323 Ga0373934_0020746 3300035086 Bacteria 2527
324 Ga0373934_0036126 3300035086 Bacteria 1945
325 Ga0373944_0000589 3300035089 Bacteria 8631
326 Ga0373944_0012090 3300035089 Bacteria 2375
327 Ga0373944_0020636 3300035089 Bacteria 1900
328 Ga0373949_0011519 3300035090 Bacteria 1949
329 Ga0373951_0017421 3300035091 Bacteria 1625
330 Ga0373923_0000101 3300035111 Bacteria 15127
331 Ga0373923_0033509 3300035111 Bacteria 2080
332 Ga0373923_0045546 3300035111 Bacteria 1822
333 Ga0373923_0098372 3300035111 Bacteria 1287
334 Ga0373936_0000233 3300035113 Bacteria 18417
335 Ga0373936_0013843 3300035113 Bacteria 3079
336 Ga0373945_0009044 3300035116 Bacteria 3254
337 Ga0373945_0042664 3300035116 Bacteria 1644
338 Ga0373953_0000883 3300035117 Bacteria 8399
339 Ga0373953_0004753 3300035117 Bacteria 4356
340 Ga0373953_0051884 3300035117 Bacteria 1659
341 Ga0373954_0012176 3300035118 Bacteria 3825
342 Ga0373954_0022351 3300035118 Bacteria 2868
343 Ga0373956_0000119 3300035119 Bacteria 27324
344 Ga0373956_0000526 3300035119 Bacteria 15694
345 Ga0373956_0014711 3300035119 Bacteria 3271
346 Ga0373956_0050766 3300035119 Bacteria 1863
347 Ga0373956_0073902 3300035119 Bacteria 1558
348 Ga0373957_0000264 3300035120 Bacteria 13148
349 Ga0373957_0068850 3300035120 Bacteria 1381
350 Ga0373960_0065657 3300035121 Bacteria 1110
351 Ga0373943_0018410 3300035170 Bacteria 3208
352 Ga0373946_0000171 3300035171 Bacteria 19714
353 Ga0373946_0005624 3300035171 Bacteria 4527
354 Ga0373946_0081095 3300035171 Bacteria 1420
355 Ga0373955_0000149 3300035172 Bacteria 27794
356 Ga0373955_0001986 3300035172 Bacteria 8818
357 Ga0373955_0013651 3300035172 Bacteria 3935
358 Ga0373955_0041344 3300035172 Bacteria 2470
359 Ga0373955_0130680 3300035172 Bacteria 1465
360 Ga0373955_0140804 3300035172 Bacteria 1414
361 Ga0373955_0192205 3300035172 Bacteria 1214
362 Ga0373955_0245265 3300035172 Bacteria 1073
363 Ga0316574_0002178 3300035398 Bacteria 9713
364 Ga0316574_0004825 3300035398 Bacteria 7135
365 Ga0373924_0000318 3300035410 Bacteria 14839
366 Ga0373924_0009072 3300035410 Bacteria 3638
367 Ga0373931_0125129 3300035691 Bacteria 1473
368 Ga0373931_0371266 3300035691 Bacteria 900
369 Ga0373935_0011145 3300035692 Bacteria 5397
370 Ga0373935_0030337 3300035692 Bacteria 3350
371 Ga0373935_0091211 3300035692 Bacteria 1995
372 Ga0373935_0110186 3300035692 Bacteria 1826
373 Ga0373927_0004565 3300035695 Bacteria 9671
374 Ga0373927_0016408 3300035695 Bacteria 4884
375 Ga0373927_0053687 3300035695 Bacteria 2607
376 Ga0373933_0000001 3300035724 Bacteria 228234
377 Ga0373933_0004044 3300035724 Bacteria 8080
378 Ga0373933_0014063 3300035724 Bacteria 4442
379 Ga0373933_0017823 3300035724 Bacteria 3986
380 Ga0373933_0053913 3300035724 Bacteria 2408
381 Ga0373933_0074097 3300035724 Bacteria 2075
382 Ga0373933_0175918 3300035724 Bacteria 1363
383 Ga0373947_0000001 3300035725 Bacteria 510932
384 Ga0373947_0001122 3300035725 Bacteria 16437
385 Ga0373947_0004746 3300035725 Bacteria 7970
386 Ga0373947_0274101 3300035725 Bacteria 1120
387 Ga0373937_0003722 3300036401 Bacteria 12886
388 Ga0373937_0008016 3300036401 Bacteria 9155
389 Ga0373937_0027495 3300036401 Bacteria 5143
390 Ga0373937_0044906 3300036401 Bacteria 4037
391 Ga0373937_0057483 3300036401 Bacteria 3573
392 Ga0373937_0112254 3300036401 Bacteria 2535
393 Ga0373937_0128272 3300036401 Bacteria 2367
394 Ga0373937_0378438 3300036401 Bacteria 1342
395 Ga0373937_0584369 3300036401 Bacteria 1060
396 Ga0316582_0000920 3300036647 Bacteria 12107
397 Ga0316582_0003300 3300036647 Bacteria 7873
398 Ga0316584_0004008 3300036712 Bacteria 9690
399 Ga0373925_0007907 3300037068 Bacteria 7741
400 Ga0373925_0022896 3300037068 Bacteria 4558
401 Ga0373925_0027209 3300037068 Bacteria 4187
402 Ga0373925_0052242 3300037068 Bacteria 3053
403 Ga0373925_0145079 3300037068 Bacteria 1860
404 Ga0373925_0230267 3300037068 Bacteria 1481
405 Ga0395899_0211122 3300037312 Bacteria 1349
406 Ga0395899_0221190 3300037312 Bacteria 1312
407 Ga0395900_0191147 3300037418 Bacteria 2076
408 Ga0395898_0078229 3300037466 Bacteria 3191
409 Ga0395898_0158606 3300037466 Bacteria 2164
410 Ga0436364_0025604 3300037853 Bacteria 2134
411 Ga0436364_0106996 3300037853 Bacteria 14379
412 Ga0436364_0330965 3300037853 Bacteria 247749
413 Ga0395901_0011041 3300038443 Bacteria 9150
414 Ga0395901_0055761 3300038443 Bacteria 4110
415 Ga0395901_0582159 3300038443 Bacteria 1131
416 Ga0436360_0348714 3300039438 Bacteria 1514
417 Ga0436363_0964495 3300039450 Bacteria 1514
418 Ga0451853_0784232 3300041512 Bacteria 932
419 Ga0466972_0148186 3300044658 Bacteria 1104
420 Ga0466965_0070061 3300044683 Bacteria 1762
421 Ga0466963_0058036 3300044694 Bacteria 2579
422 Ga0466963_0077566 3300044694 Bacteria 2245
423 Ga0466964_0032567 3300044706 Bacteria 2072
424 Ga0466971_0116137 3300044719 Bacteria 1237
425 Ga0466971_0259779 3300044719 Bacteria 828
426 Ga0466968_0237417 3300044735 Bacteria 863
427 Ga0466970_0039347 3300044765 Bacteria 2509
428 Ga0466970_0064875 3300044765 Bacteria 1959
429 Ga0466957_0048984 3300044842 Bacteria 2568
430 Ga0466957_0093478 3300044842 Bacteria 1887
431 Ga0466957_0171524 3300044842 Bacteria 1413
432 Ga0466957_0424456 3300044842 Bacteria 913
433 Ga0466960_0006004 3300044901 Bacteria 4849
434 Ga0466960_0078548 3300044901 Bacteria 1657
435 Ga0466960_0097842 3300044901 Bacteria 1506
436 Ga0466960_0309215 3300044901 Bacteria 892
437 Ga0466959_0076439 3300045049 Bacteria 2417
438 Ga0466958_0060857 3300045836 Bacteria 2299
439 Ga0466958_0103389 3300045836 Bacteria 1773
440 Ga0466958_0197067 3300045836 Bacteria 1281
441 Ga0466958_0324865 3300045836 Bacteria 989
442 Ga0466967_0012950 3300045976 Bacteria 6415
443 Ga0466967_0035867 3300045976 Bacteria 4226
444 Ga0466967_0126443 3300045976 Bacteria 2368
445 Ga0466967_0154932 3300045976 Bacteria 2145
446 Ga0466967_0155764 3300045976 Bacteria 2140
447 Ga0466967_0516811 3300045976 Bacteria 1173
448 Ga0495592_0000002 3300046454 Bacteria 209491
449 Ga0495592_0011520 3300046454 Bacteria 6693
450 Ga0495592_0025397 3300046454 Bacteria 4497
451 Ga0495592_0028991 3300046454 Bacteria 4190
452 Ga0495592_0115879 3300046454 Bacteria 1891
453 Ga0495603_0005339 3300046455 Bacteria 7664
454 Ga0495629_0001549 3300046459 Bacteria 18051
455 Ga0495629_0146547 3300046459 Bacteria 1642
456 Ga0495641_0006847 3300046461 Bacteria 7292
457 Ga0495641_0007210 3300046461 Bacteria 6999
458 Ga0495641_0075303 3300046461 Bacteria 1513
459 Ga0495651_0000002 3300046462 Bacteria 209492
460 Ga0495651_0004885 3300046462 Bacteria 10252
461 Ga0495651_0016351 3300046462 Bacteria 5745
462 Ga0495651_0018305 3300046462 Bacteria 5424
463 Ga0495651_0023699 3300046462 Bacteria 4772
464 Ga0495651_0040760 3300046462 Bacteria 3609
465 Ga0495651_0073159 3300046462 Bacteria 2602
466 Ga0495651_0224041 3300046462 Bacteria 1299
467 Ga0495653_0025465 3300046463 Bacteria 4755
468 Ga0495653_0035895 3300046463 Bacteria 3909
469 Ga0495653_0061535 3300046463 Bacteria 2840
470 Ga0495653_0071947 3300046463 Bacteria 2583
471 Ga0495580_0001403 3300046472 Bacteria 21155
472 Ga0495582_0001716 3300046473 Bacteria 12362
473 Ga0495582_0046302 3300046473 Bacteria 2395
474 Ga0495582_0051181 3300046473 Bacteria 2277
475 Ga0495639_0008056 3300046475 Bacteria 4524
476 Ga0495639_0053636 3300046475 Bacteria 1837
477 Ga0495639_0103619 3300046475 Bacteria 1345
478 Ga0495662_0020455 3300046476 Bacteria 3201
479 Ga0495662_0048557 3300046476 Bacteria 2049
480 Ga0495662_0097420 3300046476 Bacteria 1438
481 Ga0495664_0021110 3300046477 Bacteria 3761
482 Ga0495664_0026244 3300046477 Bacteria 3393
483 Ga0495664_0032158 3300046477 Bacteria 3077
484 Ga0495664_0048897 3300046477 Bacteria 2510
485 Ga0495594_0050795 3300046499 Bacteria 2281
486 Ga0495594_0092479 3300046499 Bacteria 1696
487 Ga0495608_0000118 3300046511 Bacteria 56564
488 Ga0495608_0013978 3300046511 Bacteria 5568
489 Ga0495608_0054487 3300046511 Bacteria 2643
490 Ga0495608_0065521 3300046511 Bacteria 2379
491 Ga0495608_0161709 3300046511 Bacteria 1423
492 Ga0495618_0003574 3300046514 Bacteria 9636
493 Ga0495618_0020187 3300046514 Bacteria 4102
494 Ga0495618_0064378 3300046514 Bacteria 2329
495 Ga0495618_0071667 3300046514 Bacteria 2204
496 Ga0495618_0157402 3300046514 Bacteria 1449
497 Ga0495620_0085171 3300046515 Bacteria 1274
498 Ga0495628_0018807 3300046516 Bacteria 5717
499 Ga0495628_0027371 3300046516 Bacteria 4640
500 Ga0495628_0042995 3300046516 Bacteria 3601
501 Ga0495628_0101232 3300046516 Bacteria 2223
502 Ga0495630_0022467 3300046517 Bacteria 4659
503 Ga0495630_0027568 3300046517 Bacteria 4215
504 Ga0495630_0196928 3300046517 Bacteria 1537
505 Ga0495630_0219811 3300046517 Bacteria 1450
506 Ga0495631_0067083 3300046518 Bacteria 1553
507 Ga0495666_0015461 3300046526 Bacteria 3799
508 Ga0495666_0039696 3300046526 Bacteria 2284
509 Ga0495652_0001668 3300046529 Bacteria 24094
510 Ga0495652_0012326 3300046529 Bacteria 7718
511 Ga0495652_0031939 3300046529 Bacteria 4607
512 Ga0495652_0041720 3300046529 Bacteria 3959
513 Ga0495652_0073193 3300046529 Bacteria 2854
514 Ga0495652_0084052 3300046529 Bacteria 2618
515 Ga0495652_0199758 3300046529 Bacteria 1518
516 Ga0495665_0014532 3300046531 Bacteria 4245
517 Ga0495665_0086593 3300046531 Bacteria 1646
518 Ga0495640_0002112 3300046533 Bacteria 15852
519 Ga0495640_0046734 3300046533 Bacteria 2997
520 Ga0495640_0066006 3300046533 Bacteria 2441
521 Ga0495640_0169235 3300046533 Bacteria 1396
522 Ga0495586_0021968 3300046535 Bacteria 3405
523 Ga0495587_0000013 3300046536 Bacteria 195619
524 Ga0495587_0040280 3300046536 Bacteria 2793
525 Ga0495587_0071961 3300046536 Bacteria 2010
526 Ga0495587_0090843 3300046536 Bacteria 1764
527 Ga0495587_0106743 3300046536 Bacteria 1610
528 Ga0495645_0008113 3300046543 Bacteria 7319
529 Ga0495645_0014580 3300046543 Bacteria 5579
530 Ga0495645_0078337 3300046543 Bacteria 2375
531 Ga0495667_0000016 3300046559 Bacteria 195635
532 Ga0495667_0006731 3300046559 Bacteria 7797
533 Ga0495667_0007380 3300046559 Bacteria 7455
534 Ga0495667_0033211 3300046559 Bacteria 3453
535 Ga0495667_0035330 3300046559 Bacteria 3340
536 Ga0495667_0048551 3300046559 Bacteria 2802
537 Ga0495667_0053066 3300046559 Bacteria 2670
538 Ga0495667_0078679 3300046559 Bacteria 2144
539 Ga0495634_0028522 3300046642 Bacteria 3873
540 Ga0495634_0056071 3300046642 Bacteria 2634
541 Ga0495634_0125666 3300046642 Bacteria 1639
542 Ga0495635_0000951 3300046663 Bacteria 19107
543 Ga0495635_0005849 3300046663 Bacteria 8571
544 Ga0495635_0120999 3300046663 Bacteria 1785
545 Ga0495657_0000014 3300046675 Bacteria 195574
546 Ga0495657_0001649 3300046675 Bacteria 19177
547 Ga0495657_0020719 3300046675 Bacteria 4727
548 Ga0495657_0042038 3300046675 Bacteria 3123
549 Ga0495657_0054676 3300046675 Bacteria 2665
550 Ga0495657_0055318 3300046675 Bacteria 2647
551 Ga0495657_0058652 3300046675 Bacteria 2555
552 Ga0495657_0081640 3300046675 Bacteria 2090
553 Ga0495599_0000006 3300046678 Bacteria 283487
554 Ga0495599_0015082 3300046678 Bacteria 4790
555 Ga0495599_0020997 3300046678 Bacteria 4071
556 Ga0495599_0089190 3300046678 Bacteria 1925
557 Ga0495599_0105895 3300046678 Bacteria 1752
558 Ga0495623_0004288 3300046679 Bacteria 9388
559 Ga0495623_0023482 3300046679 Bacteria 3980
560 Ga0495623_0028615 3300046679 Bacteria 3584
561 Ga0495623_0032320 3300046679 Bacteria 3364
562 Ga0495623_0045131 3300046679 Bacteria 2800
563 Ga0495623_0175146 3300046679 Bacteria 1250
564 Ga0495646_0011492 3300046680 Bacteria 5620
565 Ga0495646_0015911 3300046680 Bacteria 4774
566 Ga0495646_0148883 3300046680 Bacteria 1303
567 Ga0495647_0040292 3300046681 Bacteria 1774
568 Ga0495647_0068933 3300046681 Bacteria 1412
569 Ga0495647_0149639 3300046681 Bacteria 1000
570 Ga0495658_0008962 3300046683 Bacteria 4974
571 Ga0495613_0016116 3300046689 Bacteria 5564
572 Ga0495624_0002996 3300046690 Bacteria 12637
573 Ga0495624_0047183 3300046690 Bacteria 2737
574 Ga0495600_0013119 3300046809 Bacteria 5197
575 Ga0495600_0032600 3300046809 Bacteria 3381
576 Ga0495600_0033158 3300046809 Bacteria 3352
577 Ga0495600_0033945 3300046809 Bacteria 3313
578 Ga0495600_0134482 3300046809 Bacteria 1606
579 Ga0495581_0004124 3300047315 Bacteria 8367
580 Ga0495581_0102609 3300047315 Bacteria 1662
581 Ga0495604_0000015 3300047317 Bacteria 195635
582 Ga0495604_0022121 3300047317 Bacteria 5074
583 Ga0495604_0022292 3300047317 Bacteria 5056
584 Ga0495604_0044946 3300047317 Bacteria 3448
585 Ga0495604_0101866 3300047317 Bacteria 2108
586 Ga0495604_0131823 3300047317 Bacteria 1795
587 Ga0495674_0004290 3300047319 Bacteria 13718
588 Ga0495674_0004688 3300047319 Bacteria 13148
589 Ga0495674_0059461 3300047319 Bacteria 3337
590 Ga0495674_0106510 3300047319 Bacteria 2381
591 Ga0495674_0246978 3300047319 Bacteria 1469
592 Ga0495676_0050282 3300047321 Bacteria 3344
593 Ga0495676_0065828 3300047321 Bacteria 2811
594 Ga0495676_0243737 3300047321 Bacteria 1229
595 Ga0495680_0000380 3300047322 Bacteria 49632
596 Ga0495680_0006296 3300047322 Bacteria 11056
597 Ga0495680_0020131 3300047322 Bacteria 5620
598 Ga0495680_0026194 3300047322 Bacteria 4811
599 Ga0495680_0052465 3300047322 Bacteria 3178
600 Ga0495680_0070996 3300047322 Bacteria 2652
601 Ga0495680_0071715 3300047322 Bacteria 2636
602 Ga0495675_0003988 3300047444 Bacteria 8945
603 Ga0495675_0006842 3300047444 Bacteria 7000
604 Ga0495675_0110803 3300047444 Bacteria 1713
605 Ga0495675_0154227 3300047444 Bacteria 1417
606 Ga0495675_0183634 3300047444 Bacteria 1279
607 Ga0495684_0029692 3300047471 Bacteria 4195
608 Ga0495684_0032688 3300047471 Bacteria 3995
609 Ga0495684_0048038 3300047471 Bacteria 3263
610 Ga0495684_0122951 3300047471 Bacteria 1953
611 Ga0495684_0169892 3300047471 Bacteria 1622
612 Ga0495684_0194699 3300047471 Bacteria 1497
613 Ga0495684_0240540 3300047471 Bacteria 1320
614 Ga0495593_0000569 3300047673 Bacteria 20962
615 Ga0495593_0025990 3300047673 Bacteria 3237
616 Ga0495602_0000013 3300048088 Bacteria 195591
617 Ga0495602_0018082 3300048088 Bacteria 7050
618 Ga0495602_0025113 3300048088 Bacteria 5771
619 Ga0495602_0128131 3300048088 Bacteria 2029
620 Ga0495602_0140239 3300048088 Bacteria 1914
621 Ga0495602_0159394 3300048088 Bacteria 1763
622 Ga0495602_0272519 3300048088 Bacteria 1250
623 Ga0495614_0009992 3300048089 Bacteria 4189
624 Ga0495614_0013749 3300048089 Bacteria 3549
625 Ga0496100_0010356 3300048903 Bacteria 5276
626 Ga0496100_0110499 3300048903 Bacteria 1908
627 Ga0496100_0120895 3300048903 Bacteria 1832
628 Ga0496101_0010359 3300048904 Bacteria 6155
629 Ga0496101_0055206 3300048904 Bacteria 2869
630 Ga0496102_0000983 3300048905 Bacteria 26821
631 Ga0496102_0005931 3300048905 Bacteria 10404
632 Ga0496102_0169839 3300048905 Bacteria 2053
633 Ga0496102_0203907 3300048905 Bacteria 1864
634 Ga0496102_0222361 3300048905 Bacteria 1780
635 Ga0496103_0003620 3300048906 Bacteria 9420
636 Ga0496103_0354745 3300048906 Bacteria 943
637 Ga0496104_0006284 3300048907 Bacteria 10442
638 Ga0496104_0006942 3300048907 Bacteria 9988
639 Ga0496104_0023189 3300048907 Bacteria 5705
640 Ga0496104_0040529 3300048907 Bacteria 4365
641 Ga0496105_0002257 3300048908 Bacteria 13967
642 Ga0496105_0003384 3300048908 Bacteria 11787
643 Ga0496105_0022474 3300048908 Bacteria 5108
644 Ga0496105_0030630 3300048908 Bacteria 4408
645 Ga0496106_0037129 3300048909 Bacteria 3644
646 Ga0496106_0258829 3300048909 Bacteria 1392
647 Ga0496107_0189008 3300048910 Bacteria 1530
648 Ga0496107_0271197 3300048910 Bacteria 1263
649 Ga0496108_0008373 3300048911 Bacteria 8390
650 Ga0496109_0024968 3300048912 Bacteria 5320
651 Ga0496109_0154294 3300048912 Bacteria 2151
652 Ga0496109_0230463 3300048912 Bacteria 1742
653 Ga0496110_0014490 3300048913 Bacteria 6549
654 Ga0496110_0119418 3300048913 Bacteria 2374
655 Ga0496110_0678764 3300048913 Bacteria 931
656 Ga0496111_0026244 3300048914 Bacteria 4112
657 Ga0496111_0124228 3300048914 Bacteria 1907
658 Ga0496112_0029947 3300048915 Bacteria 5266
659 Ga0496112_0281210 3300048915 Bacteria 1611
660 Ga0496112_0298895 3300048915 Bacteria 1555
661 Ga0496112_0814337 3300048915 Bacteria 858
662 Ga0496113_0271978 3300048916 Bacteria 1354
663 Ga0496114_0019240 3300048917 Bacteria 5532
664 Ga0496114_0300059 3300048917 Bacteria 1418
665 Ga0496114_0405368 3300048917 Bacteria 1207
666 Ga0496115_0082818 3300048918 Bacteria 2614
667 Ga0496115_0179456 3300048918 Bacteria 1751
668 Ga0496115_0275242 3300048918 Bacteria 1382
669 Ga0496126_0235246 3300048929 Bacteria 1533
670 Ga0501034_0687686 3300049571 Bacteria 922
671 Ga0501036_0001833 3300049572 Bacteria 16501
672 Ga0501036_0009108 3300049572 Bacteria 8165
673 Ga0501036_0415271 3300049572 Bacteria 1122
674 Ga0501038_0032357 3300049574 Bacteria 4614
675 Ga0501038_0117828 3300049574 Bacteria 2193
676 Ga0501039_0042421 3300049575 Bacteria 3515
677 Ga0501040_0012841 3300049576 Bacteria 5500
678 Ga0501040_0090813 3300049576 Bacteria 2123
679 Ga0501041_0020790 3300049577 Bacteria 3927
680 Ga0501041_0096193 3300049577 Bacteria 1830
681 Ga0501042_0000649 3300049578 Bacteria 18669
682 Ga0501046_0005754 3300049580 Bacteria 11064
683 Ga0501046_0078427 3300049580 Bacteria 2555
684 Ga0501046_0315915 3300049580 Bacteria 1139
685 Ga0501047_0128325 3300049581 Bacteria 2416
686 Ga0501048_0009775 3300049582 Bacteria 7191
687 Ga0501048_0112403 3300049582 Bacteria 1923
688 Ga0501069_0162641 3300049585 Bacteria 1286
689 Ga0501071_0002819 3300049587 Bacteria 10704
690 Ga0501071_0032008 3300049587 Bacteria 3732
691 Ga0501071_0448650 3300049587 Bacteria 987
692 Ga0501071_0550768 3300049587 Bacteria 886
693 Ga0501072_0059576 3300049588 Bacteria 3010
694 Ga0501072_0098812 3300049588 Bacteria 2320
695 Ga0501074_0191911 3300049590 Bacteria 1456
696 Ga0501075_0002567 3300049591 Bacteria 12107
697 Ga0501075_0145032 3300049591 Bacteria 1809
698 Ga0501075_0482994 3300049591 Bacteria 945
699 Ga0501076_0000957 3300049592 Bacteria 18872
700 Ga0501076_0007978 3300049592 Bacteria 7728
701 Ga0501077_0085255 3300049593 Bacteria 2002
702 Ga0501077_0090877 3300049593 Bacteria 1935
703 Ga0501079_0010125 3300049741 Bacteria 7157
704 Ga0501079_0121616 3300049741 Bacteria 2030
705 Ga0501080_0060935 3300049742 Bacteria 3513
706 Ga0501080_0190582 3300049742 Bacteria 1884
707 Ga0501081_0034845 3300049743 Bacteria 3426
708 Ga0501035_0024974 3300049822 Bacteria 5480
709 Ga0501035_0042510 3300049822 Bacteria 4099
710 Ga0501044_0085116 3300049823 Bacteria 3195
711 Ga0501044_0469996 3300049823 Bacteria 1162
712 Ga0501045_0094897 3300049824 Bacteria 2206
713 nmdc:mga05p37_10551_c1 3300050507 Bacteria 10956
714 nmdc:mga09592_16026_c1 3300050508 Bacteria 6126
715 nmdc:mga08y16_18189_c1 3300050511 Bacteria 7405
716 nmdc:mga0n895_209079_c1 3300050512 Bacteria 1982
717 nmdc:mga0n895_63600_c1 3300050512 Bacteria 3649
718 nmdc:mga0rr50_115394_c1 3300050513 Bacteria 2131
719 nmdc:mga0rr50_204116_c1 3300050513 Bacteria 1626
720 nmdc:mga0rr50_648762_c1 3300050513 Bacteria 901
721 Ga0495601_0092166 3300053077 Bacteria 1951
722 Ga0495601_0100116 3300053077 Bacteria 1871
723 Ga0495612_0007523 3300053078 Bacteria 4452
724 Ga0495612_0054437 3300053078 Bacteria 1648
725 Ga0495612_0086446 3300053078 Bacteria 1322
726 Ga0495595_0004997 3300053084 Bacteria 5356
727 Ga0495595_0008824 3300053084 Bacteria 4151
728 Ga0495595_0019025 3300053084 Bacteria 2975
729 Ga0495595_0022435 3300053084 Bacteria 2772
730 Ga0495619_0008048 3300053085 Bacteria 6672
731 Ga0495619_0054659 3300053085 Bacteria 2643
732 Ga0500568_0003155 3300053139 Bacteria 9391
733 Ga0501084_0038908 3300054114 Bacteria 3977
734 Ga0501082_0125486 3300060353 Bacteria 2226
735 Ga0466962_0068918 3300061719 Bacteria 1689
736 Ga0466962_0091563 3300061719 Bacteria 1457
737 Ga0530510_0051263 3300061734 Bacteria 2982
738 Ga0530510_0567861 3300061734 Bacteria 862

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10097371 Ga0157376_100973712 223
2 3300048915 Ga0496112_0814337 Ga0496112_0814337_136_837 230
3 3300035691 Ga0373931_0371266 Ga0373931_0371266_39_734 231
4 3300044719 Ga0466971_0259779 Ga0466971_0259779_35_757 231
5 3300045976 Ga0466967_0154932 Ga0466967_0154932_28_723 231
6 3300046515 Ga0495620_0085171 Ga0495620_0085171_500_1195 231
7 3300046518 Ga0495631_0067083 Ga0495631_0067083_369_1064 231
8 3300013307 Ga0157372_11077247 Ga0157372_110772472 233
9 3300048905 Ga0496102_0000983 Ga0496102_0000983_18398_19138 233
10 3300007076 Ga0075435_100109014 Ga0075435_1001090142 235
11 3300025906 Ga0207699_10119325 Ga0207699_101193252 236
12 3300050513 nmdc:mga0rr50_115394_c1 nmdc:mga0rr50_115394_c1_1031_1834 236
13 3300005616 Ga0068852_100216176 Ga0068852_1002161761 237
14 3300035086 Ga0373934_0000025 Ga0373934_0000025_447_1244 237
15 3300035111 Ga0373923_0033509 Ga0373923_0033509_399_1196 237
16 3300035117 Ga0373953_0004753 Ga0373953_0004753_2914_3711 237
17 3300035118 Ga0373954_0012176 Ga0373954_0012176_2216_3013 237
18 3300035119 Ga0373956_0000119 Ga0373956_0000119_26108_26905 237
19 3300035120 Ga0373957_0000264 Ga0373957_0000264_9471_10268 237
20 3300035172 Ga0373955_0000149 Ga0373955_0000149_430_1227 237
21 3300035410 Ga0373924_0000318 Ga0373924_0000318_13676_14473 237
22 3300035724 Ga0373933_0000001 Ga0373933_0000001_208231_209028 237
23 3300036401 Ga0373937_0003722 Ga0373937_0003722_9332_10129 237
24 3300046454 Ga0495592_0000002 Ga0495592_0000002_208261_209058 237
25 3300046462 Ga0495651_0000002 Ga0495651_0000002_436_1233 237
26 3300046463 Ga0495653_0035895 Ga0495653_0035895_208_1005 237
27 3300046511 Ga0495608_0000118 Ga0495608_0000118_451_1248 237
28 3300046516 Ga0495628_0018807 Ga0495628_0018807_385_1182 237
29 3300046529 Ga0495652_0001668 Ga0495652_0001668_22867_23664 237
30 3300046536 Ga0495587_0000013 Ga0495587_0000013_194392_195189 237
31 3300046559 Ga0495667_0000016 Ga0495667_0000016_194397_195194 237
32 3300046675 Ga0495657_0000014 Ga0495657_0000014_382_1179 237
33 3300046678 Ga0495599_0000006 Ga0495599_0000006_208679_209476 237
34 3300046679 Ga0495623_0004288 Ga0495623_0004288_443_1240 237
35 3300046809 Ga0495600_0032600 Ga0495600_0032600_434_1231 237
36 3300047317 Ga0495604_0000015 Ga0495604_0000015_194378_195175 237
37 3300047322 Ga0495680_0000380 Ga0495680_0000380_426_1223 237
38 3300047444 Ga0495675_0003988 Ga0495675_0003988_415_1212 237
39 3300048088 Ga0495602_0000013 Ga0495602_0000013_194375_195172 237
40 3300053084 Ga0495595_0004997 Ga0495595_0004997_400_1197 237
41 3300005445 Ga0070708_100853291 Ga0070708_1008532911 238
42 3300005467 Ga0070706_100016022 Ga0070706_1000160229 238
43 3300005467 Ga0070706_100132282 Ga0070706_1001322822 238
44 3300005468 Ga0070707_100087282 Ga0070707_1000872822 238
45 3300005468 Ga0070707_100144402 Ga0070707_1001444022 238
46 3300005471 Ga0070698_100109039 Ga0070698_1001090393 238
47 3300005547 Ga0070693_100116170 Ga0070693_1001161702 238
48 3300005615 Ga0070702_100077130 Ga0070702_1000771303 238
49 3300005983 Ga0081540_1001512 Ga0081540_100151219 238
50 3300006844 Ga0075428_100050071 Ga0075428_1000500713 238
51 3300006852 Ga0075433_10043688 Ga0075433_100436882 238
52 3300006914 Ga0075436_100055144 Ga0075436_1000551441 238
53 3300007788 Ga0099795_10080728 Ga0099795_100807282 238
54 3300009147 Ga0114129_10043767 Ga0114129_100437672 238
55 3300009148 Ga0105243_10018288 Ga0105243_100182883 238
56 3300009551 Ga0105238_10472690 Ga0105238_104726902 238
57 3300009553 Ga0105249_10234369 Ga0105249_102343692 238
58 3300013297 Ga0157378_10013756 Ga0157378_100137562 238
59 3300013306 Ga0163162_10394642 Ga0163162_103946422 238
60 3300025910 Ga0207684_10063805 Ga0207684_100638052 238
61 3300025910 Ga0207684_10290658 Ga0207684_102906582 238
62 3300025922 Ga0207646_10156719 Ga0207646_101567192 238
63 3300025928 Ga0207700_10225360 Ga0207700_102253603 238
64 3300025929 Ga0207664_10207160 Ga0207664_102071602 238
65 3300027907 Ga0207428_10114133 Ga0207428_101141333 238
66 3300037068 Ga0373925_0022896 Ga0373925_0022896_1231_2019 238
67 3300037853 Ga0436364_0025604 Ga0436364_0025604_557_1309 238
68 3300047319 Ga0495674_0004688 Ga0495674_0004688_2807_3604 238
69 3300050507 nmdc:mga05p37_10551_c1 nmdc:mga05p37_10551_c1_5208_5987 238
70 3300050511 nmdc:mga08y16_18189_c1 nmdc:mga08y16_18189_c1_5456_6235 238
71 3300050512 nmdc:mga0n895_63600_c1 nmdc:mga0n895_63600_c1_226_1005 238
72 3300053078 Ga0495612_0086446 Ga0495612_0086446_89_886 238
73 3300053139 Ga0500568_0003155 Ga0500568_0003155_759_1610 238
74 3300005328 Ga0070676_10124606 Ga0070676_101246062 239
75 3300005344 Ga0070661_100046183 Ga0070661_1000461832 239
76 3300005366 Ga0070659_100127615 Ga0070659_1001276152 239
77 3300005445 Ga0070708_100181706 Ga0070708_1001817062 239
78 3300005456 Ga0070678_100491116 Ga0070678_1004911162 239
79 3300005518 Ga0070699_100325164 Ga0070699_1003251642 239
80 3300005535 Ga0070684_100159237 Ga0070684_1001592372 239
81 3300005535 Ga0070684_100215054 Ga0070684_1002150543 239
82 3300005544 Ga0070686_100048347 Ga0070686_1000483472 239
83 3300005618 Ga0068864_100356716 Ga0068864_1003567162 239
84 3300005842 Ga0068858_100090185 Ga0068858_1000901852 239
85 3300009098 Ga0105245_10072114 Ga0105245_100721143 239
86 3300009098 Ga0105245_10151002 Ga0105245_101510024 239
87 3300009177 Ga0105248_10078501 Ga0105248_100785013 239
88 3300009551 Ga0105238_10126613 Ga0105238_101266133 239
89 3300009551 Ga0105238_10864944 Ga0105238_108649441 239
90 3300014325 Ga0163163_10042895 Ga0163163_100428953 239
91 3300014326 Ga0157380_10904340 Ga0157380_109043402 239
92 3300020082 Ga0206353_11135489 Ga0206353_111354892 239
93 3300022467 Ga0224712_10029195 Ga0224712_100291952 239
94 3300025906 Ga0207699_10269658 Ga0207699_102696582 239
95 3300025916 Ga0207663_10131254 Ga0207663_101312543 239
96 3300025919 Ga0207657_10010958 Ga0207657_100109588 239
97 3300025928 Ga0207700_10250710 Ga0207700_102507102 239
98 3300025929 Ga0207664_10020568 Ga0207664_100205686 239
99 3300025939 Ga0207665_10005391 Ga0207665_100053917 239
100 3300025972 Ga0207668_10440511 Ga0207668_104405112 239
101 3300026035 Ga0207703_10089636 Ga0207703_100896362 239
102 3300026078 Ga0207702_10460060 Ga0207702_104600601 239
103 3300026118 Ga0207675_100020030 Ga0207675_1000200303 239
104 3300028380 Ga0268265_10032110 Ga0268265_100321102 239
105 3300028381 Ga0268264_10797672 Ga0268264_107976721 239
106 3300035083 Ga0373926_0056493 Ga0373926_0056493_283_1071 239
107 3300035086 Ga0373934_0012177 Ga0373934_0012177_247_1023 239
108 3300035086 Ga0373934_0019874 Ga0373934_0019874_720_1496 239
109 3300035089 Ga0373944_0012090 Ga0373944_0012090_1104_1895 239
110 3300035091 Ga0373951_0017421 Ga0373951_0017421_142_906 239
111 3300035119 Ga0373956_0073902 Ga0373956_0073902_89_865 239
112 3300035120 Ga0373957_0068850 Ga0373957_0068850_173_961 239
113 3300035171 Ga0373946_0081095 Ga0373946_0081095_238_1026 239
114 3300035172 Ga0373955_0013651 Ga0373955_0013651_97_873 239
115 3300035172 Ga0373955_0041344 Ga0373955_0041344_254_1042 239
116 3300035724 Ga0373933_0014063 Ga0373933_0014063_3157_3927 239
117 3300035724 Ga0373933_0053913 Ga0373933_0053913_1339_2115 239
118 3300035724 Ga0373933_0074097 Ga0373933_0074097_608_1384 239
119 3300036401 Ga0373937_0027495 Ga0373937_0027495_3050_3826 239
120 3300036401 Ga0373937_0112254 Ga0373937_0112254_635_1405 239
121 3300036401 Ga0373937_0378438 Ga0373937_0378438_49_825 239
122 3300046459 Ga0495629_0146547 Ga0495629_0146547_738_1529 239
123 3300046462 Ga0495651_0023699 Ga0495651_0023699_1389_2165 239
124 3300046462 Ga0495651_0040760 Ga0495651_0040760_1266_2042 239
125 3300046462 Ga0495651_0224041 Ga0495651_0224041_166_936 239
126 3300046477 Ga0495664_0026244 Ga0495664_0026244_732_1502 239
127 3300046499 Ga0495594_0092479 Ga0495594_0092479_415_1206 239
128 3300046514 Ga0495618_0071667 Ga0495618_0071667_701_1471 239
129 3300046526 Ga0495666_0039696 Ga0495666_0039696_1007_1798 239
130 3300046529 Ga0495652_0041720 Ga0495652_0041720_305_1081 239
131 3300046529 Ga0495652_0199758 Ga0495652_0199758_299_1069 239
132 3300046559 Ga0495667_0006731 Ga0495667_0006731_2162_2938 239
133 3300046663 Ga0495635_0120999 Ga0495635_0120999_513_1283 239
134 3300046675 Ga0495657_0020719 Ga0495657_0020719_2561_3337 239
135 3300046675 Ga0495657_0042038 Ga0495657_0042038_1973_2743 239
136 3300046678 Ga0495599_0105895 Ga0495599_0105895_845_1621 239
137 3300046679 Ga0495623_0045131 Ga0495623_0045131_763_1533 239
138 3300046679 Ga0495623_0175146 Ga0495623_0175146_119_895 239
139 3300046681 Ga0495647_0068933 Ga0495647_0068933_361_1152 239
140 3300046809 Ga0495600_0134482 Ga0495600_0134482_504_1274 239
141 3300047317 Ga0495604_0022292 Ga0495604_0022292_3644_4420 239
142 3300047322 Ga0495680_0006296 Ga0495680_0006296_180_956 239
143 3300047471 Ga0495684_0194699 Ga0495684_0194699_638_1414 239
144 3300048088 Ga0495602_0018082 Ga0495602_0018082_1359_2135 239
145 3300048088 Ga0495602_0025113 Ga0495602_0025113_1929_2705 239
146 3300048088 Ga0495602_0140239 Ga0495602_0140239_753_1523 239
147 3300050512 nmdc:mga0n895_209079_c1 nmdc:mga0n895_209079_c1_537_1301 239
148 3300003203 JGI25406J46586_10011340 JGI25406J46586_100113402 240
149 3300003659 JGI25404J52841_10004335 JGI25404J52841_100043354 240
150 3300005356 Ga0070674_100353782 Ga0070674_1003537822 240
151 3300005435 Ga0070714_100179288 Ga0070714_1001792882 240
152 3300005437 Ga0070710_10049041 Ga0070710_100490412 240
153 3300005439 Ga0070711_100039016 Ga0070711_1000390163 240
154 3300005467 Ga0070706_100005940 Ga0070706_10000594012 240
155 3300005937 Ga0081455_10004970 Ga0081455_1000497013 240
156 3300005983 Ga0081540_1000074 Ga0081540_10000744 240
157 3300005985 Ga0081539_10000421 Ga0081539_1000042129 240
158 3300006028 Ga0070717_10000010 Ga0070717_1000001041 240
159 3300006163 Ga0070715_10001650 Ga0070715_100016504 240
160 3300006173 Ga0070716_100017725 Ga0070716_1000177253 240
161 3300006871 Ga0075434_100037030 Ga0075434_1000370303 240
162 3300006914 Ga0075436_100124083 Ga0075436_1001240832 240
163 3300007076 Ga0075435_100229163 Ga0075435_1002291632 240
164 3300014969 Ga0157376_10467377 Ga0157376_104673772 240
165 3300025898 Ga0207692_10000912 Ga0207692_1000091213 240
166 3300025898 Ga0207692_10175423 Ga0207692_101754231 240
167 3300025910 Ga0207684_10005619 Ga0207684_1000561912 240
168 3300025912 Ga0207707_10291145 Ga0207707_102911452 240
169 3300025915 Ga0207693_10016510 Ga0207693_100165103 240
170 3300025921 Ga0207652_10434379 Ga0207652_104343792 240
171 3300025929 Ga0207664_10001557 Ga0207664_100015575 240
172 3300025929 Ga0207664_10134335 Ga0207664_101343352 240
173 3300025939 Ga0207665_10004055 Ga0207665_100040553 240
174 3300028379 Ga0268266_10338612 Ga0268266_103386122 240
175 3300028666 Ga0265336_10013374 Ga0265336_100133742 240
176 3300028800 Ga0265338_10001861 Ga0265338_1000186127 240
177 3300031251 Ga0265327_10014535 Ga0265327_100145352 240
178 3300031901 Ga0307406_10042549 Ga0307406_100425492 240
179 3300031903 Ga0307407_10158111 Ga0307407_101581112 240
180 3300031911 Ga0307412_10377997 Ga0307412_103779972 240
181 3300031995 Ga0307409_100026214 Ga0307409_1000262142 240
182 3300032002 Ga0307416_100349572 Ga0307416_1003495723 240
183 3300035089 Ga0373944_0020636 Ga0373944_0020636_704_1465 240
184 3300035111 Ga0373923_0098372 Ga0373923_0098372_88_849 240
185 3300035113 Ga0373936_0013843 Ga0373936_0013843_1615_2376 240
186 3300035116 Ga0373945_0042664 Ga0373945_0042664_704_1465 240
187 3300035119 Ga0373956_0014711 Ga0373956_0014711_2352_3122 240
188 3300035170 Ga0373943_0018410 Ga0373943_0018410_1376_2137 240
189 3300035171 Ga0373946_0005624 Ga0373946_0005624_2146_2907 240
190 3300035172 Ga0373955_0192205 Ga0373955_0192205_255_1040 240
191 3300035692 Ga0373935_0030337 Ga0373935_0030337_1517_2278 240
192 3300035695 Ga0373927_0016408 Ga0373927_0016408_3496_4257 240
193 3300035724 Ga0373933_0175918 Ga0373933_0175918_329_1096 240
194 3300035725 Ga0373947_0004746 Ga0373947_0004746_383_1144 240
195 3300036401 Ga0373937_0044906 Ga0373937_0044906_533_1318 240
196 3300036401 Ga0373937_0584369 Ga0373937_0584369_36_803 240
197 3300037068 Ga0373925_0007907 Ga0373925_0007907_1635_2396 240
198 3300044683 Ga0466965_0070061 Ga0466965_0070061_134_871 240
199 3300044706 Ga0466964_0032567 Ga0466964_0032567_495_1232 240
200 3300044842 Ga0466957_0048984 Ga0466957_0048984_1021_1758 240
201 3300045976 Ga0466967_0035867 Ga0466967_0035867_1129_1890 240
202 3300045976 Ga0466967_0155764 Ga0466967_0155764_797_1534 240
203 3300046454 Ga0495592_0115879 Ga0495592_0115879_17_784 240
204 3300046462 Ga0495651_0073159 Ga0495651_0073159_1435_2202 240
205 3300046463 Ga0495653_0071947 Ga0495653_0071947_355_1116 240
206 3300046476 Ga0495662_0097420 Ga0495662_0097420_373_1134 240
207 3300046477 Ga0495664_0048897 Ga0495664_0048897_373_1134 240
208 3300046511 Ga0495608_0013978 Ga0495608_0013978_1807_2574 240
209 3300046511 Ga0495608_0065521 Ga0495608_0065521_19_780 240
210 3300046514 Ga0495618_0157402 Ga0495618_0157402_151_912 240
211 3300046516 Ga0495628_0101232 Ga0495628_0101232_822_1589 240
212 3300046517 Ga0495630_0022467 Ga0495630_0022467_312_1073 240
213 3300046517 Ga0495630_0196928 Ga0495630_0196928_591_1358 240
214 3300046529 Ga0495652_0012326 Ga0495652_0012326_3081_3848 240
215 3300046529 Ga0495652_0073193 Ga0495652_0073193_1421_2182 240
216 3300046531 Ga0495665_0086593 Ga0495665_0086593_481_1242 240
217 3300046533 Ga0495640_0066006 Ga0495640_0066006_1602_2363 240
218 3300046536 Ga0495587_0090843 Ga0495587_0090843_690_1451 240
219 3300046536 Ga0495587_0106743 Ga0495587_0106743_707_1474 240
220 3300046543 Ga0495645_0078337 Ga0495645_0078337_347_1114 240
221 3300046559 Ga0495667_0033211 Ga0495667_0033211_1636_2397 240
222 3300046559 Ga0495667_0053066 Ga0495667_0053066_1849_2616 240
223 3300046642 Ga0495634_0056071 Ga0495634_0056071_1442_2209 240
224 3300046642 Ga0495634_0125666 Ga0495634_0125666_260_1021 240
225 3300046663 Ga0495635_0000951 Ga0495635_0000951_16740_17501 240
226 3300046663 Ga0495635_0005849 Ga0495635_0005849_4781_5548 240
227 3300046675 Ga0495657_0055318 Ga0495657_0055318_44_811 240
228 3300046675 Ga0495657_0081640 Ga0495657_0081640_395_1156 240
229 3300046678 Ga0495599_0089190 Ga0495599_0089190_417_1178 240
230 3300046681 Ga0495647_0149639 Ga0495647_0149639_199_960 240
231 3300046690 Ga0495624_0047183 Ga0495624_0047183_1634_2395 240
232 3300046809 Ga0495600_0033945 Ga0495600_0033945_1942_2709 240
233 3300047317 Ga0495604_0044946 Ga0495604_0044946_1619_2386 240
234 3300047319 Ga0495674_0004290 Ga0495674_0004290_523_1284 240
235 3300047319 Ga0495674_0106510 Ga0495674_0106510_911_1678 240
236 3300047319 Ga0495674_0246978 Ga0495674_0246978_421_1209 240
237 3300047321 Ga0495676_0065828 Ga0495676_0065828_366_1127 240
238 3300047322 Ga0495680_0026194 Ga0495680_0026194_154_921 240
239 3300047322 Ga0495680_0071715 Ga0495680_0071715_704_1465 240
240 3300047444 Ga0495675_0154227 Ga0495675_0154227_202_969 240
241 3300047471 Ga0495684_0048038 Ga0495684_0048038_509_1270 240
242 3300047471 Ga0495684_0240540 Ga0495684_0240540_518_1285 240
243 3300048088 Ga0495602_0128131 Ga0495602_0128131_707_1474 240
244 3300048905 Ga0496102_0203907 Ga0496102_0203907_384_1160 240
245 3300048907 Ga0496104_0006284 Ga0496104_0006284_2048_2824 240
246 3300048908 Ga0496105_0002257 Ga0496105_0002257_258_1034 240
247 3300048910 Ga0496107_0189008 Ga0496107_0189008_235_1011 240
248 3300048912 Ga0496109_0154294 Ga0496109_0154294_406_1182 240
249 3300048915 Ga0496112_0029947 Ga0496112_0029947_4102_4878 240
250 3300050513 nmdc:mga0rr50_204116_c1 nmdc:mga0rr50_204116_c1_434_1231 240
251 3300053085 Ga0495619_0054659 Ga0495619_0054659_991_1758 240
252 iso_pu_bacteria 2867312974 2867317909 240
253 iso_pu_bacteria 2867319477 2867319605 240
254 3300005327 Ga0070658_10010707 Ga0070658_100107073 241
255 3300005327 Ga0070658_10059220 Ga0070658_100592204 241
256 3300005329 Ga0070683_100053379 Ga0070683_1000533793 241
257 3300005337 Ga0070682_100196382 Ga0070682_1001963822 241
258 3300005345 Ga0070692_10042979 Ga0070692_100429792 241
259 3300005364 Ga0070673_100102503 Ga0070673_1001025032 241
260 3300005366 Ga0070659_100129965 Ga0070659_1001299652 241
261 3300005367 Ga0070667_100051490 Ga0070667_1000514903 241
262 3300005434 Ga0070709_10443742 Ga0070709_104437421 241
263 3300005436 Ga0070713_100233704 Ga0070713_1002337042 241
264 3300005437 Ga0070710_10082152 Ga0070710_100821522 241
265 3300005439 Ga0070711_100323697 Ga0070711_1003236972 241
266 3300005530 Ga0070679_100190272 Ga0070679_1001902722 241
267 3300005577 Ga0068857_100180481 Ga0068857_1001804812 241
268 3300005617 Ga0068859_100260772 Ga0068859_1002607722 241
269 3300006028 Ga0070717_10298981 Ga0070717_102989812 241
270 3300006175 Ga0070712_100349679 Ga0070712_1003496792 241
271 3300006880 Ga0075429_100268463 Ga0075429_1002684632 241
272 3300006931 Ga0097620_100260786 Ga0097620_1002607862 241
273 3300007076 Ga0075435_100449846 Ga0075435_1004498462 241
274 3300013102 Ga0157371_10032175 Ga0157371_100321753 241
275 3300013308 Ga0157375_10094505 Ga0157375_100945053 241
276 3300014968 Ga0157379_10209688 Ga0157379_102096882 241
277 3300021388 Ga0213875_10015906 Ga0213875_100159062 241
278 3300025898 Ga0207692_10127797 Ga0207692_101277971 241
279 3300025906 Ga0207699_10210466 Ga0207699_102104662 241
280 3300025915 Ga0207693_10101953 Ga0207693_101019533 241
281 3300025916 Ga0207663_10222518 Ga0207663_102225182 241
282 3300025921 Ga0207652_10198611 Ga0207652_101986112 241
283 3300025926 Ga0207659_10488413 Ga0207659_104884132 241
284 3300025928 Ga0207700_10258258 Ga0207700_102582583 241
285 3300025928 Ga0207700_10354516 Ga0207700_103545162 241
286 3300025929 Ga0207664_10015225 Ga0207664_100152252 241
287 3300025929 Ga0207664_10044030 Ga0207664_100440302 241
288 3300025932 Ga0207690_10011248 Ga0207690_100112485 241
289 3300025933 Ga0207706_10021574 Ga0207706_100215743 241
290 3300025986 Ga0207658_10067006 Ga0207658_100670062 241
291 3300026078 Ga0207702_10258128 Ga0207702_102581283 241
292 3300026095 Ga0207676_10091777 Ga0207676_100917772 241
293 3300026116 Ga0207674_10061630 Ga0207674_100616304 241
294 3300035090 Ga0373949_0011519 Ga0373949_0011519_847_1608 241
295 3300035111 Ga0373923_0045546 Ga0373923_0045546_751_1521 241
296 3300035121 Ga0373960_0065657 Ga0373960_0065657_242_1003 241
297 3300035172 Ga0373955_0140804 Ga0373955_0140804_117_887 241
298 3300035691 Ga0373931_0125129 Ga0373931_0125129_128_889 241
299 3300037068 Ga0373925_0230267 Ga0373925_0230267_247_1008 241
300 3300037312 Ga0395899_0211122 Ga0395899_0211122_433_1218 241
301 3300037466 Ga0395898_0158606 Ga0395898_0158606_993_1775 241
302 3300037853 Ga0436364_0106996 Ga0436364_0106996_4334_5083 241
303 3300038443 Ga0395901_0582159 Ga0395901_0582159_249_1034 241
304 3300041512 Ga0451853_0784232 Ga0451853_0784232_118_879 241
305 3300044735 Ga0466968_0237417 Ga0466968_0237417_71_823 241
306 3300046461 Ga0495641_0075303 Ga0495641_0075303_399_1163 241
307 3300046517 Ga0495630_0219811 Ga0495630_0219811_376_1146 241
308 3300046559 Ga0495667_0035330 Ga0495667_0035330_876_1646 241
309 3300047471 Ga0495684_0169892 Ga0495684_0169892_595_1365 241
310 3300048909 Ga0496106_0037129 Ga0496106_0037129_2469_3230 241
311 3300048915 Ga0496112_0298895 Ga0496112_0298895_639_1400 241
312 3300048918 Ga0496115_0082818 Ga0496115_0082818_366_1127 241
313 3300005327 Ga0070658_10123451 Ga0070658_101234512 242
314 3300005434 Ga0070709_10000198 Ga0070709_1000019827 242
315 3300005435 Ga0070714_100003316 Ga0070714_1000033163 242
316 3300005435 Ga0070714_100008683 Ga0070714_1000086835 242
317 3300005436 Ga0070713_100025012 Ga0070713_1000250123 242
318 3300005437 Ga0070710_10003510 Ga0070710_100035103 242
319 3300005439 Ga0070711_100009129 Ga0070711_1000091295 242
320 3300005440 Ga0070705_100001031 Ga0070705_1000010312 242
321 3300005549 Ga0070704_100143008 Ga0070704_1001430082 242
322 3300006173 Ga0070716_100000184 Ga0070716_1000001843 242
323 3300011119 Ga0105246_10003753 Ga0105246_100037537 242
324 3300013105 Ga0157369_10118212 Ga0157369_101182123 242
325 3300025898 Ga0207692_10000151 Ga0207692_100001513 242
326 3300025906 Ga0207699_10000357 Ga0207699_100003573 242
327 3300025916 Ga0207663_10003484 Ga0207663_100034846 242
328 3300025928 Ga0207700_10000404 Ga0207700_1000040422 242
329 3300025928 Ga0207700_10551826 Ga0207700_105518262 242
330 3300025929 Ga0207664_10000484 Ga0207664_100004846 242
331 3300025929 Ga0207664_10000644 Ga0207664_1000064419 242
332 3300025939 Ga0207665_10000042 Ga0207665_1000004244 242
333 3300035086 Ga0373934_0020746 Ga0373934_0020746_833_1630 242
334 3300035117 Ga0373953_0000883 Ga0373953_0000883_711_1508 242
335 3300035172 Ga0373955_0130680 Ga0373955_0130680_279_1076 242
336 3300035172 Ga0373955_0245265 Ga0373955_0245265_260_1063 242
337 3300035692 Ga0373935_0110186 Ga0373935_0110186_209_1006 242
338 3300035695 Ga0373927_0053687 Ga0373927_0053687_1105_1902 242
339 3300035724 Ga0373933_0004044 Ga0373933_0004044_2771_3568 242
340 3300035725 Ga0373947_0274101 Ga0373947_0274101_178_975 242
341 3300036401 Ga0373937_0008016 Ga0373937_0008016_3038_3835 242
342 3300037068 Ga0373925_0052242 Ga0373925_0052242_632_1429 242
343 3300037068 Ga0373925_0145079 Ga0373925_0145079_708_1505 242
344 3300039438 Ga0436360_0348714 Ga0436360_0348714_117_923 242
345 3300039450 Ga0436363_0964495 Ga0436363_0964495_121_915 242
346 3300044765 Ga0466970_0039347 Ga0466970_0039347_218_1003 242
347 3300046454 Ga0495592_0011520 Ga0495592_0011520_4722_5519 242
348 3300046461 Ga0495641_0007210 Ga0495641_0007210_505_1302 242
349 3300046462 Ga0495651_0004885 Ga0495651_0004885_2636_3433 242
350 3300046463 Ga0495653_0061535 Ga0495653_0061535_1223_2020 242
351 3300046473 Ga0495582_0046302 Ga0495582_0046302_36_833 242
352 3300046475 Ga0495639_0053636 Ga0495639_0053636_490_1287 242
353 3300046476 Ga0495662_0048557 Ga0495662_0048557_1231_2028 242
354 3300046477 Ga0495664_0021110 Ga0495664_0021110_1434_2231 242
355 3300046514 Ga0495618_0064378 Ga0495618_0064378_818_1615 242
356 3300046516 Ga0495628_0042995 Ga0495628_0042995_789_1586 242
357 3300046529 Ga0495652_0084052 Ga0495652_0084052_1001_1798 242
358 3300046533 Ga0495640_0046734 Ga0495640_0046734_498_1295 242
359 3300046543 Ga0495645_0008113 Ga0495645_0008113_3786_4583 242
360 3300046559 Ga0495667_0078679 Ga0495667_0078679_1301_2110 242
361 3300046675 Ga0495657_0054676 Ga0495657_0054676_492_1289 242
362 3300046679 Ga0495623_0032320 Ga0495623_0032320_599_1396 242
363 3300046680 Ga0495646_0148883 Ga0495646_0148883_91_870 242
364 3300046809 Ga0495600_0033158 Ga0495600_0033158_1135_1932 242
365 3300047317 Ga0495604_0101866 Ga0495604_0101866_711_1508 242
366 3300047321 Ga0495676_0243737 Ga0495676_0243737_47_844 242
367 3300047322 Ga0495680_0070996 Ga0495680_0070996_711_1508 242
368 3300047444 Ga0495675_0006842 Ga0495675_0006842_437_1234 242
369 3300047471 Ga0495684_0122951 Ga0495684_0122951_338_1135 242
370 3300047673 Ga0495593_0025990 Ga0495593_0025990_2420_3217 242
371 3300048089 Ga0495614_0009992 Ga0495614_0009992_971_1753 242
372 3300048903 Ga0496100_0120895 Ga0496100_0120895_654_1481 242
373 3300048929 Ga0496126_0235246 Ga0496126_0235246_206_1042 242
374 3300053077 Ga0495601_0092166 Ga0495601_0092166_634_1431 242
375 3300053078 Ga0495612_0054437 Ga0495612_0054437_369_1166 242
376 3300053084 Ga0495595_0019025 Ga0495595_0019025_1674_2471 242
377 3300005330 Ga0070690_100028460 Ga0070690_1000284603 243
378 3300005340 Ga0070689_100111574 Ga0070689_1001115742 243
379 3300005343 Ga0070687_100164203 Ga0070687_1001642032 243
380 3300005355 Ga0070671_100024167 Ga0070671_1000241674 243
381 3300005356 Ga0070674_100314731 Ga0070674_1003147312 243
382 3300005365 Ga0070688_100035000 Ga0070688_1000350002 243
383 3300005437 Ga0070710_10204129 Ga0070710_102041291 243
384 3300005440 Ga0070705_100106053 Ga0070705_1001060532 243
385 3300005458 Ga0070681_10078952 Ga0070681_100789523 243
386 3300005467 Ga0070706_100056829 Ga0070706_1000568295 243
387 3300005471 Ga0070698_100001515 Ga0070698_10000151513 243
388 3300005471 Ga0070698_100001616 Ga0070698_10000161616 243
389 3300005518 Ga0070699_100000578 Ga0070699_10000057814 243
390 3300005518 Ga0070699_100418972 Ga0070699_1004189722 243
391 3300005530 Ga0070679_100074346 Ga0070679_1000743464 243
392 3300005535 Ga0070684_100079780 Ga0070684_1000797802 243
393 3300005536 Ga0070697_100003261 Ga0070697_10000326110 243
394 3300005539 Ga0068853_100339466 Ga0068853_1003394661 243
395 3300005564 Ga0070664_100071861 Ga0070664_1000718612 243
396 3300005564 Ga0070664_100353640 Ga0070664_1003536402 243
397 3300005615 Ga0070702_100020323 Ga0070702_1000203233 243
398 3300005618 Ga0068864_100107526 Ga0068864_1001075262 243
399 3300005842 Ga0068858_100892930 Ga0068858_1008929301 243
400 3300006028 Ga0070717_10082257 Ga0070717_100822573 243
401 3300006163 Ga0070715_10004966 Ga0070715_100049663 243
402 3300006173 Ga0070716_100049276 Ga0070716_1000492762 243
403 3300006880 Ga0075429_100015337 Ga0075429_1000153375 243
404 3300006881 Ga0068865_100135885 Ga0068865_1001358851 243
405 3300009098 Ga0105245_10100901 Ga0105245_101009012 243
406 3300009101 Ga0105247_10028545 Ga0105247_100285452 243
407 3300009148 Ga0105243_10029708 Ga0105243_100297083 243
408 3300009148 Ga0105243_10373435 Ga0105243_103734352 243
409 3300009174 Ga0105241_10020146 Ga0105241_100201463 243
410 3300009176 Ga0105242_10036596 Ga0105242_100365963 243
411 3300009176 Ga0105242_10059768 Ga0105242_100597683 243
412 3300009551 Ga0105238_10033058 Ga0105238_100330583 243
413 3300009551 Ga0105238_10391132 Ga0105238_103911322 243
414 3300009553 Ga0105249_10033268 Ga0105249_100332684 243
415 3300011119 Ga0105246_10018223 Ga0105246_100182232 243
416 3300013102 Ga0157371_10027044 Ga0157371_100270442 243
417 3300013104 Ga0157370_10191124 Ga0157370_101911242 243
418 3300013296 Ga0157374_10528145 Ga0157374_105281452 243
419 3300013297 Ga0157378_10048437 Ga0157378_100484372 243
420 3300013308 Ga0157375_10048920 Ga0157375_100489203 243
421 3300013308 Ga0157375_10450910 Ga0157375_104509102 243
422 3300014325 Ga0163163_10061786 Ga0163163_100617864 243
423 3300014325 Ga0163163_10079433 Ga0163163_100794332 243
424 3300020080 Ga0206350_10114685 Ga0206350_101146854 243
425 3300025898 Ga0207692_10053047 Ga0207692_100530472 243
426 3300025899 Ga0207642_10020865 Ga0207642_100208652 243
427 3300025901 Ga0207688_10010067 Ga0207688_100100674 243
428 3300025901 Ga0207688_10160785 Ga0207688_101607852 243
429 3300025904 Ga0207647_10051605 Ga0207647_100516052 243
430 3300025905 Ga0207685_10043655 Ga0207685_100436552 243
431 3300025906 Ga0207699_10008137 Ga0207699_100081372 243
432 3300025907 Ga0207645_10030978 Ga0207645_100309783 243
433 3300025910 Ga0207684_10045396 Ga0207684_100453962 243
434 3300025910 Ga0207684_10110666 Ga0207684_101106662 243
435 3300025922 Ga0207646_10033173 Ga0207646_100331734 243
436 3300025922 Ga0207646_10314678 Ga0207646_103146782 243
437 3300025924 Ga0207694_10072412 Ga0207694_100724124 243
438 3300025927 Ga0207687_10109198 Ga0207687_101091982 243
439 3300025928 Ga0207700_10047188 Ga0207700_100471882 243
440 3300025929 Ga0207664_10094408 Ga0207664_100944082 243
441 3300025929 Ga0207664_10349597 Ga0207664_103495972 243
442 3300025929 Ga0207664_10650528 Ga0207664_106505281 243
443 3300025934 Ga0207686_10211175 Ga0207686_102111752 243
444 3300025939 Ga0207665_10105239 Ga0207665_101052393 243
445 3300025940 Ga0207691_10021065 Ga0207691_100210654 243
446 3300025941 Ga0207711_10095258 Ga0207711_100952581 243
447 3300025942 Ga0207689_10018569 Ga0207689_100185694 243
448 3300026067 Ga0207678_10000752 Ga0207678_1000075234 243
449 3300026067 Ga0207678_10401187 Ga0207678_104011872 243
450 3300026075 Ga0207708_10030540 Ga0207708_100305402 243
451 3300026078 Ga0207702_10026614 Ga0207702_100266142 243
452 3300026095 Ga0207676_10205945 Ga0207676_102059452 243
453 3300026121 Ga0207683_10012993 Ga0207683_100129933 243
454 3300026121 Ga0207683_10259273 Ga0207683_102592732 243
455 3300028558 Ga0265326_10000008 Ga0265326_1000000845 243
456 3300028563 Ga0265319_1001253 Ga0265319_10012534 243
457 3300028573 Ga0265334_10000152 Ga0265334_1000015245 243
458 3300028666 Ga0265336_10013987 Ga0265336_100139872 243
459 3300028800 Ga0265338_10008474 Ga0265338_100084748 243
460 3300029957 Ga0265324_10003605 Ga0265324_100036054 243
461 3300031240 Ga0265320_10073255 Ga0265320_100732552 243
462 3300031824 Ga0307413_10289124 Ga0307413_102891242 243
463 3300035084 Ga0373928_0004087 Ga0373928_0004087_273_1076 243
464 3300035086 Ga0373934_0036126 Ga0373934_0036126_155_961 243
465 3300035089 Ga0373944_0000589 Ga0373944_0000589_7690_8496 243
466 3300035111 Ga0373923_0000101 Ga0373923_0000101_3832_4638 243
467 3300035113 Ga0373936_0000233 Ga0373936_0000233_17407_18213 243
468 3300035116 Ga0373945_0009044 Ga0373945_0009044_149_955 243
469 3300035118 Ga0373954_0022351 Ga0373954_0022351_154_960 243
470 3300035119 Ga0373956_0050766 Ga0373956_0050766_913_1755 243
471 3300035171 Ga0373946_0000171 Ga0373946_0000171_2415_3221 243
472 3300035172 Ga0373955_0001986 Ga0373955_0001986_5613_6419 243
473 3300035410 Ga0373924_0009072 Ga0373924_0009072_473_1279 243
474 3300035692 Ga0373935_0091211 Ga0373935_0091211_985_1791 243
475 3300035695 Ga0373927_0004565 Ga0373927_0004565_150_956 243
476 3300035724 Ga0373933_0017823 Ga0373933_0017823_2371_3177 243
477 3300035725 Ga0373947_0001122 Ga0373947_0001122_300_1106 243
478 3300036401 Ga0373937_0057483 Ga0373937_0057483_2372_3178 243
479 3300036401 Ga0373937_0128272 Ga0373937_0128272_1304_2146 243
480 3300037068 Ga0373925_0027209 Ga0373925_0027209_1010_1816 243
481 3300037418 Ga0395900_0191147 Ga0395900_0191147_1254_2021 243
482 3300037466 Ga0395898_0078229 Ga0395898_0078229_2267_3034 243
483 3300046454 Ga0495592_0025397 Ga0495592_0025397_538_1344 243
484 3300046454 Ga0495592_0028991 Ga0495592_0028991_3232_4074 243
485 3300046455 Ga0495603_0005339 Ga0495603_0005339_2442_3248 243
486 3300046459 Ga0495629_0001549 Ga0495629_0001549_2414_3220 243
487 3300046461 Ga0495641_0006847 Ga0495641_0006847_818_1624 243
488 3300046462 Ga0495651_0016351 Ga0495651_0016351_3968_4774 243
489 3300046462 Ga0495651_0018305 Ga0495651_0018305_3527_4369 243
490 3300046463 Ga0495653_0025465 Ga0495653_0025465_3467_4309 243
491 3300046472 Ga0495580_0001403 Ga0495580_0001403_19532_20338 243
492 3300046473 Ga0495582_0001716 Ga0495582_0001716_8859_9665 243
493 3300046475 Ga0495639_0008056 Ga0495639_0008056_410_1216 243
494 3300046475 Ga0495639_0103619 Ga0495639_0103619_446_1288 243
495 3300046476 Ga0495662_0020455 Ga0495662_0020455_2366_3172 243
496 3300046477 Ga0495664_0032158 Ga0495664_0032158_645_1451 243
497 3300046499 Ga0495594_0050795 Ga0495594_0050795_600_1406 243
498 3300046511 Ga0495608_0054487 Ga0495608_0054487_86_892 243
499 3300046511 Ga0495608_0161709 Ga0495608_0161709_382_1224 243
500 3300046514 Ga0495618_0003574 Ga0495618_0003574_6459_7265 243
501 3300046514 Ga0495618_0020187 Ga0495618_0020187_3064_3906 243
502 3300046516 Ga0495628_0027371 Ga0495628_0027371_301_1143 243
503 3300046517 Ga0495630_0027568 Ga0495630_0027568_2443_3249 243
504 3300046526 Ga0495666_0015461 Ga0495666_0015461_1171_1977 243
505 3300046529 Ga0495652_0031939 Ga0495652_0031939_3077_3883 243
506 3300046531 Ga0495665_0014532 Ga0495665_0014532_1068_1874 243
507 3300046533 Ga0495640_0002112 Ga0495640_0002112_9093_9899 243
508 3300046533 Ga0495640_0169235 Ga0495640_0169235_389_1231 243
509 3300046535 Ga0495586_0021968 Ga0495586_0021968_2261_3067 243
510 3300046536 Ga0495587_0040280 Ga0495587_0040280_806_1648 243
511 3300046536 Ga0495587_0071961 Ga0495587_0071961_965_1771 243
512 3300046543 Ga0495645_0014580 Ga0495645_0014580_2402_3208 243
513 3300046559 Ga0495667_0007380 Ga0495667_0007380_4278_5084 243
514 3300046559 Ga0495667_0048551 Ga0495667_0048551_625_1467 243
515 3300046642 Ga0495634_0028522 Ga0495634_0028522_818_1624 243
516 3300046675 Ga0495657_0001649 Ga0495657_0001649_818_1624 243
517 3300046675 Ga0495657_0058652 Ga0495657_0058652_1441_2283 243
518 3300046678 Ga0495599_0015082 Ga0495599_0015082_353_1195 243
519 3300046678 Ga0495599_0020997 Ga0495599_0020997_2372_3178 243
520 3300046679 Ga0495623_0023482 Ga0495623_0023482_1893_2735 243
521 3300046679 Ga0495623_0028615 Ga0495623_0028615_2186_2992 243
522 3300046680 Ga0495646_0011492 Ga0495646_0011492_2443_3249 243
523 3300046680 Ga0495646_0015911 Ga0495646_0015911_3659_4501 243
524 3300046681 Ga0495647_0040292 Ga0495647_0040292_120_926 243
525 3300046683 Ga0495658_0008962 Ga0495658_0008962_2233_3039 243
526 3300046689 Ga0495613_0016116 Ga0495613_0016116_4349_5155 243
527 3300046690 Ga0495624_0002996 Ga0495624_0002996_8184_8990 243
528 3300046809 Ga0495600_0013119 Ga0495600_0013119_4151_4957 243
529 3300047315 Ga0495581_0004124 Ga0495581_0004124_2404_3210 243
530 3300047317 Ga0495604_0022121 Ga0495604_0022121_3419_4261 243
531 3300047317 Ga0495604_0131823 Ga0495604_0131823_912_1718 243
532 3300047319 Ga0495674_0059461 Ga0495674_0059461_282_1088 243
533 3300047321 Ga0495676_0050282 Ga0495676_0050282_645_1451 243
534 3300047322 Ga0495680_0020131 Ga0495680_0020131_2443_3249 243
535 3300047322 Ga0495680_0052465 Ga0495680_0052465_1482_2324 243
536 3300047444 Ga0495675_0110803 Ga0495675_0110803_702_1544 243
537 3300047444 Ga0495675_0183634 Ga0495675_0183634_372_1178 243
538 3300047471 Ga0495684_0029692 Ga0495684_0029692_806_1648 243
539 3300047471 Ga0495684_0032688 Ga0495684_0032688_2372_3178 243
540 3300047673 Ga0495593_0000569 Ga0495593_0000569_13995_14801 243
541 3300048088 Ga0495602_0159394 Ga0495602_0159394_736_1542 243
542 3300048088 Ga0495602_0272519 Ga0495602_0272519_122_964 243
543 3300048089 Ga0495614_0013749 Ga0495614_0013749_1972_2778 243
544 3300048903 Ga0496100_0110499 Ga0496100_0110499_174_977 243
545 3300048904 Ga0496101_0055206 Ga0496101_0055206_228_1031 243
546 3300048905 Ga0496102_0222361 Ga0496102_0222361_786_1535 243
547 3300048906 Ga0496103_0354745 Ga0496103_0354745_158_907 243
548 3300048907 Ga0496104_0040529 Ga0496104_0040529_2632_3435 243
549 3300048908 Ga0496105_0003384 Ga0496105_0003384_504_1337 243
550 3300048908 Ga0496105_0022474 Ga0496105_0022474_156_959 243
551 3300048913 Ga0496110_0014490 Ga0496110_0014490_1731_2534 243
552 3300048913 Ga0496110_0678764 Ga0496110_0678764_72_839 243
553 3300048914 Ga0496111_0026244 Ga0496111_0026244_1714_2517 243
554 3300048915 Ga0496112_0281210 Ga0496112_0281210_497_1330 243
555 3300048916 Ga0496113_0271978 Ga0496113_0271978_24_857 243
556 3300048917 Ga0496114_0405368 Ga0496114_0405368_420_1187 243
557 3300048918 Ga0496115_0275242 Ga0496115_0275242_259_1077 243
558 3300049572 Ga0501036_0009108 Ga0501036_0009108_5969_6760 243
559 3300049574 Ga0501038_0117828 Ga0501038_0117828_1273_2064 243
560 3300049576 Ga0501040_0012841 Ga0501040_0012841_759_1550 243
561 3300049577 Ga0501041_0096193 Ga0501041_0096193_457_1248 243
562 3300049580 Ga0501046_0078427 Ga0501046_0078427_640_1431 243
563 3300049582 Ga0501048_0112403 Ga0501048_0112403_1111_1902 243
564 3300049585 Ga0501069_0162641 Ga0501069_0162641_249_1040 243
565 3300049587 Ga0501071_0032008 Ga0501071_0032008_2490_3281 243
566 3300049587 Ga0501071_0448650 Ga0501071_0448650_16_795 243
567 3300049588 Ga0501072_0059576 Ga0501072_0059576_869_1660 243
568 3300049588 Ga0501072_0098812 Ga0501072_0098812_131_874 243
569 3300049590 Ga0501074_0191911 Ga0501074_0191911_460_1251 243
570 3300049591 Ga0501075_0145032 Ga0501075_0145032_873_1664 243
571 3300049592 Ga0501076_0007978 Ga0501076_0007978_6879_7670 243
572 3300049593 Ga0501077_0085255 Ga0501077_0085255_91_882 243
573 3300049741 Ga0501079_0121616 Ga0501079_0121616_372_1163 243
574 3300049742 Ga0501080_0190582 Ga0501080_0190582_83_874 243
575 3300049743 Ga0501081_0034845 Ga0501081_0034845_129_920 243
576 3300049822 Ga0501035_0042510 Ga0501035_0042510_2067_2858 243
577 3300049823 Ga0501044_0085116 Ga0501044_0085116_1928_2686 243
578 3300049824 Ga0501045_0094897 Ga0501045_0094897_321_1112 243
579 3300050508 nmdc:mga09592_16026_c1 nmdc:mga09592_16026_c1_4038_4832 243
580 3300053077 Ga0495601_0100116 Ga0495601_0100116_221_1063 243
581 3300053078 Ga0495612_0007523 Ga0495612_0007523_1222_2028 243
582 3300053084 Ga0495595_0008824 Ga0495595_0008824_2938_3780 243
583 3300053084 Ga0495595_0022435 Ga0495595_0022435_1779_2585 243
584 3300053085 Ga0495619_0008048 Ga0495619_0008048_5585_6391 243
585 3300054114 Ga0501084_0038908 Ga0501084_0038908_1093_1884 243
586 3300061734 Ga0530510_0051263 Ga0530510_0051263_1371_2162 243
587 iso_pu_bacteria 2675903058 2676475787 243
588 iso_pu_bacteria 2811994882 2812374923 243
589 iso_pu_bacteria 2818991458 2819666525 243
590 iso_pu_bacteria 2827628540 2827630348 243
591 3300006028 Ga0070717_10117030 Ga0070717_101170302 244
592 3300006175 Ga0070712_100054075 Ga0070712_1000540751 244
593 3300014326 Ga0157380_10545556 Ga0157380_105455562 244
594 3300014745 Ga0157377_10015569 Ga0157377_100155695 244
595 3300021388 Ga0213875_10000246 Ga0213875_1000024633 244
596 3300031456 Ga0307513_10015320 Ga0307513_100153203 244
597 3300031903 Ga0307407_10432911 Ga0307407_104329111 244
598 3300031995 Ga0307409_100674669 Ga0307409_1006746691 244
599 3300032002 Ga0307416_100790717 Ga0307416_1007907172 244
600 3300037312 Ga0395899_0221190 Ga0395899_0221190_243_1025 244
601 3300037853 Ga0436364_0330965 Ga0436364_0330965_168615_169460 244
602 3300044901 Ga0466960_0309215 Ga0466960_0309215_127_870 244
603 3300047315 Ga0495581_0102609 Ga0495581_0102609_326_1087 244
604 3300049571 Ga0501034_0687686 Ga0501034_0687686_137_904 244
605 3300049572 Ga0501036_0001833 Ga0501036_0001833_10428_11195 244
606 3300049574 Ga0501038_0032357 Ga0501038_0032357_2989_3756 244
607 3300049575 Ga0501039_0042421 Ga0501039_0042421_1622_2389 244
608 3300049576 Ga0501040_0090813 Ga0501040_0090813_1237_1977 244
609 3300049577 Ga0501041_0020790 Ga0501041_0020790_213_980 244
610 3300049578 Ga0501042_0000649 Ga0501042_0000649_407_1174 244
611 3300049580 Ga0501046_0005754 Ga0501046_0005754_4136_4903 244
612 3300049582 Ga0501048_0009775 Ga0501048_0009775_2459_3226 244
613 3300049587 Ga0501071_0002819 Ga0501071_0002819_5455_6222 244
614 3300049591 Ga0501075_0002567 Ga0501075_0002567_4200_4967 244
615 3300049592 Ga0501076_0000957 Ga0501076_0000957_12771_13538 244
616 3300049741 Ga0501079_0010125 Ga0501079_0010125_4864_5631 244
617 3300049742 Ga0501080_0060935 Ga0501080_0060935_862_1629 244
618 3300049822 Ga0501035_0024974 Ga0501035_0024974_928_1695 244
619 3300049823 Ga0501044_0469996 Ga0501044_0469996_308_1141 244
620 3300060353 Ga0501082_0125486 Ga0501082_0125486_1439_2206 244
621 3300061734 Ga0530510_0567861 Ga0530510_0567861_11_754 244
622 iso_pu_bacteria 8057568493 8057572157 244
623 3300005435 Ga0070714_100283418 Ga0070714_1002834182 245
624 3300005530 Ga0070679_100724094 Ga0070679_1007240941 245
625 3300022467 Ga0224712_10031501 Ga0224712_100315012 245
626 3300025900 Ga0207710_10062505 Ga0207710_100625052 245
627 3300025929 Ga0207664_10251096 Ga0207664_102510962 245
628 3300031824 Ga0307413_10071465 Ga0307413_100714652 245
629 3300031903 Ga0307407_10018572 Ga0307407_100185722 245
630 3300035119 Ga0373956_0000526 Ga0373956_0000526_2969_3814 245
631 3300045976 Ga0466967_0516811 Ga0466967_0516811_162_1016 245
632 3300049572 Ga0501036_0415271 Ga0501036_0415271_255_1103 245
633 3300050513 nmdc:mga0rr50_648762_c1 nmdc:mga0rr50_648762_c1_54_881 245
634 iso_pu_bacteria 2622736605 2623498814 245
635 3300005345 Ga0070692_10161264 Ga0070692_101612642 246
636 3300005437 Ga0070710_10117965 Ga0070710_101179652 246
637 3300005536 Ga0070697_100549754 Ga0070697_1005497541 246
638 3300005563 Ga0068855_100264061 Ga0068855_1002640612 246
639 3300005841 Ga0068863_100030070 Ga0068863_1000300704 246
640 3300005842 Ga0068858_100027567 Ga0068858_1000275672 246
641 3300006028 Ga0070717_10506124 Ga0070717_105061241 246
642 3300009174 Ga0105241_10405854 Ga0105241_104058541 246
643 3300009545 Ga0105237_10324604 Ga0105237_103246041 246
644 3300013105 Ga0157369_10365266 Ga0157369_103652662 246
645 3300020082 Ga0206353_10923945 Ga0206353_109239452 246
646 3300025906 Ga0207699_10020192 Ga0207699_100201923 246
647 3300025916 Ga0207663_10011212 Ga0207663_100112124 246
648 3300025949 Ga0207667_10216254 Ga0207667_102162542 246
649 3300026035 Ga0207703_10332427 Ga0207703_103324272 246
650 3300026078 Ga0207702_10345493 Ga0207702_103454932 246
651 3300026088 Ga0207641_10046249 Ga0207641_100462493 246
652 3300026121 Ga0207683_10090790 Ga0207683_100907902 246
653 3300031852 Ga0307410_10006399 Ga0307410_100063994 246
654 3300031995 Ga0307409_100245395 Ga0307409_1002453951 246
655 3300035083 Ga0373926_0018669 Ga0373926_0018669_779_1675 246
656 3300035692 Ga0373935_0011145 Ga0373935_0011145_225_1121 246
657 3300035725 Ga0373947_0000001 Ga0373947_0000001_20655_21551 246
658 3300044901 Ga0466960_0006004 Ga0466960_0006004_3331_4101 246
659 3300045836 Ga0466958_0060857 Ga0466958_0060857_724_1494 246
660 3300045976 Ga0466967_0126443 Ga0466967_0126443_58_828 246
661 3300048907 Ga0496104_0006942 Ga0496104_0006942_5069_6001 246
662 3300048911 Ga0496108_0008373 Ga0496108_0008373_938_1870 246
663 3300048912 Ga0496109_0230463 Ga0496109_0230463_100_981 246
664 3300048914 Ga0496111_0124228 Ga0496111_0124228_263_1195 246
665 3300048917 Ga0496114_0300059 Ga0496114_0300059_470_1249 246
666 3300049581 Ga0501047_0128325 Ga0501047_0128325_92_955 246
667 3300049587 Ga0501071_0550768 Ga0501071_0550768_17_820 246
668 3300049593 Ga0501077_0090877 Ga0501077_0090877_44_907 246
669 iso_pu_bacteria 2808606365 2808874244 246
670 3300025928 Ga0207700_10523641 Ga0207700_105236412 247
671 3300031665 Ga0316575_10005740 Ga0316575_100057402 247
672 3300031665 Ga0316575_10062298 Ga0316575_100622982 247
673 3300031691 Ga0316579_10025305 Ga0316579_100253053 247
674 3300031691 Ga0316579_10036343 Ga0316579_100363432 247
675 3300031727 Ga0316576_10156747 Ga0316576_101567472 247
676 3300031728 Ga0316578_10003554 Ga0316578_100035547 247
677 3300032133 Ga0316583_10018043 Ga0316583_100180432 247
678 3300032139 Ga0316580_10010623 Ga0316580_100106232 247
679 3300032139 Ga0316580_10038578 Ga0316580_100385782 247
680 3300035117 Ga0373953_0051884 Ga0373953_0051884_425_1360 247
681 3300035398 Ga0316574_0002178 Ga0316574_0002178_1521_2387 247
682 3300035398 Ga0316574_0004825 Ga0316574_0004825_3296_4162 247
683 3300036647 Ga0316582_0000920 Ga0316582_0000920_5161_6027 247
684 3300036647 Ga0316582_0003300 Ga0316582_0003300_4336_5202 247
685 3300036712 Ga0316584_0004008 Ga0316584_0004008_5155_6021 247
686 3300038443 Ga0395901_0055761 Ga0395901_0055761_414_1265 247
687 3300044842 Ga0466957_0424456 Ga0466957_0424456_107_850 247
688 3300044901 Ga0466960_0078548 Ga0466960_0078548_700_1494 247
689 3300046473 Ga0495582_0051181 Ga0495582_0051181_356_1153 247
690 3300048903 Ga0496100_0010356 Ga0496100_0010356_2520_3347 247
691 3300048904 Ga0496101_0010359 Ga0496101_0010359_2189_3016 247
692 3300048905 Ga0496102_0005931 Ga0496102_0005931_8969_9796 247
693 3300048905 Ga0496102_0169839 Ga0496102_0169839_652_1446 247
694 3300048906 Ga0496103_0003620 Ga0496103_0003620_3628_4455 247
695 3300048907 Ga0496104_0023189 Ga0496104_0023189_1068_1895 247
696 3300048908 Ga0496105_0030630 Ga0496105_0030630_1930_2757 247
697 3300048909 Ga0496106_0258829 Ga0496106_0258829_553_1368 247
698 3300048910 Ga0496107_0271197 Ga0496107_0271197_311_1138 247
699 3300048912 Ga0496109_0024968 Ga0496109_0024968_3946_4755 247
700 3300048913 Ga0496110_0119418 Ga0496110_0119418_1543_2352 247
701 3300048917 Ga0496114_0019240 Ga0496114_0019240_2804_3631 247
702 3300048918 Ga0496115_0179456 Ga0496115_0179456_884_1678 247
703 iso_pu_bacteria 2643221711 2644609769 247
704 iso_pu_bacteria 2818991462 2819691680 247
705 iso_pu_bacteria 2818991469 2819729540 247
706 iso_pu_bacteria 2919446982 2919450356 247
707 iso_pu_bacteria 8053945823 8053953271 247
708 3300000549 LJQas_1005059 LJQas_10050592 248
709 3300005366 Ga0070659_100704001 Ga0070659_1007040011 248
710 3300005535 Ga0070684_100264206 Ga0070684_1002642062 248
711 3300005615 Ga0070702_100511370 Ga0070702_1005113701 248
712 3300005985 Ga0081539_10044133 Ga0081539_100441332 248
713 3300013105 Ga0157369_10624857 Ga0157369_106248572 248
714 3300020082 Ga0206353_11320916 Ga0206353_113209162 248
715 3300025944 Ga0207661_10111374 Ga0207661_101113741 248
716 3300031548 Ga0307408_100640688 Ga0307408_1006406882 248
717 3300031731 Ga0307405_10288906 Ga0307405_102889061 248
718 3300031731 Ga0307405_10320123 Ga0307405_103201232 248
719 3300031824 Ga0307413_10032019 Ga0307413_100320193 248
720 3300031903 Ga0307407_10129827 Ga0307407_101298272 248
721 3300031911 Ga0307412_10083650 Ga0307412_100836502 248
722 3300031995 Ga0307409_100017289 Ga0307409_1000172896 248
723 3300031995 Ga0307409_100050997 Ga0307409_1000509973 248
724 3300031995 Ga0307409_100054320 Ga0307409_1000543204 248
725 3300031995 Ga0307409_100289150 Ga0307409_1002891502 248
726 3300031995 Ga0307409_100342953 Ga0307409_1003429532 248
727 3300032002 Ga0307416_100179539 Ga0307416_1001795392 248
728 3300032002 Ga0307416_100280868 Ga0307416_1002808682 248
729 3300032004 Ga0307414_10382740 Ga0307414_103827402 248
730 3300032004 Ga0307414_10838568 Ga0307414_108385681 248
731 3300032005 Ga0307411_10272949 Ga0307411_102729492 248
732 3300032126 Ga0307415_100034933 Ga0307415_1000349332 248
733 3300032126 Ga0307415_100155672 Ga0307415_1001556722 248
734 3300032126 Ga0307415_100155731 Ga0307415_1001557312 248
735 3300038443 Ga0395901_0011041 Ga0395901_0011041_3639_4385 248
736 3300044658 Ga0466972_0148186 Ga0466972_0148186_154_960 248
737 3300044694 Ga0466963_0058036 Ga0466963_0058036_535_1314 248
738 3300044694 Ga0466963_0077566 Ga0466963_0077566_787_1533 248
739 3300044719 Ga0466971_0116137 Ga0466971_0116137_15_761 248
740 3300044765 Ga0466970_0064875 Ga0466970_0064875_826_1572 248
741 3300044842 Ga0466957_0093478 Ga0466957_0093478_145_891 248
742 3300044842 Ga0466957_0171524 Ga0466957_0171524_402_1208 248
743 3300044901 Ga0466960_0097842 Ga0466960_0097842_591_1364 248
744 3300045049 Ga0466959_0076439 Ga0466959_0076439_324_1070 248
745 3300045836 Ga0466958_0103389 Ga0466958_0103389_759_1505 248
746 3300045836 Ga0466958_0197067 Ga0466958_0197067_141_920 248
747 3300045836 Ga0466958_0324865 Ga0466958_0324865_169_975 248
748 3300045976 Ga0466967_0012950 Ga0466967_0012950_1974_2723 248
749 3300049580 Ga0501046_0315915 Ga0501046_0315915_98_856 248
750 3300049591 Ga0501075_0482994 Ga0501075_0482994_32_790 248
751 3300061719 Ga0466962_0068918 Ga0466962_0068918_387_1133 248
752 3300061719 Ga0466962_0091563 Ga0466962_0091563_650_1396 248
753 iso_pu_bacteria 2643221679 2644444997 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16554

OAM_dimer

Dimerisation domain of d-ornithine 4,5-aminomutase

26

108

0.91

PF02310

B12-binding

B12 binding domain

131

258

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.83 105 241
2i2x-assembly1.cif.gz_B crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri 0.8182 107 244
1y80-assembly1.cif.gz_A structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica 0.8084 104 237
2yxb-assembly1.cif.gz_A crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix 0.8071 104 239
1ccw-assembly1.cif.gz_C structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium 0.8005 104 241
ID Description Score Start End Superfamily
1xrsB01 Alpha Beta;2-Layer Sandwich;Defensin A-like;D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain 0.978 19 69 3.30.30.60
1xrsB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9561 87 241 3.40.50.280
1xrsB01 Alpha Beta;2-Layer Sandwich;Defensin A-like;D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain 0.9419 19 69 3.30.30.60
1xrsB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.9216 87 241 3.40.50.280
3kowB04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.908 89 240 3.40.50.280
ID Description Score Start End GO Terms
AF-A0A645GME8-F1-model_v4 Lysine 5,6-aminomutase beta subunit (EC 5.4.3.3) 0.9581 89 242 GO:0031419
GO:0046872
GO:0047826
AF-A0A353LXU6-F1-model_v4 B12-binding domain-containing protein 0.9568 105 241 GO:0031419
GO:0046872
AF-A0A3D1QZG5-F1-model_v4 B12-binding domain-containing protein 0.9507 125 240 GO:0031419
GO:0046872
AF-A0A838KJI0-F1-model_v4 Cobalamin B12-binding domain-containing protein 0.9436 93 248 GO:0031419
GO:0046872
AF-A0A3C0FCE1-F1-model_v4 B12-binding domain-containing protein 0.9389 146 241 GO:0031419
GO:0046872

Feature Viewer

pLDDT pTM Quality
90.86 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map