F479196
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 753 | 326 | 738 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100264061|Ga0068855_1002640612 |
| Length | 310 |
| Sequence | MTTASAGQSLSGPERASQHSDQDRKIVRPYGDTTGDGRVQLSFTLPVPYGTSEQRARAEGAALQLAAKMGMDPAMVVHAKGMGPDFTFFIVYGRVAHLVDLSEVIVAEREFPLLPAAEINLRIRSALGRKLVVVGACIGTDAHTVGIDAILNVKGHAGEKGLEYYREMRIVNLGAQVAVPDLVARARAEQADAVLVSQVVTQRDAHLNNTREMAAAFRAAGPPQPLLVVGGPRFAPGTEAGLGVDKIFGKGTGPGEVASYLAHALAPASAKAAALPGLTSDEGARREGGASKRPEHELNSTAGAGGSGGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 2 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 3 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 4 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 5 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 6 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 7 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 8 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 9 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 10 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 11 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 12 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 13 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 14 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 104 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 150 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 160 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 161 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 162 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 175 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 202 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 325 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 326 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.21 |
| Metatranscriptomes | 0.8 |
| Isolates | 1.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 5.84 |
| Rhizosphere | 92.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1005059 | 3300000549 | Bacteria | 1685 |
| 2 | JGI25406J46586_10011340 | 3300003203 | Bacteria | 3914 |
| 3 | JGI25404J52841_10004335 | 3300003659 | Bacteria | 2867 |
| 4 | Ga0070658_10010707 | 3300005327 | Bacteria | 7347 |
| 5 | Ga0070658_10059220 | 3300005327 | Bacteria | 3119 |
| 6 | Ga0070658_10123451 | 3300005327 | Bacteria | 2153 |
| 7 | Ga0070676_10124606 | 3300005328 | Bacteria | 1621 |
| 8 | Ga0070683_100053379 | 3300005329 | Bacteria | 3745 |
| 9 | Ga0070690_100028460 | 3300005330 | Bacteria | 3462 |
| 10 | Ga0070682_100196382 | 3300005337 | Bacteria | 1420 |
| 11 | Ga0070689_100111574 | 3300005340 | Bacteria | 2175 |
| 12 | Ga0070687_100164203 | 3300005343 | Bacteria | 1316 |
| 13 | Ga0070661_100046183 | 3300005344 | Bacteria | 3186 |
| 14 | Ga0070692_10042979 | 3300005345 | Bacteria | 2323 |
| 15 | Ga0070692_10161264 | 3300005345 | Bacteria | 1285 |
| 16 | Ga0070671_100024167 | 3300005355 | Bacteria | 4973 |
| 17 | Ga0070674_100314731 | 3300005356 | Bacteria | 1253 |
| 18 | Ga0070674_100353782 | 3300005356 | Bacteria | 1187 |
| 19 | Ga0070673_100102503 | 3300005364 | Bacteria | 2359 |
| 20 | Ga0070688_100035000 | 3300005365 | Bacteria | 3048 |
| 21 | Ga0070659_100127615 | 3300005366 | Bacteria | 2064 |
| 22 | Ga0070659_100129965 | 3300005366 | Bacteria | 2045 |
| 23 | Ga0070659_100704001 | 3300005366 | Bacteria | 874 |
| 24 | Ga0070667_100051490 | 3300005367 | Bacteria | 3472 |
| 25 | Ga0070709_10000198 | 3300005434 | Bacteria | 38521 |
| 26 | Ga0070709_10443742 | 3300005434 | Bacteria | 976 |
| 27 | Ga0070714_100003316 | 3300005435 | Bacteria | 12006 |
| 28 | Ga0070714_100008683 | 3300005435 | Bacteria | 7945 |
| 29 | Ga0070714_100179288 | 3300005435 | Bacteria | 1927 |
| 30 | Ga0070714_100283418 | 3300005435 | Bacteria | 1540 |
| 31 | Ga0070713_100025012 | 3300005436 | Bacteria | 4661 |
| 32 | Ga0070713_100233704 | 3300005436 | Bacteria | 1672 |
| 33 | Ga0070710_10003510 | 3300005437 | Bacteria | 7431 |
| 34 | Ga0070710_10049041 | 3300005437 | Bacteria | 2360 |
| 35 | Ga0070710_10082152 | 3300005437 | Bacteria | 1883 |
| 36 | Ga0070710_10117965 | 3300005437 | Bacteria | 1602 |
| 37 | Ga0070710_10204129 | 3300005437 | Bacteria | 1249 |
| 38 | Ga0070711_100009129 | 3300005439 | Bacteria | 6093 |
| 39 | Ga0070711_100039016 | 3300005439 | Bacteria | 3196 |
| 40 | Ga0070711_100323697 | 3300005439 | Bacteria | 1232 |
| 41 | Ga0070705_100001031 | 3300005440 | Bacteria | 15524 |
| 42 | Ga0070705_100106053 | 3300005440 | Bacteria | 1785 |
| 43 | Ga0070708_100181706 | 3300005445 | Bacteria | 1966 |
| 44 | Ga0070708_100853291 | 3300005445 | Bacteria | 855 |
| 45 | Ga0070678_100491116 | 3300005456 | Bacteria | 1082 |
| 46 | Ga0070681_10078952 | 3300005458 | Bacteria | 3248 |
| 47 | Ga0070706_100005940 | 3300005467 | Bacteria | 11542 |
| 48 | Ga0070706_100016022 | 3300005467 | Bacteria | 6923 |
| 49 | Ga0070706_100056829 | 3300005467 | Bacteria | 3610 |
| 50 | Ga0070706_100132282 | 3300005467 | Bacteria | 2328 |
| 51 | Ga0070707_100087282 | 3300005468 | Bacteria | 3017 |
| 52 | Ga0070707_100144402 | 3300005468 | Bacteria | 2316 |
| 53 | Ga0070698_100001515 | 3300005471 | Bacteria | 25747 |
| 54 | Ga0070698_100001616 | 3300005471 | Bacteria | 25085 |
| 55 | Ga0070698_100109039 | 3300005471 | Bacteria | 2735 |
| 56 | Ga0070699_100000578 | 3300005518 | Bacteria | 34737 |
| 57 | Ga0070699_100325164 | 3300005518 | Bacteria | 1383 |
| 58 | Ga0070699_100418972 | 3300005518 | Bacteria | 1212 |
| 59 | Ga0070679_100074346 | 3300005530 | Bacteria | 3389 |
| 60 | Ga0070679_100190272 | 3300005530 | Bacteria | 2021 |
| 61 | Ga0070679_100724094 | 3300005530 | Bacteria | 938 |
| 62 | Ga0070684_100079780 | 3300005535 | Bacteria | 2894 |
| 63 | Ga0070684_100159237 | 3300005535 | Bacteria | 2047 |
| 64 | Ga0070684_100215054 | 3300005535 | Bacteria | 1753 |
| 65 | Ga0070684_100264206 | 3300005535 | Bacteria | 1575 |
| 66 | Ga0070697_100003261 | 3300005536 | Bacteria | 12465 |
| 67 | Ga0070697_100549754 | 3300005536 | Bacteria | 1012 |
| 68 | Ga0068853_100339466 | 3300005539 | Bacteria | 1395 |
| 69 | Ga0070686_100048347 | 3300005544 | Bacteria | 2694 |
| 70 | Ga0070693_100116170 | 3300005547 | Bacteria | 1654 |
| 71 | Ga0070704_100143008 | 3300005549 | Bacteria | 1870 |
| 72 | Ga0068855_100264061 | 3300005563 | Bacteria | 1917 |
| 73 | Ga0070664_100071861 | 3300005564 | Bacteria | 2966 |
| 74 | Ga0070664_100353640 | 3300005564 | Bacteria | 1337 |
| 75 | Ga0068857_100180481 | 3300005577 | Bacteria | 1921 |
| 76 | Ga0070702_100020323 | 3300005615 | Bacteria | 3476 |
| 77 | Ga0070702_100077130 | 3300005615 | Bacteria | 1985 |
| 78 | Ga0070702_100511370 | 3300005615 | Bacteria | 884 |
| 79 | Ga0068852_100216176 | 3300005616 | Bacteria | 1821 |
| 80 | Ga0068859_100260772 | 3300005617 | Bacteria | 1824 |
| 81 | Ga0068864_100107526 | 3300005618 | Bacteria | 2481 |
| 82 | Ga0068864_100356716 | 3300005618 | Bacteria | 1381 |
| 83 | Ga0068863_100030070 | 3300005841 | Bacteria | 5188 |
| 84 | Ga0068858_100027567 | 3300005842 | Bacteria | 5277 |
| 85 | Ga0068858_100090185 | 3300005842 | Bacteria | 2852 |
| 86 | Ga0068858_100892930 | 3300005842 | Bacteria | 869 |
| 87 | Ga0081455_10004970 | 3300005937 | Bacteria | 14708 |
| 88 | Ga0081540_1000074 | 3300005983 | Bacteria | 107172 |
| 89 | Ga0081540_1001512 | 3300005983 | Bacteria | 19996 |
| 90 | Ga0081539_10000421 | 3300005985 | Bacteria | 90163 |
| 91 | Ga0081539_10044133 | 3300005985 | Bacteria | 2576 |
| 92 | Ga0070717_10000010 | 3300006028 | Bacteria | 283501 |
| 93 | Ga0070717_10082257 | 3300006028 | Bacteria | 2705 |
| 94 | Ga0070717_10117030 | 3300006028 | Bacteria | 2279 |
| 95 | Ga0070717_10298981 | 3300006028 | Bacteria | 1431 |
| 96 | Ga0070717_10506124 | 3300006028 | Bacteria | 1092 |
| 97 | Ga0070715_10001650 | 3300006163 | Bacteria | 6609 |
| 98 | Ga0070715_10004966 | 3300006163 | Bacteria | 4407 |
| 99 | Ga0070716_100000184 | 3300006173 | Bacteria | 24485 |
| 100 | Ga0070716_100017725 | 3300006173 | Bacteria | 3697 |
| 101 | Ga0070716_100049276 | 3300006173 | Bacteria | 2385 |
| 102 | Ga0070712_100054075 | 3300006175 | Bacteria | 2805 |
| 103 | Ga0070712_100349679 | 3300006175 | Bacteria | 1209 |
| 104 | Ga0075428_100050071 | 3300006844 | Bacteria | 4582 |
| 105 | Ga0075433_10043688 | 3300006852 | Bacteria | 3891 |
| 106 | Ga0075434_100037030 | 3300006871 | Bacteria | 4828 |
| 107 | Ga0075429_100015337 | 3300006880 | Bacteria | 6640 |
| 108 | Ga0075429_100268463 | 3300006880 | Bacteria | 1494 |
| 109 | Ga0068865_100135885 | 3300006881 | Bacteria | 1848 |
| 110 | Ga0075436_100055144 | 3300006914 | Bacteria | 2744 |
| 111 | Ga0075436_100124083 | 3300006914 | Bacteria | 1808 |
| 112 | Ga0097620_100260786 | 3300006931 | Bacteria | 1824 |
| 113 | Ga0075435_100109014 | 3300007076 | Bacteria | 2301 |
| 114 | Ga0075435_100229163 | 3300007076 | Bacteria | 1578 |
| 115 | Ga0075435_100449846 | 3300007076 | Bacteria | 1111 |
| 116 | Ga0099795_10080728 | 3300007788 | Bacteria | 1244 |
| 117 | Ga0105245_10072114 | 3300009098 | Bacteria | 3137 |
| 118 | Ga0105245_10100901 | 3300009098 | Bacteria | 2671 |
| 119 | Ga0105245_10151002 | 3300009098 | Bacteria | 2197 |
| 120 | Ga0105247_10028545 | 3300009101 | Bacteria | 3377 |
| 121 | Ga0114129_10043767 | 3300009147 | Bacteria | 6300 |
| 122 | Ga0105243_10018288 | 3300009148 | Bacteria | 5307 |
| 123 | Ga0105243_10029708 | 3300009148 | Bacteria | 4205 |
| 124 | Ga0105243_10373435 | 3300009148 | Bacteria | 1316 |
| 125 | Ga0105241_10020146 | 3300009174 | Bacteria | 4927 |
| 126 | Ga0105241_10405854 | 3300009174 | Bacteria | 1196 |
| 127 | Ga0105242_10036596 | 3300009176 | Bacteria | 3939 |
| 128 | Ga0105242_10059768 | 3300009176 | Bacteria | 3129 |
| 129 | Ga0105248_10078501 | 3300009177 | Bacteria | 3711 |
| 130 | Ga0105237_10324604 | 3300009545 | Bacteria | 1543 |
| 131 | Ga0105238_10033058 | 3300009551 | Bacteria | 5263 |
| 132 | Ga0105238_10126613 | 3300009551 | Bacteria | 2533 |
| 133 | Ga0105238_10391132 | 3300009551 | Bacteria | 1383 |
| 134 | Ga0105238_10472690 | 3300009551 | Bacteria | 1252 |
| 135 | Ga0105238_10864944 | 3300009551 | Bacteria | 921 |
| 136 | Ga0105249_10033268 | 3300009553 | Bacteria | 4667 |
| 137 | Ga0105249_10234369 | 3300009553 | Bacteria | 1812 |
| 138 | Ga0105246_10003753 | 3300011119 | Bacteria | 9204 |
| 139 | Ga0105246_10018223 | 3300011119 | Bacteria | 4474 |
| 140 | Ga0157371_10027044 | 3300013102 | Bacteria | 4164 |
| 141 | Ga0157371_10032175 | 3300013102 | Bacteria | 3776 |
| 142 | Ga0157370_10191124 | 3300013104 | Bacteria | 1900 |
| 143 | Ga0157369_10118212 | 3300013105 | Bacteria | 2814 |
| 144 | Ga0157369_10365266 | 3300013105 | Bacteria | 1498 |
| 145 | Ga0157369_10624857 | 3300013105 | Bacteria | 1111 |
| 146 | Ga0157374_10528145 | 3300013296 | Bacteria | 1186 |
| 147 | Ga0157378_10013756 | 3300013297 | Bacteria | 7078 |
| 148 | Ga0157378_10048437 | 3300013297 | Bacteria | 3779 |
| 149 | Ga0163162_10394642 | 3300013306 | Bacteria | 1516 |
| 150 | Ga0157372_11077247 | 3300013307 | Bacteria | 930 |
| 151 | Ga0157375_10048920 | 3300013308 | Bacteria | 4139 |
| 152 | Ga0157375_10094505 | 3300013308 | Bacteria | 3058 |
| 153 | Ga0157375_10450910 | 3300013308 | Bacteria | 1452 |
| 154 | Ga0163163_10042895 | 3300014325 | Bacteria | 4433 |
| 155 | Ga0163163_10061786 | 3300014325 | Bacteria | 3712 |
| 156 | Ga0163163_10079433 | 3300014325 | Bacteria | 3279 |
| 157 | Ga0157380_10545556 | 3300014326 | Bacteria | 1136 |
| 158 | Ga0157380_10904340 | 3300014326 | Bacteria | 909 |
| 159 | Ga0157377_10015569 | 3300014745 | Bacteria | 3895 |
| 160 | Ga0157379_10209688 | 3300014968 | Bacteria | 1763 |
| 161 | Ga0157376_10097371 | 3300014969 | Bacteria | 2563 |
| 162 | Ga0157376_10467377 | 3300014969 | Bacteria | 1234 |
| 163 | Ga0206350_10114685 | 3300020080 | Bacteria | 2569 |
| 164 | Ga0206353_10923945 | 3300020082 | Bacteria | 1837 |
| 165 | Ga0206353_11135489 | 3300020082 | Bacteria | 2017 |
| 166 | Ga0206353_11320916 | 3300020082 | Bacteria | 2018 |
| 167 | Ga0213875_10000246 | 3300021388 | Bacteria | 54368 |
| 168 | Ga0213875_10015906 | 3300021388 | Bacteria | 3655 |
| 169 | Ga0224712_10029195 | 3300022467 | Bacteria | 1978 |
| 170 | Ga0224712_10031501 | 3300022467 | Bacteria | 1924 |
| 171 | Ga0207692_10000151 | 3300025898 | Bacteria | 21926 |
| 172 | Ga0207692_10000912 | 3300025898 | Bacteria | 10677 |
| 173 | Ga0207692_10053047 | 3300025898 | Bacteria | 2063 |
| 174 | Ga0207692_10127797 | 3300025898 | Bacteria | 1431 |
| 175 | Ga0207692_10175423 | 3300025898 | Bacteria | 1245 |
| 176 | Ga0207642_10020865 | 3300025899 | Bacteria | 2568 |
| 177 | Ga0207710_10062505 | 3300025900 | Bacteria | 1692 |
| 178 | Ga0207688_10010067 | 3300025901 | Bacteria | 5142 |
| 179 | Ga0207688_10160785 | 3300025901 | Bacteria | 1331 |
| 180 | Ga0207647_10051605 | 3300025904 | Bacteria | 2541 |
| 181 | Ga0207685_10043655 | 3300025905 | Bacteria | 1691 |
| 182 | Ga0207699_10000357 | 3300025906 | Bacteria | 24151 |
| 183 | Ga0207699_10008137 | 3300025906 | Bacteria | 5161 |
| 184 | Ga0207699_10020192 | 3300025906 | Bacteria | 3565 |
| 185 | Ga0207699_10119325 | 3300025906 | Bacteria | 1703 |
| 186 | Ga0207699_10210466 | 3300025906 | Bacteria | 1322 |
| 187 | Ga0207699_10269658 | 3300025906 | Bacteria | 1179 |
| 188 | Ga0207645_10030978 | 3300025907 | Bacteria | 3445 |
| 189 | Ga0207684_10005619 | 3300025910 | Bacteria | 11532 |
| 190 | Ga0207684_10045396 | 3300025910 | Bacteria | 3728 |
| 191 | Ga0207684_10063805 | 3300025910 | Bacteria | 3127 |
| 192 | Ga0207684_10110666 | 3300025910 | Bacteria | 2351 |
| 193 | Ga0207684_10290658 | 3300025910 | Bacteria | 1409 |
| 194 | Ga0207707_10291145 | 3300025912 | Bacteria | 1413 |
| 195 | Ga0207693_10016510 | 3300025915 | Bacteria | 5899 |
| 196 | Ga0207693_10101953 | 3300025915 | Bacteria | 2251 |
| 197 | Ga0207663_10003484 | 3300025916 | Bacteria | 7702 |
| 198 | Ga0207663_10011212 | 3300025916 | Bacteria | 4805 |
| 199 | Ga0207663_10131254 | 3300025916 | Bacteria | 1731 |
| 200 | Ga0207663_10222518 | 3300025916 | Bacteria | 1374 |
| 201 | Ga0207657_10010958 | 3300025919 | Bacteria | 9017 |
| 202 | Ga0207652_10198611 | 3300025921 | Bacteria | 1805 |
| 203 | Ga0207652_10434379 | 3300025921 | Bacteria | 1184 |
| 204 | Ga0207646_10033173 | 3300025922 | Bacteria | 4672 |
| 205 | Ga0207646_10156719 | 3300025922 | Bacteria | 2054 |
| 206 | Ga0207646_10314678 | 3300025922 | Bacteria | 1415 |
| 207 | Ga0207694_10072412 | 3300025924 | Bacteria | 2694 |
| 208 | Ga0207659_10488413 | 3300025926 | Bacteria | 1041 |
| 209 | Ga0207687_10109198 | 3300025927 | Bacteria | 2049 |
| 210 | Ga0207700_10000404 | 3300025928 | Bacteria | 25243 |
| 211 | Ga0207700_10047188 | 3300025928 | Bacteria | 3191 |
| 212 | Ga0207700_10225360 | 3300025928 | Bacteria | 1591 |
| 213 | Ga0207700_10250710 | 3300025928 | Bacteria | 1512 |
| 214 | Ga0207700_10258258 | 3300025928 | Bacteria | 1491 |
| 215 | Ga0207700_10354516 | 3300025928 | Bacteria | 1278 |
| 216 | Ga0207700_10523641 | 3300025928 | Bacteria | 1051 |
| 217 | Ga0207700_10551826 | 3300025928 | Bacteria | 1023 |
| 218 | Ga0207664_10000484 | 3300025929 | Bacteria | 28320 |
| 219 | Ga0207664_10000644 | 3300025929 | Bacteria | 24188 |
| 220 | Ga0207664_10001557 | 3300025929 | Bacteria | 15047 |
| 221 | Ga0207664_10015225 | 3300025929 | Bacteria | 5577 |
| 222 | Ga0207664_10020568 | 3300025929 | Bacteria | 4894 |
| 223 | Ga0207664_10044030 | 3300025929 | Bacteria | 3493 |
| 224 | Ga0207664_10094408 | 3300025929 | Bacteria | 2458 |
| 225 | Ga0207664_10134335 | 3300025929 | Bacteria | 2086 |
| 226 | Ga0207664_10207160 | 3300025929 | Bacteria | 1695 |
| 227 | Ga0207664_10251096 | 3300025929 | Bacteria | 1544 |
| 228 | Ga0207664_10349597 | 3300025929 | Bacteria | 1308 |
| 229 | Ga0207664_10650528 | 3300025929 | Bacteria | 947 |
| 230 | Ga0207690_10011248 | 3300025932 | Bacteria | 5344 |
| 231 | Ga0207706_10021574 | 3300025933 | Bacteria | 5782 |
| 232 | Ga0207686_10211175 | 3300025934 | Bacteria | 1395 |
| 233 | Ga0207665_10000042 | 3300025939 | Bacteria | 82783 |
| 234 | Ga0207665_10004055 | 3300025939 | Bacteria | 9776 |
| 235 | Ga0207665_10005391 | 3300025939 | Bacteria | 8540 |
| 236 | Ga0207665_10105239 | 3300025939 | Bacteria | 1976 |
| 237 | Ga0207691_10021065 | 3300025940 | Bacteria | 6160 |
| 238 | Ga0207711_10095258 | 3300025941 | Bacteria | 2625 |
| 239 | Ga0207689_10018569 | 3300025942 | Bacteria | 5866 |
| 240 | Ga0207661_10111374 | 3300025944 | Bacteria | 2316 |
| 241 | Ga0207667_10216254 | 3300025949 | Bacteria | 1964 |
| 242 | Ga0207668_10440511 | 3300025972 | Bacteria | 1110 |
| 243 | Ga0207658_10067006 | 3300025986 | Bacteria | 2703 |
| 244 | Ga0207703_10089636 | 3300026035 | Bacteria | 2583 |
| 245 | Ga0207703_10332427 | 3300026035 | Bacteria | 1394 |
| 246 | Ga0207678_10000752 | 3300026067 | Bacteria | 29608 |
| 247 | Ga0207678_10401187 | 3300026067 | Bacteria | 1187 |
| 248 | Ga0207708_10030540 | 3300026075 | Bacteria | 4086 |
| 249 | Ga0207702_10026614 | 3300026078 | Bacteria | 4802 |
| 250 | Ga0207702_10258128 | 3300026078 | Bacteria | 1640 |
| 251 | Ga0207702_10345493 | 3300026078 | Bacteria | 1422 |
| 252 | Ga0207702_10460060 | 3300026078 | Bacteria | 1236 |
| 253 | Ga0207641_10046249 | 3300026088 | Bacteria | 3668 |
| 254 | Ga0207676_10091777 | 3300026095 | Bacteria | 2496 |
| 255 | Ga0207676_10205945 | 3300026095 | Bacteria | 1741 |
| 256 | Ga0207674_10061630 | 3300026116 | Bacteria | 3789 |
| 257 | Ga0207675_100020030 | 3300026118 | Bacteria | 6242 |
| 258 | Ga0207683_10012993 | 3300026121 | Bacteria | 7106 |
| 259 | Ga0207683_10090790 | 3300026121 | Bacteria | 2721 |
| 260 | Ga0207683_10259273 | 3300026121 | Bacteria | 1587 |
| 261 | Ga0207428_10114133 | 3300027907 | Bacteria | 2076 |
| 262 | Ga0268266_10338612 | 3300028379 | Bacteria | 1412 |
| 263 | Ga0268265_10032110 | 3300028380 | Bacteria | 3800 |
| 264 | Ga0268264_10797672 | 3300028381 | Bacteria | 943 |
| 265 | Ga0265326_10000008 | 3300028558 | Bacteria | 210923 |
| 266 | Ga0265319_1001253 | 3300028563 | Bacteria | 15479 |
| 267 | Ga0265334_10000152 | 3300028573 | Bacteria | 42908 |
| 268 | Ga0265336_10013374 | 3300028666 | Bacteria | 2738 |
| 269 | Ga0265336_10013987 | 3300028666 | Bacteria | 2667 |
| 270 | Ga0265338_10001861 | 3300028800 | Bacteria | 33146 |
| 271 | Ga0265338_10008474 | 3300028800 | Bacteria | 12479 |
| 272 | Ga0265324_10003605 | 3300029957 | Bacteria | 7285 |
| 273 | Ga0265320_10073255 | 3300031240 | Bacteria | 1610 |
| 274 | Ga0265327_10014535 | 3300031251 | Bacteria | 5143 |
| 275 | Ga0307513_10015320 | 3300031456 | Bacteria | 9298 |
| 276 | Ga0307408_100640688 | 3300031548 | Bacteria | 949 |
| 277 | Ga0316575_10005740 | 3300031665 | Bacteria | 4432 |
| 278 | Ga0316575_10062298 | 3300031665 | Bacteria | 1491 |
| 279 | Ga0316579_10025305 | 3300031691 | Bacteria | 2678 |
| 280 | Ga0316579_10036343 | 3300031691 | Bacteria | 2272 |
| 281 | Ga0316576_10156747 | 3300031727 | Bacteria | 1716 |
| 282 | Ga0316578_10003554 | 3300031728 | Bacteria | 7158 |
| 283 | Ga0307405_10288906 | 3300031731 | Bacteria | 1238 |
| 284 | Ga0307405_10320123 | 3300031731 | Bacteria | 1184 |
| 285 | Ga0307413_10032019 | 3300031824 | Bacteria | 2975 |
| 286 | Ga0307413_10071465 | 3300031824 | Bacteria | 2187 |
| 287 | Ga0307413_10289124 | 3300031824 | Bacteria | 1237 |
| 288 | Ga0307410_10006399 | 3300031852 | Bacteria | 6354 |
| 289 | Ga0307406_10042549 | 3300031901 | Bacteria | 2836 |
| 290 | Ga0307407_10018572 | 3300031903 | Bacteria | 3520 |
| 291 | Ga0307407_10129827 | 3300031903 | Bacteria | 1610 |
| 292 | Ga0307407_10158111 | 3300031903 | Bacteria | 1480 |
| 293 | Ga0307407_10432911 | 3300031903 | Bacteria | 951 |
| 294 | Ga0307412_10083650 | 3300031911 | Bacteria | 2213 |
| 295 | Ga0307412_10377997 | 3300031911 | Bacteria | 1146 |
| 296 | Ga0307409_100017289 | 3300031995 | Bacteria | 4802 |
| 297 | Ga0307409_100026214 | 3300031995 | Bacteria | 4106 |
| 298 | Ga0307409_100050997 | 3300031995 | Bacteria | 3164 |
| 299 | Ga0307409_100054320 | 3300031995 | Bacteria | 3084 |
| 300 | Ga0307409_100245395 | 3300031995 | Bacteria | 1633 |
| 301 | Ga0307409_100289150 | 3300031995 | Bacteria | 1519 |
| 302 | Ga0307409_100342953 | 3300031995 | Bacteria | 1406 |
| 303 | Ga0307409_100674669 | 3300031995 | Bacteria | 1030 |
| 304 | Ga0307416_100179539 | 3300032002 | Bacteria | 1982 |
| 305 | Ga0307416_100280868 | 3300032002 | Bacteria | 1641 |
| 306 | Ga0307416_100349572 | 3300032002 | Bacteria | 1495 |
| 307 | Ga0307416_100790717 | 3300032002 | Bacteria | 1044 |
| 308 | Ga0307414_10382740 | 3300032004 | Bacteria | 1217 |
| 309 | Ga0307414_10838568 | 3300032004 | Bacteria | 840 |
| 310 | Ga0307411_10272949 | 3300032005 | Bacteria | 1342 |
| 311 | Ga0307415_100034933 | 3300032126 | Bacteria | 3278 |
| 312 | Ga0307415_100155672 | 3300032126 | Bacteria | 1764 |
| 313 | Ga0307415_100155731 | 3300032126 | Bacteria | 1764 |
| 314 | Ga0316583_10018043 | 3300032133 | Bacteria | 2534 |
| 315 | Ga0316580_10010623 | 3300032139 | Bacteria | 2787 |
| 316 | Ga0316580_10038578 | 3300032139 | Bacteria | 1476 |
| 317 | Ga0373926_0018669 | 3300035083 | Bacteria | 2387 |
| 318 | Ga0373926_0056493 | 3300035083 | Bacteria | 1424 |
| 319 | Ga0373928_0004087 | 3300035084 | Bacteria | 2781 |
| 320 | Ga0373934_0000025 | 3300035086 | Bacteria | 49119 |
| 321 | Ga0373934_0012177 | 3300035086 | Bacteria | 3246 |
| 322 | Ga0373934_0019874 | 3300035086 | Bacteria | 2581 |
| 323 | Ga0373934_0020746 | 3300035086 | Bacteria | 2527 |
| 324 | Ga0373934_0036126 | 3300035086 | Bacteria | 1945 |
| 325 | Ga0373944_0000589 | 3300035089 | Bacteria | 8631 |
| 326 | Ga0373944_0012090 | 3300035089 | Bacteria | 2375 |
| 327 | Ga0373944_0020636 | 3300035089 | Bacteria | 1900 |
| 328 | Ga0373949_0011519 | 3300035090 | Bacteria | 1949 |
| 329 | Ga0373951_0017421 | 3300035091 | Bacteria | 1625 |
| 330 | Ga0373923_0000101 | 3300035111 | Bacteria | 15127 |
| 331 | Ga0373923_0033509 | 3300035111 | Bacteria | 2080 |
| 332 | Ga0373923_0045546 | 3300035111 | Bacteria | 1822 |
| 333 | Ga0373923_0098372 | 3300035111 | Bacteria | 1287 |
| 334 | Ga0373936_0000233 | 3300035113 | Bacteria | 18417 |
| 335 | Ga0373936_0013843 | 3300035113 | Bacteria | 3079 |
| 336 | Ga0373945_0009044 | 3300035116 | Bacteria | 3254 |
| 337 | Ga0373945_0042664 | 3300035116 | Bacteria | 1644 |
| 338 | Ga0373953_0000883 | 3300035117 | Bacteria | 8399 |
| 339 | Ga0373953_0004753 | 3300035117 | Bacteria | 4356 |
| 340 | Ga0373953_0051884 | 3300035117 | Bacteria | 1659 |
| 341 | Ga0373954_0012176 | 3300035118 | Bacteria | 3825 |
| 342 | Ga0373954_0022351 | 3300035118 | Bacteria | 2868 |
| 343 | Ga0373956_0000119 | 3300035119 | Bacteria | 27324 |
| 344 | Ga0373956_0000526 | 3300035119 | Bacteria | 15694 |
| 345 | Ga0373956_0014711 | 3300035119 | Bacteria | 3271 |
| 346 | Ga0373956_0050766 | 3300035119 | Bacteria | 1863 |
| 347 | Ga0373956_0073902 | 3300035119 | Bacteria | 1558 |
| 348 | Ga0373957_0000264 | 3300035120 | Bacteria | 13148 |
| 349 | Ga0373957_0068850 | 3300035120 | Bacteria | 1381 |
| 350 | Ga0373960_0065657 | 3300035121 | Bacteria | 1110 |
| 351 | Ga0373943_0018410 | 3300035170 | Bacteria | 3208 |
| 352 | Ga0373946_0000171 | 3300035171 | Bacteria | 19714 |
| 353 | Ga0373946_0005624 | 3300035171 | Bacteria | 4527 |
| 354 | Ga0373946_0081095 | 3300035171 | Bacteria | 1420 |
| 355 | Ga0373955_0000149 | 3300035172 | Bacteria | 27794 |
| 356 | Ga0373955_0001986 | 3300035172 | Bacteria | 8818 |
| 357 | Ga0373955_0013651 | 3300035172 | Bacteria | 3935 |
| 358 | Ga0373955_0041344 | 3300035172 | Bacteria | 2470 |
| 359 | Ga0373955_0130680 | 3300035172 | Bacteria | 1465 |
| 360 | Ga0373955_0140804 | 3300035172 | Bacteria | 1414 |
| 361 | Ga0373955_0192205 | 3300035172 | Bacteria | 1214 |
| 362 | Ga0373955_0245265 | 3300035172 | Bacteria | 1073 |
| 363 | Ga0316574_0002178 | 3300035398 | Bacteria | 9713 |
| 364 | Ga0316574_0004825 | 3300035398 | Bacteria | 7135 |
| 365 | Ga0373924_0000318 | 3300035410 | Bacteria | 14839 |
| 366 | Ga0373924_0009072 | 3300035410 | Bacteria | 3638 |
| 367 | Ga0373931_0125129 | 3300035691 | Bacteria | 1473 |
| 368 | Ga0373931_0371266 | 3300035691 | Bacteria | 900 |
| 369 | Ga0373935_0011145 | 3300035692 | Bacteria | 5397 |
| 370 | Ga0373935_0030337 | 3300035692 | Bacteria | 3350 |
| 371 | Ga0373935_0091211 | 3300035692 | Bacteria | 1995 |
| 372 | Ga0373935_0110186 | 3300035692 | Bacteria | 1826 |
| 373 | Ga0373927_0004565 | 3300035695 | Bacteria | 9671 |
| 374 | Ga0373927_0016408 | 3300035695 | Bacteria | 4884 |
| 375 | Ga0373927_0053687 | 3300035695 | Bacteria | 2607 |
| 376 | Ga0373933_0000001 | 3300035724 | Bacteria | 228234 |
| 377 | Ga0373933_0004044 | 3300035724 | Bacteria | 8080 |
| 378 | Ga0373933_0014063 | 3300035724 | Bacteria | 4442 |
| 379 | Ga0373933_0017823 | 3300035724 | Bacteria | 3986 |
| 380 | Ga0373933_0053913 | 3300035724 | Bacteria | 2408 |
| 381 | Ga0373933_0074097 | 3300035724 | Bacteria | 2075 |
| 382 | Ga0373933_0175918 | 3300035724 | Bacteria | 1363 |
| 383 | Ga0373947_0000001 | 3300035725 | Bacteria | 510932 |
| 384 | Ga0373947_0001122 | 3300035725 | Bacteria | 16437 |
| 385 | Ga0373947_0004746 | 3300035725 | Bacteria | 7970 |
| 386 | Ga0373947_0274101 | 3300035725 | Bacteria | 1120 |
| 387 | Ga0373937_0003722 | 3300036401 | Bacteria | 12886 |
| 388 | Ga0373937_0008016 | 3300036401 | Bacteria | 9155 |
| 389 | Ga0373937_0027495 | 3300036401 | Bacteria | 5143 |
| 390 | Ga0373937_0044906 | 3300036401 | Bacteria | 4037 |
| 391 | Ga0373937_0057483 | 3300036401 | Bacteria | 3573 |
| 392 | Ga0373937_0112254 | 3300036401 | Bacteria | 2535 |
| 393 | Ga0373937_0128272 | 3300036401 | Bacteria | 2367 |
| 394 | Ga0373937_0378438 | 3300036401 | Bacteria | 1342 |
| 395 | Ga0373937_0584369 | 3300036401 | Bacteria | 1060 |
| 396 | Ga0316582_0000920 | 3300036647 | Bacteria | 12107 |
| 397 | Ga0316582_0003300 | 3300036647 | Bacteria | 7873 |
| 398 | Ga0316584_0004008 | 3300036712 | Bacteria | 9690 |
| 399 | Ga0373925_0007907 | 3300037068 | Bacteria | 7741 |
| 400 | Ga0373925_0022896 | 3300037068 | Bacteria | 4558 |
| 401 | Ga0373925_0027209 | 3300037068 | Bacteria | 4187 |
| 402 | Ga0373925_0052242 | 3300037068 | Bacteria | 3053 |
| 403 | Ga0373925_0145079 | 3300037068 | Bacteria | 1860 |
| 404 | Ga0373925_0230267 | 3300037068 | Bacteria | 1481 |
| 405 | Ga0395899_0211122 | 3300037312 | Bacteria | 1349 |
| 406 | Ga0395899_0221190 | 3300037312 | Bacteria | 1312 |
| 407 | Ga0395900_0191147 | 3300037418 | Bacteria | 2076 |
| 408 | Ga0395898_0078229 | 3300037466 | Bacteria | 3191 |
| 409 | Ga0395898_0158606 | 3300037466 | Bacteria | 2164 |
| 410 | Ga0436364_0025604 | 3300037853 | Bacteria | 2134 |
| 411 | Ga0436364_0106996 | 3300037853 | Bacteria | 14379 |
| 412 | Ga0436364_0330965 | 3300037853 | Bacteria | 247749 |
| 413 | Ga0395901_0011041 | 3300038443 | Bacteria | 9150 |
| 414 | Ga0395901_0055761 | 3300038443 | Bacteria | 4110 |
| 415 | Ga0395901_0582159 | 3300038443 | Bacteria | 1131 |
| 416 | Ga0436360_0348714 | 3300039438 | Bacteria | 1514 |
| 417 | Ga0436363_0964495 | 3300039450 | Bacteria | 1514 |
| 418 | Ga0451853_0784232 | 3300041512 | Bacteria | 932 |
| 419 | Ga0466972_0148186 | 3300044658 | Bacteria | 1104 |
| 420 | Ga0466965_0070061 | 3300044683 | Bacteria | 1762 |
| 421 | Ga0466963_0058036 | 3300044694 | Bacteria | 2579 |
| 422 | Ga0466963_0077566 | 3300044694 | Bacteria | 2245 |
| 423 | Ga0466964_0032567 | 3300044706 | Bacteria | 2072 |
| 424 | Ga0466971_0116137 | 3300044719 | Bacteria | 1237 |
| 425 | Ga0466971_0259779 | 3300044719 | Bacteria | 828 |
| 426 | Ga0466968_0237417 | 3300044735 | Bacteria | 863 |
| 427 | Ga0466970_0039347 | 3300044765 | Bacteria | 2509 |
| 428 | Ga0466970_0064875 | 3300044765 | Bacteria | 1959 |
| 429 | Ga0466957_0048984 | 3300044842 | Bacteria | 2568 |
| 430 | Ga0466957_0093478 | 3300044842 | Bacteria | 1887 |
| 431 | Ga0466957_0171524 | 3300044842 | Bacteria | 1413 |
| 432 | Ga0466957_0424456 | 3300044842 | Bacteria | 913 |
| 433 | Ga0466960_0006004 | 3300044901 | Bacteria | 4849 |
| 434 | Ga0466960_0078548 | 3300044901 | Bacteria | 1657 |
| 435 | Ga0466960_0097842 | 3300044901 | Bacteria | 1506 |
| 436 | Ga0466960_0309215 | 3300044901 | Bacteria | 892 |
| 437 | Ga0466959_0076439 | 3300045049 | Bacteria | 2417 |
| 438 | Ga0466958_0060857 | 3300045836 | Bacteria | 2299 |
| 439 | Ga0466958_0103389 | 3300045836 | Bacteria | 1773 |
| 440 | Ga0466958_0197067 | 3300045836 | Bacteria | 1281 |
| 441 | Ga0466958_0324865 | 3300045836 | Bacteria | 989 |
| 442 | Ga0466967_0012950 | 3300045976 | Bacteria | 6415 |
| 443 | Ga0466967_0035867 | 3300045976 | Bacteria | 4226 |
| 444 | Ga0466967_0126443 | 3300045976 | Bacteria | 2368 |
| 445 | Ga0466967_0154932 | 3300045976 | Bacteria | 2145 |
| 446 | Ga0466967_0155764 | 3300045976 | Bacteria | 2140 |
| 447 | Ga0466967_0516811 | 3300045976 | Bacteria | 1173 |
| 448 | Ga0495592_0000002 | 3300046454 | Bacteria | 209491 |
| 449 | Ga0495592_0011520 | 3300046454 | Bacteria | 6693 |
| 450 | Ga0495592_0025397 | 3300046454 | Bacteria | 4497 |
| 451 | Ga0495592_0028991 | 3300046454 | Bacteria | 4190 |
| 452 | Ga0495592_0115879 | 3300046454 | Bacteria | 1891 |
| 453 | Ga0495603_0005339 | 3300046455 | Bacteria | 7664 |
| 454 | Ga0495629_0001549 | 3300046459 | Bacteria | 18051 |
| 455 | Ga0495629_0146547 | 3300046459 | Bacteria | 1642 |
| 456 | Ga0495641_0006847 | 3300046461 | Bacteria | 7292 |
| 457 | Ga0495641_0007210 | 3300046461 | Bacteria | 6999 |
| 458 | Ga0495641_0075303 | 3300046461 | Bacteria | 1513 |
| 459 | Ga0495651_0000002 | 3300046462 | Bacteria | 209492 |
| 460 | Ga0495651_0004885 | 3300046462 | Bacteria | 10252 |
| 461 | Ga0495651_0016351 | 3300046462 | Bacteria | 5745 |
| 462 | Ga0495651_0018305 | 3300046462 | Bacteria | 5424 |
| 463 | Ga0495651_0023699 | 3300046462 | Bacteria | 4772 |
| 464 | Ga0495651_0040760 | 3300046462 | Bacteria | 3609 |
| 465 | Ga0495651_0073159 | 3300046462 | Bacteria | 2602 |
| 466 | Ga0495651_0224041 | 3300046462 | Bacteria | 1299 |
| 467 | Ga0495653_0025465 | 3300046463 | Bacteria | 4755 |
| 468 | Ga0495653_0035895 | 3300046463 | Bacteria | 3909 |
| 469 | Ga0495653_0061535 | 3300046463 | Bacteria | 2840 |
| 470 | Ga0495653_0071947 | 3300046463 | Bacteria | 2583 |
| 471 | Ga0495580_0001403 | 3300046472 | Bacteria | 21155 |
| 472 | Ga0495582_0001716 | 3300046473 | Bacteria | 12362 |
| 473 | Ga0495582_0046302 | 3300046473 | Bacteria | 2395 |
| 474 | Ga0495582_0051181 | 3300046473 | Bacteria | 2277 |
| 475 | Ga0495639_0008056 | 3300046475 | Bacteria | 4524 |
| 476 | Ga0495639_0053636 | 3300046475 | Bacteria | 1837 |
| 477 | Ga0495639_0103619 | 3300046475 | Bacteria | 1345 |
| 478 | Ga0495662_0020455 | 3300046476 | Bacteria | 3201 |
| 479 | Ga0495662_0048557 | 3300046476 | Bacteria | 2049 |
| 480 | Ga0495662_0097420 | 3300046476 | Bacteria | 1438 |
| 481 | Ga0495664_0021110 | 3300046477 | Bacteria | 3761 |
| 482 | Ga0495664_0026244 | 3300046477 | Bacteria | 3393 |
| 483 | Ga0495664_0032158 | 3300046477 | Bacteria | 3077 |
| 484 | Ga0495664_0048897 | 3300046477 | Bacteria | 2510 |
| 485 | Ga0495594_0050795 | 3300046499 | Bacteria | 2281 |
| 486 | Ga0495594_0092479 | 3300046499 | Bacteria | 1696 |
| 487 | Ga0495608_0000118 | 3300046511 | Bacteria | 56564 |
| 488 | Ga0495608_0013978 | 3300046511 | Bacteria | 5568 |
| 489 | Ga0495608_0054487 | 3300046511 | Bacteria | 2643 |
| 490 | Ga0495608_0065521 | 3300046511 | Bacteria | 2379 |
| 491 | Ga0495608_0161709 | 3300046511 | Bacteria | 1423 |
| 492 | Ga0495618_0003574 | 3300046514 | Bacteria | 9636 |
| 493 | Ga0495618_0020187 | 3300046514 | Bacteria | 4102 |
| 494 | Ga0495618_0064378 | 3300046514 | Bacteria | 2329 |
| 495 | Ga0495618_0071667 | 3300046514 | Bacteria | 2204 |
| 496 | Ga0495618_0157402 | 3300046514 | Bacteria | 1449 |
| 497 | Ga0495620_0085171 | 3300046515 | Bacteria | 1274 |
| 498 | Ga0495628_0018807 | 3300046516 | Bacteria | 5717 |
| 499 | Ga0495628_0027371 | 3300046516 | Bacteria | 4640 |
| 500 | Ga0495628_0042995 | 3300046516 | Bacteria | 3601 |
| 501 | Ga0495628_0101232 | 3300046516 | Bacteria | 2223 |
| 502 | Ga0495630_0022467 | 3300046517 | Bacteria | 4659 |
| 503 | Ga0495630_0027568 | 3300046517 | Bacteria | 4215 |
| 504 | Ga0495630_0196928 | 3300046517 | Bacteria | 1537 |
| 505 | Ga0495630_0219811 | 3300046517 | Bacteria | 1450 |
| 506 | Ga0495631_0067083 | 3300046518 | Bacteria | 1553 |
| 507 | Ga0495666_0015461 | 3300046526 | Bacteria | 3799 |
| 508 | Ga0495666_0039696 | 3300046526 | Bacteria | 2284 |
| 509 | Ga0495652_0001668 | 3300046529 | Bacteria | 24094 |
| 510 | Ga0495652_0012326 | 3300046529 | Bacteria | 7718 |
| 511 | Ga0495652_0031939 | 3300046529 | Bacteria | 4607 |
| 512 | Ga0495652_0041720 | 3300046529 | Bacteria | 3959 |
| 513 | Ga0495652_0073193 | 3300046529 | Bacteria | 2854 |
| 514 | Ga0495652_0084052 | 3300046529 | Bacteria | 2618 |
| 515 | Ga0495652_0199758 | 3300046529 | Bacteria | 1518 |
| 516 | Ga0495665_0014532 | 3300046531 | Bacteria | 4245 |
| 517 | Ga0495665_0086593 | 3300046531 | Bacteria | 1646 |
| 518 | Ga0495640_0002112 | 3300046533 | Bacteria | 15852 |
| 519 | Ga0495640_0046734 | 3300046533 | Bacteria | 2997 |
| 520 | Ga0495640_0066006 | 3300046533 | Bacteria | 2441 |
| 521 | Ga0495640_0169235 | 3300046533 | Bacteria | 1396 |
| 522 | Ga0495586_0021968 | 3300046535 | Bacteria | 3405 |
| 523 | Ga0495587_0000013 | 3300046536 | Bacteria | 195619 |
| 524 | Ga0495587_0040280 | 3300046536 | Bacteria | 2793 |
| 525 | Ga0495587_0071961 | 3300046536 | Bacteria | 2010 |
| 526 | Ga0495587_0090843 | 3300046536 | Bacteria | 1764 |
| 527 | Ga0495587_0106743 | 3300046536 | Bacteria | 1610 |
| 528 | Ga0495645_0008113 | 3300046543 | Bacteria | 7319 |
| 529 | Ga0495645_0014580 | 3300046543 | Bacteria | 5579 |
| 530 | Ga0495645_0078337 | 3300046543 | Bacteria | 2375 |
| 531 | Ga0495667_0000016 | 3300046559 | Bacteria | 195635 |
| 532 | Ga0495667_0006731 | 3300046559 | Bacteria | 7797 |
| 533 | Ga0495667_0007380 | 3300046559 | Bacteria | 7455 |
| 534 | Ga0495667_0033211 | 3300046559 | Bacteria | 3453 |
| 535 | Ga0495667_0035330 | 3300046559 | Bacteria | 3340 |
| 536 | Ga0495667_0048551 | 3300046559 | Bacteria | 2802 |
| 537 | Ga0495667_0053066 | 3300046559 | Bacteria | 2670 |
| 538 | Ga0495667_0078679 | 3300046559 | Bacteria | 2144 |
| 539 | Ga0495634_0028522 | 3300046642 | Bacteria | 3873 |
| 540 | Ga0495634_0056071 | 3300046642 | Bacteria | 2634 |
| 541 | Ga0495634_0125666 | 3300046642 | Bacteria | 1639 |
| 542 | Ga0495635_0000951 | 3300046663 | Bacteria | 19107 |
| 543 | Ga0495635_0005849 | 3300046663 | Bacteria | 8571 |
| 544 | Ga0495635_0120999 | 3300046663 | Bacteria | 1785 |
| 545 | Ga0495657_0000014 | 3300046675 | Bacteria | 195574 |
| 546 | Ga0495657_0001649 | 3300046675 | Bacteria | 19177 |
| 547 | Ga0495657_0020719 | 3300046675 | Bacteria | 4727 |
| 548 | Ga0495657_0042038 | 3300046675 | Bacteria | 3123 |
| 549 | Ga0495657_0054676 | 3300046675 | Bacteria | 2665 |
| 550 | Ga0495657_0055318 | 3300046675 | Bacteria | 2647 |
| 551 | Ga0495657_0058652 | 3300046675 | Bacteria | 2555 |
| 552 | Ga0495657_0081640 | 3300046675 | Bacteria | 2090 |
| 553 | Ga0495599_0000006 | 3300046678 | Bacteria | 283487 |
| 554 | Ga0495599_0015082 | 3300046678 | Bacteria | 4790 |
| 555 | Ga0495599_0020997 | 3300046678 | Bacteria | 4071 |
| 556 | Ga0495599_0089190 | 3300046678 | Bacteria | 1925 |
| 557 | Ga0495599_0105895 | 3300046678 | Bacteria | 1752 |
| 558 | Ga0495623_0004288 | 3300046679 | Bacteria | 9388 |
| 559 | Ga0495623_0023482 | 3300046679 | Bacteria | 3980 |
| 560 | Ga0495623_0028615 | 3300046679 | Bacteria | 3584 |
| 561 | Ga0495623_0032320 | 3300046679 | Bacteria | 3364 |
| 562 | Ga0495623_0045131 | 3300046679 | Bacteria | 2800 |
| 563 | Ga0495623_0175146 | 3300046679 | Bacteria | 1250 |
| 564 | Ga0495646_0011492 | 3300046680 | Bacteria | 5620 |
| 565 | Ga0495646_0015911 | 3300046680 | Bacteria | 4774 |
| 566 | Ga0495646_0148883 | 3300046680 | Bacteria | 1303 |
| 567 | Ga0495647_0040292 | 3300046681 | Bacteria | 1774 |
| 568 | Ga0495647_0068933 | 3300046681 | Bacteria | 1412 |
| 569 | Ga0495647_0149639 | 3300046681 | Bacteria | 1000 |
| 570 | Ga0495658_0008962 | 3300046683 | Bacteria | 4974 |
| 571 | Ga0495613_0016116 | 3300046689 | Bacteria | 5564 |
| 572 | Ga0495624_0002996 | 3300046690 | Bacteria | 12637 |
| 573 | Ga0495624_0047183 | 3300046690 | Bacteria | 2737 |
| 574 | Ga0495600_0013119 | 3300046809 | Bacteria | 5197 |
| 575 | Ga0495600_0032600 | 3300046809 | Bacteria | 3381 |
| 576 | Ga0495600_0033158 | 3300046809 | Bacteria | 3352 |
| 577 | Ga0495600_0033945 | 3300046809 | Bacteria | 3313 |
| 578 | Ga0495600_0134482 | 3300046809 | Bacteria | 1606 |
| 579 | Ga0495581_0004124 | 3300047315 | Bacteria | 8367 |
| 580 | Ga0495581_0102609 | 3300047315 | Bacteria | 1662 |
| 581 | Ga0495604_0000015 | 3300047317 | Bacteria | 195635 |
| 582 | Ga0495604_0022121 | 3300047317 | Bacteria | 5074 |
| 583 | Ga0495604_0022292 | 3300047317 | Bacteria | 5056 |
| 584 | Ga0495604_0044946 | 3300047317 | Bacteria | 3448 |
| 585 | Ga0495604_0101866 | 3300047317 | Bacteria | 2108 |
| 586 | Ga0495604_0131823 | 3300047317 | Bacteria | 1795 |
| 587 | Ga0495674_0004290 | 3300047319 | Bacteria | 13718 |
| 588 | Ga0495674_0004688 | 3300047319 | Bacteria | 13148 |
| 589 | Ga0495674_0059461 | 3300047319 | Bacteria | 3337 |
| 590 | Ga0495674_0106510 | 3300047319 | Bacteria | 2381 |
| 591 | Ga0495674_0246978 | 3300047319 | Bacteria | 1469 |
| 592 | Ga0495676_0050282 | 3300047321 | Bacteria | 3344 |
| 593 | Ga0495676_0065828 | 3300047321 | Bacteria | 2811 |
| 594 | Ga0495676_0243737 | 3300047321 | Bacteria | 1229 |
| 595 | Ga0495680_0000380 | 3300047322 | Bacteria | 49632 |
| 596 | Ga0495680_0006296 | 3300047322 | Bacteria | 11056 |
| 597 | Ga0495680_0020131 | 3300047322 | Bacteria | 5620 |
| 598 | Ga0495680_0026194 | 3300047322 | Bacteria | 4811 |
| 599 | Ga0495680_0052465 | 3300047322 | Bacteria | 3178 |
| 600 | Ga0495680_0070996 | 3300047322 | Bacteria | 2652 |
| 601 | Ga0495680_0071715 | 3300047322 | Bacteria | 2636 |
| 602 | Ga0495675_0003988 | 3300047444 | Bacteria | 8945 |
| 603 | Ga0495675_0006842 | 3300047444 | Bacteria | 7000 |
| 604 | Ga0495675_0110803 | 3300047444 | Bacteria | 1713 |
| 605 | Ga0495675_0154227 | 3300047444 | Bacteria | 1417 |
| 606 | Ga0495675_0183634 | 3300047444 | Bacteria | 1279 |
| 607 | Ga0495684_0029692 | 3300047471 | Bacteria | 4195 |
| 608 | Ga0495684_0032688 | 3300047471 | Bacteria | 3995 |
| 609 | Ga0495684_0048038 | 3300047471 | Bacteria | 3263 |
| 610 | Ga0495684_0122951 | 3300047471 | Bacteria | 1953 |
| 611 | Ga0495684_0169892 | 3300047471 | Bacteria | 1622 |
| 612 | Ga0495684_0194699 | 3300047471 | Bacteria | 1497 |
| 613 | Ga0495684_0240540 | 3300047471 | Bacteria | 1320 |
| 614 | Ga0495593_0000569 | 3300047673 | Bacteria | 20962 |
| 615 | Ga0495593_0025990 | 3300047673 | Bacteria | 3237 |
| 616 | Ga0495602_0000013 | 3300048088 | Bacteria | 195591 |
| 617 | Ga0495602_0018082 | 3300048088 | Bacteria | 7050 |
| 618 | Ga0495602_0025113 | 3300048088 | Bacteria | 5771 |
| 619 | Ga0495602_0128131 | 3300048088 | Bacteria | 2029 |
| 620 | Ga0495602_0140239 | 3300048088 | Bacteria | 1914 |
| 621 | Ga0495602_0159394 | 3300048088 | Bacteria | 1763 |
| 622 | Ga0495602_0272519 | 3300048088 | Bacteria | 1250 |
| 623 | Ga0495614_0009992 | 3300048089 | Bacteria | 4189 |
| 624 | Ga0495614_0013749 | 3300048089 | Bacteria | 3549 |
| 625 | Ga0496100_0010356 | 3300048903 | Bacteria | 5276 |
| 626 | Ga0496100_0110499 | 3300048903 | Bacteria | 1908 |
| 627 | Ga0496100_0120895 | 3300048903 | Bacteria | 1832 |
| 628 | Ga0496101_0010359 | 3300048904 | Bacteria | 6155 |
| 629 | Ga0496101_0055206 | 3300048904 | Bacteria | 2869 |
| 630 | Ga0496102_0000983 | 3300048905 | Bacteria | 26821 |
| 631 | Ga0496102_0005931 | 3300048905 | Bacteria | 10404 |
| 632 | Ga0496102_0169839 | 3300048905 | Bacteria | 2053 |
| 633 | Ga0496102_0203907 | 3300048905 | Bacteria | 1864 |
| 634 | Ga0496102_0222361 | 3300048905 | Bacteria | 1780 |
| 635 | Ga0496103_0003620 | 3300048906 | Bacteria | 9420 |
| 636 | Ga0496103_0354745 | 3300048906 | Bacteria | 943 |
| 637 | Ga0496104_0006284 | 3300048907 | Bacteria | 10442 |
| 638 | Ga0496104_0006942 | 3300048907 | Bacteria | 9988 |
| 639 | Ga0496104_0023189 | 3300048907 | Bacteria | 5705 |
| 640 | Ga0496104_0040529 | 3300048907 | Bacteria | 4365 |
| 641 | Ga0496105_0002257 | 3300048908 | Bacteria | 13967 |
| 642 | Ga0496105_0003384 | 3300048908 | Bacteria | 11787 |
| 643 | Ga0496105_0022474 | 3300048908 | Bacteria | 5108 |
| 644 | Ga0496105_0030630 | 3300048908 | Bacteria | 4408 |
| 645 | Ga0496106_0037129 | 3300048909 | Bacteria | 3644 |
| 646 | Ga0496106_0258829 | 3300048909 | Bacteria | 1392 |
| 647 | Ga0496107_0189008 | 3300048910 | Bacteria | 1530 |
| 648 | Ga0496107_0271197 | 3300048910 | Bacteria | 1263 |
| 649 | Ga0496108_0008373 | 3300048911 | Bacteria | 8390 |
| 650 | Ga0496109_0024968 | 3300048912 | Bacteria | 5320 |
| 651 | Ga0496109_0154294 | 3300048912 | Bacteria | 2151 |
| 652 | Ga0496109_0230463 | 3300048912 | Bacteria | 1742 |
| 653 | Ga0496110_0014490 | 3300048913 | Bacteria | 6549 |
| 654 | Ga0496110_0119418 | 3300048913 | Bacteria | 2374 |
| 655 | Ga0496110_0678764 | 3300048913 | Bacteria | 931 |
| 656 | Ga0496111_0026244 | 3300048914 | Bacteria | 4112 |
| 657 | Ga0496111_0124228 | 3300048914 | Bacteria | 1907 |
| 658 | Ga0496112_0029947 | 3300048915 | Bacteria | 5266 |
| 659 | Ga0496112_0281210 | 3300048915 | Bacteria | 1611 |
| 660 | Ga0496112_0298895 | 3300048915 | Bacteria | 1555 |
| 661 | Ga0496112_0814337 | 3300048915 | Bacteria | 858 |
| 662 | Ga0496113_0271978 | 3300048916 | Bacteria | 1354 |
| 663 | Ga0496114_0019240 | 3300048917 | Bacteria | 5532 |
| 664 | Ga0496114_0300059 | 3300048917 | Bacteria | 1418 |
| 665 | Ga0496114_0405368 | 3300048917 | Bacteria | 1207 |
| 666 | Ga0496115_0082818 | 3300048918 | Bacteria | 2614 |
| 667 | Ga0496115_0179456 | 3300048918 | Bacteria | 1751 |
| 668 | Ga0496115_0275242 | 3300048918 | Bacteria | 1382 |
| 669 | Ga0496126_0235246 | 3300048929 | Bacteria | 1533 |
| 670 | Ga0501034_0687686 | 3300049571 | Bacteria | 922 |
| 671 | Ga0501036_0001833 | 3300049572 | Bacteria | 16501 |
| 672 | Ga0501036_0009108 | 3300049572 | Bacteria | 8165 |
| 673 | Ga0501036_0415271 | 3300049572 | Bacteria | 1122 |
| 674 | Ga0501038_0032357 | 3300049574 | Bacteria | 4614 |
| 675 | Ga0501038_0117828 | 3300049574 | Bacteria | 2193 |
| 676 | Ga0501039_0042421 | 3300049575 | Bacteria | 3515 |
| 677 | Ga0501040_0012841 | 3300049576 | Bacteria | 5500 |
| 678 | Ga0501040_0090813 | 3300049576 | Bacteria | 2123 |
| 679 | Ga0501041_0020790 | 3300049577 | Bacteria | 3927 |
| 680 | Ga0501041_0096193 | 3300049577 | Bacteria | 1830 |
| 681 | Ga0501042_0000649 | 3300049578 | Bacteria | 18669 |
| 682 | Ga0501046_0005754 | 3300049580 | Bacteria | 11064 |
| 683 | Ga0501046_0078427 | 3300049580 | Bacteria | 2555 |
| 684 | Ga0501046_0315915 | 3300049580 | Bacteria | 1139 |
| 685 | Ga0501047_0128325 | 3300049581 | Bacteria | 2416 |
| 686 | Ga0501048_0009775 | 3300049582 | Bacteria | 7191 |
| 687 | Ga0501048_0112403 | 3300049582 | Bacteria | 1923 |
| 688 | Ga0501069_0162641 | 3300049585 | Bacteria | 1286 |
| 689 | Ga0501071_0002819 | 3300049587 | Bacteria | 10704 |
| 690 | Ga0501071_0032008 | 3300049587 | Bacteria | 3732 |
| 691 | Ga0501071_0448650 | 3300049587 | Bacteria | 987 |
| 692 | Ga0501071_0550768 | 3300049587 | Bacteria | 886 |
| 693 | Ga0501072_0059576 | 3300049588 | Bacteria | 3010 |
| 694 | Ga0501072_0098812 | 3300049588 | Bacteria | 2320 |
| 695 | Ga0501074_0191911 | 3300049590 | Bacteria | 1456 |
| 696 | Ga0501075_0002567 | 3300049591 | Bacteria | 12107 |
| 697 | Ga0501075_0145032 | 3300049591 | Bacteria | 1809 |
| 698 | Ga0501075_0482994 | 3300049591 | Bacteria | 945 |
| 699 | Ga0501076_0000957 | 3300049592 | Bacteria | 18872 |
| 700 | Ga0501076_0007978 | 3300049592 | Bacteria | 7728 |
| 701 | Ga0501077_0085255 | 3300049593 | Bacteria | 2002 |
| 702 | Ga0501077_0090877 | 3300049593 | Bacteria | 1935 |
| 703 | Ga0501079_0010125 | 3300049741 | Bacteria | 7157 |
| 704 | Ga0501079_0121616 | 3300049741 | Bacteria | 2030 |
| 705 | Ga0501080_0060935 | 3300049742 | Bacteria | 3513 |
| 706 | Ga0501080_0190582 | 3300049742 | Bacteria | 1884 |
| 707 | Ga0501081_0034845 | 3300049743 | Bacteria | 3426 |
| 708 | Ga0501035_0024974 | 3300049822 | Bacteria | 5480 |
| 709 | Ga0501035_0042510 | 3300049822 | Bacteria | 4099 |
| 710 | Ga0501044_0085116 | 3300049823 | Bacteria | 3195 |
| 711 | Ga0501044_0469996 | 3300049823 | Bacteria | 1162 |
| 712 | Ga0501045_0094897 | 3300049824 | Bacteria | 2206 |
| 713 | nmdc:mga05p37_10551_c1 | 3300050507 | Bacteria | 10956 |
| 714 | nmdc:mga09592_16026_c1 | 3300050508 | Bacteria | 6126 |
| 715 | nmdc:mga08y16_18189_c1 | 3300050511 | Bacteria | 7405 |
| 716 | nmdc:mga0n895_209079_c1 | 3300050512 | Bacteria | 1982 |
| 717 | nmdc:mga0n895_63600_c1 | 3300050512 | Bacteria | 3649 |
| 718 | nmdc:mga0rr50_115394_c1 | 3300050513 | Bacteria | 2131 |
| 719 | nmdc:mga0rr50_204116_c1 | 3300050513 | Bacteria | 1626 |
| 720 | nmdc:mga0rr50_648762_c1 | 3300050513 | Bacteria | 901 |
| 721 | Ga0495601_0092166 | 3300053077 | Bacteria | 1951 |
| 722 | Ga0495601_0100116 | 3300053077 | Bacteria | 1871 |
| 723 | Ga0495612_0007523 | 3300053078 | Bacteria | 4452 |
| 724 | Ga0495612_0054437 | 3300053078 | Bacteria | 1648 |
| 725 | Ga0495612_0086446 | 3300053078 | Bacteria | 1322 |
| 726 | Ga0495595_0004997 | 3300053084 | Bacteria | 5356 |
| 727 | Ga0495595_0008824 | 3300053084 | Bacteria | 4151 |
| 728 | Ga0495595_0019025 | 3300053084 | Bacteria | 2975 |
| 729 | Ga0495595_0022435 | 3300053084 | Bacteria | 2772 |
| 730 | Ga0495619_0008048 | 3300053085 | Bacteria | 6672 |
| 731 | Ga0495619_0054659 | 3300053085 | Bacteria | 2643 |
| 732 | Ga0500568_0003155 | 3300053139 | Bacteria | 9391 |
| 733 | Ga0501084_0038908 | 3300054114 | Bacteria | 3977 |
| 734 | Ga0501082_0125486 | 3300060353 | Bacteria | 2226 |
| 735 | Ga0466962_0068918 | 3300061719 | Bacteria | 1689 |
| 736 | Ga0466962_0091563 | 3300061719 | Bacteria | 1457 |
| 737 | Ga0530510_0051263 | 3300061734 | Bacteria | 2982 |
| 738 | Ga0530510_0567861 | 3300061734 | Bacteria | 862 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014969 | Ga0157376_10097371 | Ga0157376_100973712 | 223 |
| 2 | 3300048915 | Ga0496112_0814337 | Ga0496112_0814337_136_837 | 230 |
| 3 | 3300035691 | Ga0373931_0371266 | Ga0373931_0371266_39_734 | 231 |
| 4 | 3300044719 | Ga0466971_0259779 | Ga0466971_0259779_35_757 | 231 |
| 5 | 3300045976 | Ga0466967_0154932 | Ga0466967_0154932_28_723 | 231 |
| 6 | 3300046515 | Ga0495620_0085171 | Ga0495620_0085171_500_1195 | 231 |
| 7 | 3300046518 | Ga0495631_0067083 | Ga0495631_0067083_369_1064 | 231 |
| 8 | 3300013307 | Ga0157372_11077247 | Ga0157372_110772472 | 233 |
| 9 | 3300048905 | Ga0496102_0000983 | Ga0496102_0000983_18398_19138 | 233 |
| 10 | 3300007076 | Ga0075435_100109014 | Ga0075435_1001090142 | 235 |
| 11 | 3300025906 | Ga0207699_10119325 | Ga0207699_101193252 | 236 |
| 12 | 3300050513 | nmdc:mga0rr50_115394_c1 | nmdc:mga0rr50_115394_c1_1031_1834 | 236 |
| 13 | 3300005616 | Ga0068852_100216176 | Ga0068852_1002161761 | 237 |
| 14 | 3300035086 | Ga0373934_0000025 | Ga0373934_0000025_447_1244 | 237 |
| 15 | 3300035111 | Ga0373923_0033509 | Ga0373923_0033509_399_1196 | 237 |
| 16 | 3300035117 | Ga0373953_0004753 | Ga0373953_0004753_2914_3711 | 237 |
| 17 | 3300035118 | Ga0373954_0012176 | Ga0373954_0012176_2216_3013 | 237 |
| 18 | 3300035119 | Ga0373956_0000119 | Ga0373956_0000119_26108_26905 | 237 |
| 19 | 3300035120 | Ga0373957_0000264 | Ga0373957_0000264_9471_10268 | 237 |
| 20 | 3300035172 | Ga0373955_0000149 | Ga0373955_0000149_430_1227 | 237 |
| 21 | 3300035410 | Ga0373924_0000318 | Ga0373924_0000318_13676_14473 | 237 |
| 22 | 3300035724 | Ga0373933_0000001 | Ga0373933_0000001_208231_209028 | 237 |
| 23 | 3300036401 | Ga0373937_0003722 | Ga0373937_0003722_9332_10129 | 237 |
| 24 | 3300046454 | Ga0495592_0000002 | Ga0495592_0000002_208261_209058 | 237 |
| 25 | 3300046462 | Ga0495651_0000002 | Ga0495651_0000002_436_1233 | 237 |
| 26 | 3300046463 | Ga0495653_0035895 | Ga0495653_0035895_208_1005 | 237 |
| 27 | 3300046511 | Ga0495608_0000118 | Ga0495608_0000118_451_1248 | 237 |
| 28 | 3300046516 | Ga0495628_0018807 | Ga0495628_0018807_385_1182 | 237 |
| 29 | 3300046529 | Ga0495652_0001668 | Ga0495652_0001668_22867_23664 | 237 |
| 30 | 3300046536 | Ga0495587_0000013 | Ga0495587_0000013_194392_195189 | 237 |
| 31 | 3300046559 | Ga0495667_0000016 | Ga0495667_0000016_194397_195194 | 237 |
| 32 | 3300046675 | Ga0495657_0000014 | Ga0495657_0000014_382_1179 | 237 |
| 33 | 3300046678 | Ga0495599_0000006 | Ga0495599_0000006_208679_209476 | 237 |
| 34 | 3300046679 | Ga0495623_0004288 | Ga0495623_0004288_443_1240 | 237 |
| 35 | 3300046809 | Ga0495600_0032600 | Ga0495600_0032600_434_1231 | 237 |
| 36 | 3300047317 | Ga0495604_0000015 | Ga0495604_0000015_194378_195175 | 237 |
| 37 | 3300047322 | Ga0495680_0000380 | Ga0495680_0000380_426_1223 | 237 |
| 38 | 3300047444 | Ga0495675_0003988 | Ga0495675_0003988_415_1212 | 237 |
| 39 | 3300048088 | Ga0495602_0000013 | Ga0495602_0000013_194375_195172 | 237 |
| 40 | 3300053084 | Ga0495595_0004997 | Ga0495595_0004997_400_1197 | 237 |
| 41 | 3300005445 | Ga0070708_100853291 | Ga0070708_1008532911 | 238 |
| 42 | 3300005467 | Ga0070706_100016022 | Ga0070706_1000160229 | 238 |
| 43 | 3300005467 | Ga0070706_100132282 | Ga0070706_1001322822 | 238 |
| 44 | 3300005468 | Ga0070707_100087282 | Ga0070707_1000872822 | 238 |
| 45 | 3300005468 | Ga0070707_100144402 | Ga0070707_1001444022 | 238 |
| 46 | 3300005471 | Ga0070698_100109039 | Ga0070698_1001090393 | 238 |
| 47 | 3300005547 | Ga0070693_100116170 | Ga0070693_1001161702 | 238 |
| 48 | 3300005615 | Ga0070702_100077130 | Ga0070702_1000771303 | 238 |
| 49 | 3300005983 | Ga0081540_1001512 | Ga0081540_100151219 | 238 |
| 50 | 3300006844 | Ga0075428_100050071 | Ga0075428_1000500713 | 238 |
| 51 | 3300006852 | Ga0075433_10043688 | Ga0075433_100436882 | 238 |
| 52 | 3300006914 | Ga0075436_100055144 | Ga0075436_1000551441 | 238 |
| 53 | 3300007788 | Ga0099795_10080728 | Ga0099795_100807282 | 238 |
| 54 | 3300009147 | Ga0114129_10043767 | Ga0114129_100437672 | 238 |
| 55 | 3300009148 | Ga0105243_10018288 | Ga0105243_100182883 | 238 |
| 56 | 3300009551 | Ga0105238_10472690 | Ga0105238_104726902 | 238 |
| 57 | 3300009553 | Ga0105249_10234369 | Ga0105249_102343692 | 238 |
| 58 | 3300013297 | Ga0157378_10013756 | Ga0157378_100137562 | 238 |
| 59 | 3300013306 | Ga0163162_10394642 | Ga0163162_103946422 | 238 |
| 60 | 3300025910 | Ga0207684_10063805 | Ga0207684_100638052 | 238 |
| 61 | 3300025910 | Ga0207684_10290658 | Ga0207684_102906582 | 238 |
| 62 | 3300025922 | Ga0207646_10156719 | Ga0207646_101567192 | 238 |
| 63 | 3300025928 | Ga0207700_10225360 | Ga0207700_102253603 | 238 |
| 64 | 3300025929 | Ga0207664_10207160 | Ga0207664_102071602 | 238 |
| 65 | 3300027907 | Ga0207428_10114133 | Ga0207428_101141333 | 238 |
| 66 | 3300037068 | Ga0373925_0022896 | Ga0373925_0022896_1231_2019 | 238 |
| 67 | 3300037853 | Ga0436364_0025604 | Ga0436364_0025604_557_1309 | 238 |
| 68 | 3300047319 | Ga0495674_0004688 | Ga0495674_0004688_2807_3604 | 238 |
| 69 | 3300050507 | nmdc:mga05p37_10551_c1 | nmdc:mga05p37_10551_c1_5208_5987 | 238 |
| 70 | 3300050511 | nmdc:mga08y16_18189_c1 | nmdc:mga08y16_18189_c1_5456_6235 | 238 |
| 71 | 3300050512 | nmdc:mga0n895_63600_c1 | nmdc:mga0n895_63600_c1_226_1005 | 238 |
| 72 | 3300053078 | Ga0495612_0086446 | Ga0495612_0086446_89_886 | 238 |
| 73 | 3300053139 | Ga0500568_0003155 | Ga0500568_0003155_759_1610 | 238 |
| 74 | 3300005328 | Ga0070676_10124606 | Ga0070676_101246062 | 239 |
| 75 | 3300005344 | Ga0070661_100046183 | Ga0070661_1000461832 | 239 |
| 76 | 3300005366 | Ga0070659_100127615 | Ga0070659_1001276152 | 239 |
| 77 | 3300005445 | Ga0070708_100181706 | Ga0070708_1001817062 | 239 |
| 78 | 3300005456 | Ga0070678_100491116 | Ga0070678_1004911162 | 239 |
| 79 | 3300005518 | Ga0070699_100325164 | Ga0070699_1003251642 | 239 |
| 80 | 3300005535 | Ga0070684_100159237 | Ga0070684_1001592372 | 239 |
| 81 | 3300005535 | Ga0070684_100215054 | Ga0070684_1002150543 | 239 |
| 82 | 3300005544 | Ga0070686_100048347 | Ga0070686_1000483472 | 239 |
| 83 | 3300005618 | Ga0068864_100356716 | Ga0068864_1003567162 | 239 |
| 84 | 3300005842 | Ga0068858_100090185 | Ga0068858_1000901852 | 239 |
| 85 | 3300009098 | Ga0105245_10072114 | Ga0105245_100721143 | 239 |
| 86 | 3300009098 | Ga0105245_10151002 | Ga0105245_101510024 | 239 |
| 87 | 3300009177 | Ga0105248_10078501 | Ga0105248_100785013 | 239 |
| 88 | 3300009551 | Ga0105238_10126613 | Ga0105238_101266133 | 239 |
| 89 | 3300009551 | Ga0105238_10864944 | Ga0105238_108649441 | 239 |
| 90 | 3300014325 | Ga0163163_10042895 | Ga0163163_100428953 | 239 |
| 91 | 3300014326 | Ga0157380_10904340 | Ga0157380_109043402 | 239 |
| 92 | 3300020082 | Ga0206353_11135489 | Ga0206353_111354892 | 239 |
| 93 | 3300022467 | Ga0224712_10029195 | Ga0224712_100291952 | 239 |
| 94 | 3300025906 | Ga0207699_10269658 | Ga0207699_102696582 | 239 |
| 95 | 3300025916 | Ga0207663_10131254 | Ga0207663_101312543 | 239 |
| 96 | 3300025919 | Ga0207657_10010958 | Ga0207657_100109588 | 239 |
| 97 | 3300025928 | Ga0207700_10250710 | Ga0207700_102507102 | 239 |
| 98 | 3300025929 | Ga0207664_10020568 | Ga0207664_100205686 | 239 |
| 99 | 3300025939 | Ga0207665_10005391 | Ga0207665_100053917 | 239 |
| 100 | 3300025972 | Ga0207668_10440511 | Ga0207668_104405112 | 239 |
| 101 | 3300026035 | Ga0207703_10089636 | Ga0207703_100896362 | 239 |
| 102 | 3300026078 | Ga0207702_10460060 | Ga0207702_104600601 | 239 |
| 103 | 3300026118 | Ga0207675_100020030 | Ga0207675_1000200303 | 239 |
| 104 | 3300028380 | Ga0268265_10032110 | Ga0268265_100321102 | 239 |
| 105 | 3300028381 | Ga0268264_10797672 | Ga0268264_107976721 | 239 |
| 106 | 3300035083 | Ga0373926_0056493 | Ga0373926_0056493_283_1071 | 239 |
| 107 | 3300035086 | Ga0373934_0012177 | Ga0373934_0012177_247_1023 | 239 |
| 108 | 3300035086 | Ga0373934_0019874 | Ga0373934_0019874_720_1496 | 239 |
| 109 | 3300035089 | Ga0373944_0012090 | Ga0373944_0012090_1104_1895 | 239 |
| 110 | 3300035091 | Ga0373951_0017421 | Ga0373951_0017421_142_906 | 239 |
| 111 | 3300035119 | Ga0373956_0073902 | Ga0373956_0073902_89_865 | 239 |
| 112 | 3300035120 | Ga0373957_0068850 | Ga0373957_0068850_173_961 | 239 |
| 113 | 3300035171 | Ga0373946_0081095 | Ga0373946_0081095_238_1026 | 239 |
| 114 | 3300035172 | Ga0373955_0013651 | Ga0373955_0013651_97_873 | 239 |
| 115 | 3300035172 | Ga0373955_0041344 | Ga0373955_0041344_254_1042 | 239 |
| 116 | 3300035724 | Ga0373933_0014063 | Ga0373933_0014063_3157_3927 | 239 |
| 117 | 3300035724 | Ga0373933_0053913 | Ga0373933_0053913_1339_2115 | 239 |
| 118 | 3300035724 | Ga0373933_0074097 | Ga0373933_0074097_608_1384 | 239 |
| 119 | 3300036401 | Ga0373937_0027495 | Ga0373937_0027495_3050_3826 | 239 |
| 120 | 3300036401 | Ga0373937_0112254 | Ga0373937_0112254_635_1405 | 239 |
| 121 | 3300036401 | Ga0373937_0378438 | Ga0373937_0378438_49_825 | 239 |
| 122 | 3300046459 | Ga0495629_0146547 | Ga0495629_0146547_738_1529 | 239 |
| 123 | 3300046462 | Ga0495651_0023699 | Ga0495651_0023699_1389_2165 | 239 |
| 124 | 3300046462 | Ga0495651_0040760 | Ga0495651_0040760_1266_2042 | 239 |
| 125 | 3300046462 | Ga0495651_0224041 | Ga0495651_0224041_166_936 | 239 |
| 126 | 3300046477 | Ga0495664_0026244 | Ga0495664_0026244_732_1502 | 239 |
| 127 | 3300046499 | Ga0495594_0092479 | Ga0495594_0092479_415_1206 | 239 |
| 128 | 3300046514 | Ga0495618_0071667 | Ga0495618_0071667_701_1471 | 239 |
| 129 | 3300046526 | Ga0495666_0039696 | Ga0495666_0039696_1007_1798 | 239 |
| 130 | 3300046529 | Ga0495652_0041720 | Ga0495652_0041720_305_1081 | 239 |
| 131 | 3300046529 | Ga0495652_0199758 | Ga0495652_0199758_299_1069 | 239 |
| 132 | 3300046559 | Ga0495667_0006731 | Ga0495667_0006731_2162_2938 | 239 |
| 133 | 3300046663 | Ga0495635_0120999 | Ga0495635_0120999_513_1283 | 239 |
| 134 | 3300046675 | Ga0495657_0020719 | Ga0495657_0020719_2561_3337 | 239 |
| 135 | 3300046675 | Ga0495657_0042038 | Ga0495657_0042038_1973_2743 | 239 |
| 136 | 3300046678 | Ga0495599_0105895 | Ga0495599_0105895_845_1621 | 239 |
| 137 | 3300046679 | Ga0495623_0045131 | Ga0495623_0045131_763_1533 | 239 |
| 138 | 3300046679 | Ga0495623_0175146 | Ga0495623_0175146_119_895 | 239 |
| 139 | 3300046681 | Ga0495647_0068933 | Ga0495647_0068933_361_1152 | 239 |
| 140 | 3300046809 | Ga0495600_0134482 | Ga0495600_0134482_504_1274 | 239 |
| 141 | 3300047317 | Ga0495604_0022292 | Ga0495604_0022292_3644_4420 | 239 |
| 142 | 3300047322 | Ga0495680_0006296 | Ga0495680_0006296_180_956 | 239 |
| 143 | 3300047471 | Ga0495684_0194699 | Ga0495684_0194699_638_1414 | 239 |
| 144 | 3300048088 | Ga0495602_0018082 | Ga0495602_0018082_1359_2135 | 239 |
| 145 | 3300048088 | Ga0495602_0025113 | Ga0495602_0025113_1929_2705 | 239 |
| 146 | 3300048088 | Ga0495602_0140239 | Ga0495602_0140239_753_1523 | 239 |
| 147 | 3300050512 | nmdc:mga0n895_209079_c1 | nmdc:mga0n895_209079_c1_537_1301 | 239 |
| 148 | 3300003203 | JGI25406J46586_10011340 | JGI25406J46586_100113402 | 240 |
| 149 | 3300003659 | JGI25404J52841_10004335 | JGI25404J52841_100043354 | 240 |
| 150 | 3300005356 | Ga0070674_100353782 | Ga0070674_1003537822 | 240 |
| 151 | 3300005435 | Ga0070714_100179288 | Ga0070714_1001792882 | 240 |
| 152 | 3300005437 | Ga0070710_10049041 | Ga0070710_100490412 | 240 |
| 153 | 3300005439 | Ga0070711_100039016 | Ga0070711_1000390163 | 240 |
| 154 | 3300005467 | Ga0070706_100005940 | Ga0070706_10000594012 | 240 |
| 155 | 3300005937 | Ga0081455_10004970 | Ga0081455_1000497013 | 240 |
| 156 | 3300005983 | Ga0081540_1000074 | Ga0081540_10000744 | 240 |
| 157 | 3300005985 | Ga0081539_10000421 | Ga0081539_1000042129 | 240 |
| 158 | 3300006028 | Ga0070717_10000010 | Ga0070717_1000001041 | 240 |
| 159 | 3300006163 | Ga0070715_10001650 | Ga0070715_100016504 | 240 |
| 160 | 3300006173 | Ga0070716_100017725 | Ga0070716_1000177253 | 240 |
| 161 | 3300006871 | Ga0075434_100037030 | Ga0075434_1000370303 | 240 |
| 162 | 3300006914 | Ga0075436_100124083 | Ga0075436_1001240832 | 240 |
| 163 | 3300007076 | Ga0075435_100229163 | Ga0075435_1002291632 | 240 |
| 164 | 3300014969 | Ga0157376_10467377 | Ga0157376_104673772 | 240 |
| 165 | 3300025898 | Ga0207692_10000912 | Ga0207692_1000091213 | 240 |
| 166 | 3300025898 | Ga0207692_10175423 | Ga0207692_101754231 | 240 |
| 167 | 3300025910 | Ga0207684_10005619 | Ga0207684_1000561912 | 240 |
| 168 | 3300025912 | Ga0207707_10291145 | Ga0207707_102911452 | 240 |
| 169 | 3300025915 | Ga0207693_10016510 | Ga0207693_100165103 | 240 |
| 170 | 3300025921 | Ga0207652_10434379 | Ga0207652_104343792 | 240 |
| 171 | 3300025929 | Ga0207664_10001557 | Ga0207664_100015575 | 240 |
| 172 | 3300025929 | Ga0207664_10134335 | Ga0207664_101343352 | 240 |
| 173 | 3300025939 | Ga0207665_10004055 | Ga0207665_100040553 | 240 |
| 174 | 3300028379 | Ga0268266_10338612 | Ga0268266_103386122 | 240 |
| 175 | 3300028666 | Ga0265336_10013374 | Ga0265336_100133742 | 240 |
| 176 | 3300028800 | Ga0265338_10001861 | Ga0265338_1000186127 | 240 |
| 177 | 3300031251 | Ga0265327_10014535 | Ga0265327_100145352 | 240 |
| 178 | 3300031901 | Ga0307406_10042549 | Ga0307406_100425492 | 240 |
| 179 | 3300031903 | Ga0307407_10158111 | Ga0307407_101581112 | 240 |
| 180 | 3300031911 | Ga0307412_10377997 | Ga0307412_103779972 | 240 |
| 181 | 3300031995 | Ga0307409_100026214 | Ga0307409_1000262142 | 240 |
| 182 | 3300032002 | Ga0307416_100349572 | Ga0307416_1003495723 | 240 |
| 183 | 3300035089 | Ga0373944_0020636 | Ga0373944_0020636_704_1465 | 240 |
| 184 | 3300035111 | Ga0373923_0098372 | Ga0373923_0098372_88_849 | 240 |
| 185 | 3300035113 | Ga0373936_0013843 | Ga0373936_0013843_1615_2376 | 240 |
| 186 | 3300035116 | Ga0373945_0042664 | Ga0373945_0042664_704_1465 | 240 |
| 187 | 3300035119 | Ga0373956_0014711 | Ga0373956_0014711_2352_3122 | 240 |
| 188 | 3300035170 | Ga0373943_0018410 | Ga0373943_0018410_1376_2137 | 240 |
| 189 | 3300035171 | Ga0373946_0005624 | Ga0373946_0005624_2146_2907 | 240 |
| 190 | 3300035172 | Ga0373955_0192205 | Ga0373955_0192205_255_1040 | 240 |
| 191 | 3300035692 | Ga0373935_0030337 | Ga0373935_0030337_1517_2278 | 240 |
| 192 | 3300035695 | Ga0373927_0016408 | Ga0373927_0016408_3496_4257 | 240 |
| 193 | 3300035724 | Ga0373933_0175918 | Ga0373933_0175918_329_1096 | 240 |
| 194 | 3300035725 | Ga0373947_0004746 | Ga0373947_0004746_383_1144 | 240 |
| 195 | 3300036401 | Ga0373937_0044906 | Ga0373937_0044906_533_1318 | 240 |
| 196 | 3300036401 | Ga0373937_0584369 | Ga0373937_0584369_36_803 | 240 |
| 197 | 3300037068 | Ga0373925_0007907 | Ga0373925_0007907_1635_2396 | 240 |
| 198 | 3300044683 | Ga0466965_0070061 | Ga0466965_0070061_134_871 | 240 |
| 199 | 3300044706 | Ga0466964_0032567 | Ga0466964_0032567_495_1232 | 240 |
| 200 | 3300044842 | Ga0466957_0048984 | Ga0466957_0048984_1021_1758 | 240 |
| 201 | 3300045976 | Ga0466967_0035867 | Ga0466967_0035867_1129_1890 | 240 |
| 202 | 3300045976 | Ga0466967_0155764 | Ga0466967_0155764_797_1534 | 240 |
| 203 | 3300046454 | Ga0495592_0115879 | Ga0495592_0115879_17_784 | 240 |
| 204 | 3300046462 | Ga0495651_0073159 | Ga0495651_0073159_1435_2202 | 240 |
| 205 | 3300046463 | Ga0495653_0071947 | Ga0495653_0071947_355_1116 | 240 |
| 206 | 3300046476 | Ga0495662_0097420 | Ga0495662_0097420_373_1134 | 240 |
| 207 | 3300046477 | Ga0495664_0048897 | Ga0495664_0048897_373_1134 | 240 |
| 208 | 3300046511 | Ga0495608_0013978 | Ga0495608_0013978_1807_2574 | 240 |
| 209 | 3300046511 | Ga0495608_0065521 | Ga0495608_0065521_19_780 | 240 |
| 210 | 3300046514 | Ga0495618_0157402 | Ga0495618_0157402_151_912 | 240 |
| 211 | 3300046516 | Ga0495628_0101232 | Ga0495628_0101232_822_1589 | 240 |
| 212 | 3300046517 | Ga0495630_0022467 | Ga0495630_0022467_312_1073 | 240 |
| 213 | 3300046517 | Ga0495630_0196928 | Ga0495630_0196928_591_1358 | 240 |
| 214 | 3300046529 | Ga0495652_0012326 | Ga0495652_0012326_3081_3848 | 240 |
| 215 | 3300046529 | Ga0495652_0073193 | Ga0495652_0073193_1421_2182 | 240 |
| 216 | 3300046531 | Ga0495665_0086593 | Ga0495665_0086593_481_1242 | 240 |
| 217 | 3300046533 | Ga0495640_0066006 | Ga0495640_0066006_1602_2363 | 240 |
| 218 | 3300046536 | Ga0495587_0090843 | Ga0495587_0090843_690_1451 | 240 |
| 219 | 3300046536 | Ga0495587_0106743 | Ga0495587_0106743_707_1474 | 240 |
| 220 | 3300046543 | Ga0495645_0078337 | Ga0495645_0078337_347_1114 | 240 |
| 221 | 3300046559 | Ga0495667_0033211 | Ga0495667_0033211_1636_2397 | 240 |
| 222 | 3300046559 | Ga0495667_0053066 | Ga0495667_0053066_1849_2616 | 240 |
| 223 | 3300046642 | Ga0495634_0056071 | Ga0495634_0056071_1442_2209 | 240 |
| 224 | 3300046642 | Ga0495634_0125666 | Ga0495634_0125666_260_1021 | 240 |
| 225 | 3300046663 | Ga0495635_0000951 | Ga0495635_0000951_16740_17501 | 240 |
| 226 | 3300046663 | Ga0495635_0005849 | Ga0495635_0005849_4781_5548 | 240 |
| 227 | 3300046675 | Ga0495657_0055318 | Ga0495657_0055318_44_811 | 240 |
| 228 | 3300046675 | Ga0495657_0081640 | Ga0495657_0081640_395_1156 | 240 |
| 229 | 3300046678 | Ga0495599_0089190 | Ga0495599_0089190_417_1178 | 240 |
| 230 | 3300046681 | Ga0495647_0149639 | Ga0495647_0149639_199_960 | 240 |
| 231 | 3300046690 | Ga0495624_0047183 | Ga0495624_0047183_1634_2395 | 240 |
| 232 | 3300046809 | Ga0495600_0033945 | Ga0495600_0033945_1942_2709 | 240 |
| 233 | 3300047317 | Ga0495604_0044946 | Ga0495604_0044946_1619_2386 | 240 |
| 234 | 3300047319 | Ga0495674_0004290 | Ga0495674_0004290_523_1284 | 240 |
| 235 | 3300047319 | Ga0495674_0106510 | Ga0495674_0106510_911_1678 | 240 |
| 236 | 3300047319 | Ga0495674_0246978 | Ga0495674_0246978_421_1209 | 240 |
| 237 | 3300047321 | Ga0495676_0065828 | Ga0495676_0065828_366_1127 | 240 |
| 238 | 3300047322 | Ga0495680_0026194 | Ga0495680_0026194_154_921 | 240 |
| 239 | 3300047322 | Ga0495680_0071715 | Ga0495680_0071715_704_1465 | 240 |
| 240 | 3300047444 | Ga0495675_0154227 | Ga0495675_0154227_202_969 | 240 |
| 241 | 3300047471 | Ga0495684_0048038 | Ga0495684_0048038_509_1270 | 240 |
| 242 | 3300047471 | Ga0495684_0240540 | Ga0495684_0240540_518_1285 | 240 |
| 243 | 3300048088 | Ga0495602_0128131 | Ga0495602_0128131_707_1474 | 240 |
| 244 | 3300048905 | Ga0496102_0203907 | Ga0496102_0203907_384_1160 | 240 |
| 245 | 3300048907 | Ga0496104_0006284 | Ga0496104_0006284_2048_2824 | 240 |
| 246 | 3300048908 | Ga0496105_0002257 | Ga0496105_0002257_258_1034 | 240 |
| 247 | 3300048910 | Ga0496107_0189008 | Ga0496107_0189008_235_1011 | 240 |
| 248 | 3300048912 | Ga0496109_0154294 | Ga0496109_0154294_406_1182 | 240 |
| 249 | 3300048915 | Ga0496112_0029947 | Ga0496112_0029947_4102_4878 | 240 |
| 250 | 3300050513 | nmdc:mga0rr50_204116_c1 | nmdc:mga0rr50_204116_c1_434_1231 | 240 |
| 251 | 3300053085 | Ga0495619_0054659 | Ga0495619_0054659_991_1758 | 240 |
| 252 | iso_pu_bacteria | 2867312974 | 2867317909 | 240 |
| 253 | iso_pu_bacteria | 2867319477 | 2867319605 | 240 |
| 254 | 3300005327 | Ga0070658_10010707 | Ga0070658_100107073 | 241 |
| 255 | 3300005327 | Ga0070658_10059220 | Ga0070658_100592204 | 241 |
| 256 | 3300005329 | Ga0070683_100053379 | Ga0070683_1000533793 | 241 |
| 257 | 3300005337 | Ga0070682_100196382 | Ga0070682_1001963822 | 241 |
| 258 | 3300005345 | Ga0070692_10042979 | Ga0070692_100429792 | 241 |
| 259 | 3300005364 | Ga0070673_100102503 | Ga0070673_1001025032 | 241 |
| 260 | 3300005366 | Ga0070659_100129965 | Ga0070659_1001299652 | 241 |
| 261 | 3300005367 | Ga0070667_100051490 | Ga0070667_1000514903 | 241 |
| 262 | 3300005434 | Ga0070709_10443742 | Ga0070709_104437421 | 241 |
| 263 | 3300005436 | Ga0070713_100233704 | Ga0070713_1002337042 | 241 |
| 264 | 3300005437 | Ga0070710_10082152 | Ga0070710_100821522 | 241 |
| 265 | 3300005439 | Ga0070711_100323697 | Ga0070711_1003236972 | 241 |
| 266 | 3300005530 | Ga0070679_100190272 | Ga0070679_1001902722 | 241 |
| 267 | 3300005577 | Ga0068857_100180481 | Ga0068857_1001804812 | 241 |
| 268 | 3300005617 | Ga0068859_100260772 | Ga0068859_1002607722 | 241 |
| 269 | 3300006028 | Ga0070717_10298981 | Ga0070717_102989812 | 241 |
| 270 | 3300006175 | Ga0070712_100349679 | Ga0070712_1003496792 | 241 |
| 271 | 3300006880 | Ga0075429_100268463 | Ga0075429_1002684632 | 241 |
| 272 | 3300006931 | Ga0097620_100260786 | Ga0097620_1002607862 | 241 |
| 273 | 3300007076 | Ga0075435_100449846 | Ga0075435_1004498462 | 241 |
| 274 | 3300013102 | Ga0157371_10032175 | Ga0157371_100321753 | 241 |
| 275 | 3300013308 | Ga0157375_10094505 | Ga0157375_100945053 | 241 |
| 276 | 3300014968 | Ga0157379_10209688 | Ga0157379_102096882 | 241 |
| 277 | 3300021388 | Ga0213875_10015906 | Ga0213875_100159062 | 241 |
| 278 | 3300025898 | Ga0207692_10127797 | Ga0207692_101277971 | 241 |
| 279 | 3300025906 | Ga0207699_10210466 | Ga0207699_102104662 | 241 |
| 280 | 3300025915 | Ga0207693_10101953 | Ga0207693_101019533 | 241 |
| 281 | 3300025916 | Ga0207663_10222518 | Ga0207663_102225182 | 241 |
| 282 | 3300025921 | Ga0207652_10198611 | Ga0207652_101986112 | 241 |
| 283 | 3300025926 | Ga0207659_10488413 | Ga0207659_104884132 | 241 |
| 284 | 3300025928 | Ga0207700_10258258 | Ga0207700_102582583 | 241 |
| 285 | 3300025928 | Ga0207700_10354516 | Ga0207700_103545162 | 241 |
| 286 | 3300025929 | Ga0207664_10015225 | Ga0207664_100152252 | 241 |
| 287 | 3300025929 | Ga0207664_10044030 | Ga0207664_100440302 | 241 |
| 288 | 3300025932 | Ga0207690_10011248 | Ga0207690_100112485 | 241 |
| 289 | 3300025933 | Ga0207706_10021574 | Ga0207706_100215743 | 241 |
| 290 | 3300025986 | Ga0207658_10067006 | Ga0207658_100670062 | 241 |
| 291 | 3300026078 | Ga0207702_10258128 | Ga0207702_102581283 | 241 |
| 292 | 3300026095 | Ga0207676_10091777 | Ga0207676_100917772 | 241 |
| 293 | 3300026116 | Ga0207674_10061630 | Ga0207674_100616304 | 241 |
| 294 | 3300035090 | Ga0373949_0011519 | Ga0373949_0011519_847_1608 | 241 |
| 295 | 3300035111 | Ga0373923_0045546 | Ga0373923_0045546_751_1521 | 241 |
| 296 | 3300035121 | Ga0373960_0065657 | Ga0373960_0065657_242_1003 | 241 |
| 297 | 3300035172 | Ga0373955_0140804 | Ga0373955_0140804_117_887 | 241 |
| 298 | 3300035691 | Ga0373931_0125129 | Ga0373931_0125129_128_889 | 241 |
| 299 | 3300037068 | Ga0373925_0230267 | Ga0373925_0230267_247_1008 | 241 |
| 300 | 3300037312 | Ga0395899_0211122 | Ga0395899_0211122_433_1218 | 241 |
| 301 | 3300037466 | Ga0395898_0158606 | Ga0395898_0158606_993_1775 | 241 |
| 302 | 3300037853 | Ga0436364_0106996 | Ga0436364_0106996_4334_5083 | 241 |
| 303 | 3300038443 | Ga0395901_0582159 | Ga0395901_0582159_249_1034 | 241 |
| 304 | 3300041512 | Ga0451853_0784232 | Ga0451853_0784232_118_879 | 241 |
| 305 | 3300044735 | Ga0466968_0237417 | Ga0466968_0237417_71_823 | 241 |
| 306 | 3300046461 | Ga0495641_0075303 | Ga0495641_0075303_399_1163 | 241 |
| 307 | 3300046517 | Ga0495630_0219811 | Ga0495630_0219811_376_1146 | 241 |
| 308 | 3300046559 | Ga0495667_0035330 | Ga0495667_0035330_876_1646 | 241 |
| 309 | 3300047471 | Ga0495684_0169892 | Ga0495684_0169892_595_1365 | 241 |
| 310 | 3300048909 | Ga0496106_0037129 | Ga0496106_0037129_2469_3230 | 241 |
| 311 | 3300048915 | Ga0496112_0298895 | Ga0496112_0298895_639_1400 | 241 |
| 312 | 3300048918 | Ga0496115_0082818 | Ga0496115_0082818_366_1127 | 241 |
| 313 | 3300005327 | Ga0070658_10123451 | Ga0070658_101234512 | 242 |
| 314 | 3300005434 | Ga0070709_10000198 | Ga0070709_1000019827 | 242 |
| 315 | 3300005435 | Ga0070714_100003316 | Ga0070714_1000033163 | 242 |
| 316 | 3300005435 | Ga0070714_100008683 | Ga0070714_1000086835 | 242 |
| 317 | 3300005436 | Ga0070713_100025012 | Ga0070713_1000250123 | 242 |
| 318 | 3300005437 | Ga0070710_10003510 | Ga0070710_100035103 | 242 |
| 319 | 3300005439 | Ga0070711_100009129 | Ga0070711_1000091295 | 242 |
| 320 | 3300005440 | Ga0070705_100001031 | Ga0070705_1000010312 | 242 |
| 321 | 3300005549 | Ga0070704_100143008 | Ga0070704_1001430082 | 242 |
| 322 | 3300006173 | Ga0070716_100000184 | Ga0070716_1000001843 | 242 |
| 323 | 3300011119 | Ga0105246_10003753 | Ga0105246_100037537 | 242 |
| 324 | 3300013105 | Ga0157369_10118212 | Ga0157369_101182123 | 242 |
| 325 | 3300025898 | Ga0207692_10000151 | Ga0207692_100001513 | 242 |
| 326 | 3300025906 | Ga0207699_10000357 | Ga0207699_100003573 | 242 |
| 327 | 3300025916 | Ga0207663_10003484 | Ga0207663_100034846 | 242 |
| 328 | 3300025928 | Ga0207700_10000404 | Ga0207700_1000040422 | 242 |
| 329 | 3300025928 | Ga0207700_10551826 | Ga0207700_105518262 | 242 |
| 330 | 3300025929 | Ga0207664_10000484 | Ga0207664_100004846 | 242 |
| 331 | 3300025929 | Ga0207664_10000644 | Ga0207664_1000064419 | 242 |
| 332 | 3300025939 | Ga0207665_10000042 | Ga0207665_1000004244 | 242 |
| 333 | 3300035086 | Ga0373934_0020746 | Ga0373934_0020746_833_1630 | 242 |
| 334 | 3300035117 | Ga0373953_0000883 | Ga0373953_0000883_711_1508 | 242 |
| 335 | 3300035172 | Ga0373955_0130680 | Ga0373955_0130680_279_1076 | 242 |
| 336 | 3300035172 | Ga0373955_0245265 | Ga0373955_0245265_260_1063 | 242 |
| 337 | 3300035692 | Ga0373935_0110186 | Ga0373935_0110186_209_1006 | 242 |
| 338 | 3300035695 | Ga0373927_0053687 | Ga0373927_0053687_1105_1902 | 242 |
| 339 | 3300035724 | Ga0373933_0004044 | Ga0373933_0004044_2771_3568 | 242 |
| 340 | 3300035725 | Ga0373947_0274101 | Ga0373947_0274101_178_975 | 242 |
| 341 | 3300036401 | Ga0373937_0008016 | Ga0373937_0008016_3038_3835 | 242 |
| 342 | 3300037068 | Ga0373925_0052242 | Ga0373925_0052242_632_1429 | 242 |
| 343 | 3300037068 | Ga0373925_0145079 | Ga0373925_0145079_708_1505 | 242 |
| 344 | 3300039438 | Ga0436360_0348714 | Ga0436360_0348714_117_923 | 242 |
| 345 | 3300039450 | Ga0436363_0964495 | Ga0436363_0964495_121_915 | 242 |
| 346 | 3300044765 | Ga0466970_0039347 | Ga0466970_0039347_218_1003 | 242 |
| 347 | 3300046454 | Ga0495592_0011520 | Ga0495592_0011520_4722_5519 | 242 |
| 348 | 3300046461 | Ga0495641_0007210 | Ga0495641_0007210_505_1302 | 242 |
| 349 | 3300046462 | Ga0495651_0004885 | Ga0495651_0004885_2636_3433 | 242 |
| 350 | 3300046463 | Ga0495653_0061535 | Ga0495653_0061535_1223_2020 | 242 |
| 351 | 3300046473 | Ga0495582_0046302 | Ga0495582_0046302_36_833 | 242 |
| 352 | 3300046475 | Ga0495639_0053636 | Ga0495639_0053636_490_1287 | 242 |
| 353 | 3300046476 | Ga0495662_0048557 | Ga0495662_0048557_1231_2028 | 242 |
| 354 | 3300046477 | Ga0495664_0021110 | Ga0495664_0021110_1434_2231 | 242 |
| 355 | 3300046514 | Ga0495618_0064378 | Ga0495618_0064378_818_1615 | 242 |
| 356 | 3300046516 | Ga0495628_0042995 | Ga0495628_0042995_789_1586 | 242 |
| 357 | 3300046529 | Ga0495652_0084052 | Ga0495652_0084052_1001_1798 | 242 |
| 358 | 3300046533 | Ga0495640_0046734 | Ga0495640_0046734_498_1295 | 242 |
| 359 | 3300046543 | Ga0495645_0008113 | Ga0495645_0008113_3786_4583 | 242 |
| 360 | 3300046559 | Ga0495667_0078679 | Ga0495667_0078679_1301_2110 | 242 |
| 361 | 3300046675 | Ga0495657_0054676 | Ga0495657_0054676_492_1289 | 242 |
| 362 | 3300046679 | Ga0495623_0032320 | Ga0495623_0032320_599_1396 | 242 |
| 363 | 3300046680 | Ga0495646_0148883 | Ga0495646_0148883_91_870 | 242 |
| 364 | 3300046809 | Ga0495600_0033158 | Ga0495600_0033158_1135_1932 | 242 |
| 365 | 3300047317 | Ga0495604_0101866 | Ga0495604_0101866_711_1508 | 242 |
| 366 | 3300047321 | Ga0495676_0243737 | Ga0495676_0243737_47_844 | 242 |
| 367 | 3300047322 | Ga0495680_0070996 | Ga0495680_0070996_711_1508 | 242 |
| 368 | 3300047444 | Ga0495675_0006842 | Ga0495675_0006842_437_1234 | 242 |
| 369 | 3300047471 | Ga0495684_0122951 | Ga0495684_0122951_338_1135 | 242 |
| 370 | 3300047673 | Ga0495593_0025990 | Ga0495593_0025990_2420_3217 | 242 |
| 371 | 3300048089 | Ga0495614_0009992 | Ga0495614_0009992_971_1753 | 242 |
| 372 | 3300048903 | Ga0496100_0120895 | Ga0496100_0120895_654_1481 | 242 |
| 373 | 3300048929 | Ga0496126_0235246 | Ga0496126_0235246_206_1042 | 242 |
| 374 | 3300053077 | Ga0495601_0092166 | Ga0495601_0092166_634_1431 | 242 |
| 375 | 3300053078 | Ga0495612_0054437 | Ga0495612_0054437_369_1166 | 242 |
| 376 | 3300053084 | Ga0495595_0019025 | Ga0495595_0019025_1674_2471 | 242 |
| 377 | 3300005330 | Ga0070690_100028460 | Ga0070690_1000284603 | 243 |
| 378 | 3300005340 | Ga0070689_100111574 | Ga0070689_1001115742 | 243 |
| 379 | 3300005343 | Ga0070687_100164203 | Ga0070687_1001642032 | 243 |
| 380 | 3300005355 | Ga0070671_100024167 | Ga0070671_1000241674 | 243 |
| 381 | 3300005356 | Ga0070674_100314731 | Ga0070674_1003147312 | 243 |
| 382 | 3300005365 | Ga0070688_100035000 | Ga0070688_1000350002 | 243 |
| 383 | 3300005437 | Ga0070710_10204129 | Ga0070710_102041291 | 243 |
| 384 | 3300005440 | Ga0070705_100106053 | Ga0070705_1001060532 | 243 |
| 385 | 3300005458 | Ga0070681_10078952 | Ga0070681_100789523 | 243 |
| 386 | 3300005467 | Ga0070706_100056829 | Ga0070706_1000568295 | 243 |
| 387 | 3300005471 | Ga0070698_100001515 | Ga0070698_10000151513 | 243 |
| 388 | 3300005471 | Ga0070698_100001616 | Ga0070698_10000161616 | 243 |
| 389 | 3300005518 | Ga0070699_100000578 | Ga0070699_10000057814 | 243 |
| 390 | 3300005518 | Ga0070699_100418972 | Ga0070699_1004189722 | 243 |
| 391 | 3300005530 | Ga0070679_100074346 | Ga0070679_1000743464 | 243 |
| 392 | 3300005535 | Ga0070684_100079780 | Ga0070684_1000797802 | 243 |
| 393 | 3300005536 | Ga0070697_100003261 | Ga0070697_10000326110 | 243 |
| 394 | 3300005539 | Ga0068853_100339466 | Ga0068853_1003394661 | 243 |
| 395 | 3300005564 | Ga0070664_100071861 | Ga0070664_1000718612 | 243 |
| 396 | 3300005564 | Ga0070664_100353640 | Ga0070664_1003536402 | 243 |
| 397 | 3300005615 | Ga0070702_100020323 | Ga0070702_1000203233 | 243 |
| 398 | 3300005618 | Ga0068864_100107526 | Ga0068864_1001075262 | 243 |
| 399 | 3300005842 | Ga0068858_100892930 | Ga0068858_1008929301 | 243 |
| 400 | 3300006028 | Ga0070717_10082257 | Ga0070717_100822573 | 243 |
| 401 | 3300006163 | Ga0070715_10004966 | Ga0070715_100049663 | 243 |
| 402 | 3300006173 | Ga0070716_100049276 | Ga0070716_1000492762 | 243 |
| 403 | 3300006880 | Ga0075429_100015337 | Ga0075429_1000153375 | 243 |
| 404 | 3300006881 | Ga0068865_100135885 | Ga0068865_1001358851 | 243 |
| 405 | 3300009098 | Ga0105245_10100901 | Ga0105245_101009012 | 243 |
| 406 | 3300009101 | Ga0105247_10028545 | Ga0105247_100285452 | 243 |
| 407 | 3300009148 | Ga0105243_10029708 | Ga0105243_100297083 | 243 |
| 408 | 3300009148 | Ga0105243_10373435 | Ga0105243_103734352 | 243 |
| 409 | 3300009174 | Ga0105241_10020146 | Ga0105241_100201463 | 243 |
| 410 | 3300009176 | Ga0105242_10036596 | Ga0105242_100365963 | 243 |
| 411 | 3300009176 | Ga0105242_10059768 | Ga0105242_100597683 | 243 |
| 412 | 3300009551 | Ga0105238_10033058 | Ga0105238_100330583 | 243 |
| 413 | 3300009551 | Ga0105238_10391132 | Ga0105238_103911322 | 243 |
| 414 | 3300009553 | Ga0105249_10033268 | Ga0105249_100332684 | 243 |
| 415 | 3300011119 | Ga0105246_10018223 | Ga0105246_100182232 | 243 |
| 416 | 3300013102 | Ga0157371_10027044 | Ga0157371_100270442 | 243 |
| 417 | 3300013104 | Ga0157370_10191124 | Ga0157370_101911242 | 243 |
| 418 | 3300013296 | Ga0157374_10528145 | Ga0157374_105281452 | 243 |
| 419 | 3300013297 | Ga0157378_10048437 | Ga0157378_100484372 | 243 |
| 420 | 3300013308 | Ga0157375_10048920 | Ga0157375_100489203 | 243 |
| 421 | 3300013308 | Ga0157375_10450910 | Ga0157375_104509102 | 243 |
| 422 | 3300014325 | Ga0163163_10061786 | Ga0163163_100617864 | 243 |
| 423 | 3300014325 | Ga0163163_10079433 | Ga0163163_100794332 | 243 |
| 424 | 3300020080 | Ga0206350_10114685 | Ga0206350_101146854 | 243 |
| 425 | 3300025898 | Ga0207692_10053047 | Ga0207692_100530472 | 243 |
| 426 | 3300025899 | Ga0207642_10020865 | Ga0207642_100208652 | 243 |
| 427 | 3300025901 | Ga0207688_10010067 | Ga0207688_100100674 | 243 |
| 428 | 3300025901 | Ga0207688_10160785 | Ga0207688_101607852 | 243 |
| 429 | 3300025904 | Ga0207647_10051605 | Ga0207647_100516052 | 243 |
| 430 | 3300025905 | Ga0207685_10043655 | Ga0207685_100436552 | 243 |
| 431 | 3300025906 | Ga0207699_10008137 | Ga0207699_100081372 | 243 |
| 432 | 3300025907 | Ga0207645_10030978 | Ga0207645_100309783 | 243 |
| 433 | 3300025910 | Ga0207684_10045396 | Ga0207684_100453962 | 243 |
| 434 | 3300025910 | Ga0207684_10110666 | Ga0207684_101106662 | 243 |
| 435 | 3300025922 | Ga0207646_10033173 | Ga0207646_100331734 | 243 |
| 436 | 3300025922 | Ga0207646_10314678 | Ga0207646_103146782 | 243 |
| 437 | 3300025924 | Ga0207694_10072412 | Ga0207694_100724124 | 243 |
| 438 | 3300025927 | Ga0207687_10109198 | Ga0207687_101091982 | 243 |
| 439 | 3300025928 | Ga0207700_10047188 | Ga0207700_100471882 | 243 |
| 440 | 3300025929 | Ga0207664_10094408 | Ga0207664_100944082 | 243 |
| 441 | 3300025929 | Ga0207664_10349597 | Ga0207664_103495972 | 243 |
| 442 | 3300025929 | Ga0207664_10650528 | Ga0207664_106505281 | 243 |
| 443 | 3300025934 | Ga0207686_10211175 | Ga0207686_102111752 | 243 |
| 444 | 3300025939 | Ga0207665_10105239 | Ga0207665_101052393 | 243 |
| 445 | 3300025940 | Ga0207691_10021065 | Ga0207691_100210654 | 243 |
| 446 | 3300025941 | Ga0207711_10095258 | Ga0207711_100952581 | 243 |
| 447 | 3300025942 | Ga0207689_10018569 | Ga0207689_100185694 | 243 |
| 448 | 3300026067 | Ga0207678_10000752 | Ga0207678_1000075234 | 243 |
| 449 | 3300026067 | Ga0207678_10401187 | Ga0207678_104011872 | 243 |
| 450 | 3300026075 | Ga0207708_10030540 | Ga0207708_100305402 | 243 |
| 451 | 3300026078 | Ga0207702_10026614 | Ga0207702_100266142 | 243 |
| 452 | 3300026095 | Ga0207676_10205945 | Ga0207676_102059452 | 243 |
| 453 | 3300026121 | Ga0207683_10012993 | Ga0207683_100129933 | 243 |
| 454 | 3300026121 | Ga0207683_10259273 | Ga0207683_102592732 | 243 |
| 455 | 3300028558 | Ga0265326_10000008 | Ga0265326_1000000845 | 243 |
| 456 | 3300028563 | Ga0265319_1001253 | Ga0265319_10012534 | 243 |
| 457 | 3300028573 | Ga0265334_10000152 | Ga0265334_1000015245 | 243 |
| 458 | 3300028666 | Ga0265336_10013987 | Ga0265336_100139872 | 243 |
| 459 | 3300028800 | Ga0265338_10008474 | Ga0265338_100084748 | 243 |
| 460 | 3300029957 | Ga0265324_10003605 | Ga0265324_100036054 | 243 |
| 461 | 3300031240 | Ga0265320_10073255 | Ga0265320_100732552 | 243 |
| 462 | 3300031824 | Ga0307413_10289124 | Ga0307413_102891242 | 243 |
| 463 | 3300035084 | Ga0373928_0004087 | Ga0373928_0004087_273_1076 | 243 |
| 464 | 3300035086 | Ga0373934_0036126 | Ga0373934_0036126_155_961 | 243 |
| 465 | 3300035089 | Ga0373944_0000589 | Ga0373944_0000589_7690_8496 | 243 |
| 466 | 3300035111 | Ga0373923_0000101 | Ga0373923_0000101_3832_4638 | 243 |
| 467 | 3300035113 | Ga0373936_0000233 | Ga0373936_0000233_17407_18213 | 243 |
| 468 | 3300035116 | Ga0373945_0009044 | Ga0373945_0009044_149_955 | 243 |
| 469 | 3300035118 | Ga0373954_0022351 | Ga0373954_0022351_154_960 | 243 |
| 470 | 3300035119 | Ga0373956_0050766 | Ga0373956_0050766_913_1755 | 243 |
| 471 | 3300035171 | Ga0373946_0000171 | Ga0373946_0000171_2415_3221 | 243 |
| 472 | 3300035172 | Ga0373955_0001986 | Ga0373955_0001986_5613_6419 | 243 |
| 473 | 3300035410 | Ga0373924_0009072 | Ga0373924_0009072_473_1279 | 243 |
| 474 | 3300035692 | Ga0373935_0091211 | Ga0373935_0091211_985_1791 | 243 |
| 475 | 3300035695 | Ga0373927_0004565 | Ga0373927_0004565_150_956 | 243 |
| 476 | 3300035724 | Ga0373933_0017823 | Ga0373933_0017823_2371_3177 | 243 |
| 477 | 3300035725 | Ga0373947_0001122 | Ga0373947_0001122_300_1106 | 243 |
| 478 | 3300036401 | Ga0373937_0057483 | Ga0373937_0057483_2372_3178 | 243 |
| 479 | 3300036401 | Ga0373937_0128272 | Ga0373937_0128272_1304_2146 | 243 |
| 480 | 3300037068 | Ga0373925_0027209 | Ga0373925_0027209_1010_1816 | 243 |
| 481 | 3300037418 | Ga0395900_0191147 | Ga0395900_0191147_1254_2021 | 243 |
| 482 | 3300037466 | Ga0395898_0078229 | Ga0395898_0078229_2267_3034 | 243 |
| 483 | 3300046454 | Ga0495592_0025397 | Ga0495592_0025397_538_1344 | 243 |
| 484 | 3300046454 | Ga0495592_0028991 | Ga0495592_0028991_3232_4074 | 243 |
| 485 | 3300046455 | Ga0495603_0005339 | Ga0495603_0005339_2442_3248 | 243 |
| 486 | 3300046459 | Ga0495629_0001549 | Ga0495629_0001549_2414_3220 | 243 |
| 487 | 3300046461 | Ga0495641_0006847 | Ga0495641_0006847_818_1624 | 243 |
| 488 | 3300046462 | Ga0495651_0016351 | Ga0495651_0016351_3968_4774 | 243 |
| 489 | 3300046462 | Ga0495651_0018305 | Ga0495651_0018305_3527_4369 | 243 |
| 490 | 3300046463 | Ga0495653_0025465 | Ga0495653_0025465_3467_4309 | 243 |
| 491 | 3300046472 | Ga0495580_0001403 | Ga0495580_0001403_19532_20338 | 243 |
| 492 | 3300046473 | Ga0495582_0001716 | Ga0495582_0001716_8859_9665 | 243 |
| 493 | 3300046475 | Ga0495639_0008056 | Ga0495639_0008056_410_1216 | 243 |
| 494 | 3300046475 | Ga0495639_0103619 | Ga0495639_0103619_446_1288 | 243 |
| 495 | 3300046476 | Ga0495662_0020455 | Ga0495662_0020455_2366_3172 | 243 |
| 496 | 3300046477 | Ga0495664_0032158 | Ga0495664_0032158_645_1451 | 243 |
| 497 | 3300046499 | Ga0495594_0050795 | Ga0495594_0050795_600_1406 | 243 |
| 498 | 3300046511 | Ga0495608_0054487 | Ga0495608_0054487_86_892 | 243 |
| 499 | 3300046511 | Ga0495608_0161709 | Ga0495608_0161709_382_1224 | 243 |
| 500 | 3300046514 | Ga0495618_0003574 | Ga0495618_0003574_6459_7265 | 243 |
| 501 | 3300046514 | Ga0495618_0020187 | Ga0495618_0020187_3064_3906 | 243 |
| 502 | 3300046516 | Ga0495628_0027371 | Ga0495628_0027371_301_1143 | 243 |
| 503 | 3300046517 | Ga0495630_0027568 | Ga0495630_0027568_2443_3249 | 243 |
| 504 | 3300046526 | Ga0495666_0015461 | Ga0495666_0015461_1171_1977 | 243 |
| 505 | 3300046529 | Ga0495652_0031939 | Ga0495652_0031939_3077_3883 | 243 |
| 506 | 3300046531 | Ga0495665_0014532 | Ga0495665_0014532_1068_1874 | 243 |
| 507 | 3300046533 | Ga0495640_0002112 | Ga0495640_0002112_9093_9899 | 243 |
| 508 | 3300046533 | Ga0495640_0169235 | Ga0495640_0169235_389_1231 | 243 |
| 509 | 3300046535 | Ga0495586_0021968 | Ga0495586_0021968_2261_3067 | 243 |
| 510 | 3300046536 | Ga0495587_0040280 | Ga0495587_0040280_806_1648 | 243 |
| 511 | 3300046536 | Ga0495587_0071961 | Ga0495587_0071961_965_1771 | 243 |
| 512 | 3300046543 | Ga0495645_0014580 | Ga0495645_0014580_2402_3208 | 243 |
| 513 | 3300046559 | Ga0495667_0007380 | Ga0495667_0007380_4278_5084 | 243 |
| 514 | 3300046559 | Ga0495667_0048551 | Ga0495667_0048551_625_1467 | 243 |
| 515 | 3300046642 | Ga0495634_0028522 | Ga0495634_0028522_818_1624 | 243 |
| 516 | 3300046675 | Ga0495657_0001649 | Ga0495657_0001649_818_1624 | 243 |
| 517 | 3300046675 | Ga0495657_0058652 | Ga0495657_0058652_1441_2283 | 243 |
| 518 | 3300046678 | Ga0495599_0015082 | Ga0495599_0015082_353_1195 | 243 |
| 519 | 3300046678 | Ga0495599_0020997 | Ga0495599_0020997_2372_3178 | 243 |
| 520 | 3300046679 | Ga0495623_0023482 | Ga0495623_0023482_1893_2735 | 243 |
| 521 | 3300046679 | Ga0495623_0028615 | Ga0495623_0028615_2186_2992 | 243 |
| 522 | 3300046680 | Ga0495646_0011492 | Ga0495646_0011492_2443_3249 | 243 |
| 523 | 3300046680 | Ga0495646_0015911 | Ga0495646_0015911_3659_4501 | 243 |
| 524 | 3300046681 | Ga0495647_0040292 | Ga0495647_0040292_120_926 | 243 |
| 525 | 3300046683 | Ga0495658_0008962 | Ga0495658_0008962_2233_3039 | 243 |
| 526 | 3300046689 | Ga0495613_0016116 | Ga0495613_0016116_4349_5155 | 243 |
| 527 | 3300046690 | Ga0495624_0002996 | Ga0495624_0002996_8184_8990 | 243 |
| 528 | 3300046809 | Ga0495600_0013119 | Ga0495600_0013119_4151_4957 | 243 |
| 529 | 3300047315 | Ga0495581_0004124 | Ga0495581_0004124_2404_3210 | 243 |
| 530 | 3300047317 | Ga0495604_0022121 | Ga0495604_0022121_3419_4261 | 243 |
| 531 | 3300047317 | Ga0495604_0131823 | Ga0495604_0131823_912_1718 | 243 |
| 532 | 3300047319 | Ga0495674_0059461 | Ga0495674_0059461_282_1088 | 243 |
| 533 | 3300047321 | Ga0495676_0050282 | Ga0495676_0050282_645_1451 | 243 |
| 534 | 3300047322 | Ga0495680_0020131 | Ga0495680_0020131_2443_3249 | 243 |
| 535 | 3300047322 | Ga0495680_0052465 | Ga0495680_0052465_1482_2324 | 243 |
| 536 | 3300047444 | Ga0495675_0110803 | Ga0495675_0110803_702_1544 | 243 |
| 537 | 3300047444 | Ga0495675_0183634 | Ga0495675_0183634_372_1178 | 243 |
| 538 | 3300047471 | Ga0495684_0029692 | Ga0495684_0029692_806_1648 | 243 |
| 539 | 3300047471 | Ga0495684_0032688 | Ga0495684_0032688_2372_3178 | 243 |
| 540 | 3300047673 | Ga0495593_0000569 | Ga0495593_0000569_13995_14801 | 243 |
| 541 | 3300048088 | Ga0495602_0159394 | Ga0495602_0159394_736_1542 | 243 |
| 542 | 3300048088 | Ga0495602_0272519 | Ga0495602_0272519_122_964 | 243 |
| 543 | 3300048089 | Ga0495614_0013749 | Ga0495614_0013749_1972_2778 | 243 |
| 544 | 3300048903 | Ga0496100_0110499 | Ga0496100_0110499_174_977 | 243 |
| 545 | 3300048904 | Ga0496101_0055206 | Ga0496101_0055206_228_1031 | 243 |
| 546 | 3300048905 | Ga0496102_0222361 | Ga0496102_0222361_786_1535 | 243 |
| 547 | 3300048906 | Ga0496103_0354745 | Ga0496103_0354745_158_907 | 243 |
| 548 | 3300048907 | Ga0496104_0040529 | Ga0496104_0040529_2632_3435 | 243 |
| 549 | 3300048908 | Ga0496105_0003384 | Ga0496105_0003384_504_1337 | 243 |
| 550 | 3300048908 | Ga0496105_0022474 | Ga0496105_0022474_156_959 | 243 |
| 551 | 3300048913 | Ga0496110_0014490 | Ga0496110_0014490_1731_2534 | 243 |
| 552 | 3300048913 | Ga0496110_0678764 | Ga0496110_0678764_72_839 | 243 |
| 553 | 3300048914 | Ga0496111_0026244 | Ga0496111_0026244_1714_2517 | 243 |
| 554 | 3300048915 | Ga0496112_0281210 | Ga0496112_0281210_497_1330 | 243 |
| 555 | 3300048916 | Ga0496113_0271978 | Ga0496113_0271978_24_857 | 243 |
| 556 | 3300048917 | Ga0496114_0405368 | Ga0496114_0405368_420_1187 | 243 |
| 557 | 3300048918 | Ga0496115_0275242 | Ga0496115_0275242_259_1077 | 243 |
| 558 | 3300049572 | Ga0501036_0009108 | Ga0501036_0009108_5969_6760 | 243 |
| 559 | 3300049574 | Ga0501038_0117828 | Ga0501038_0117828_1273_2064 | 243 |
| 560 | 3300049576 | Ga0501040_0012841 | Ga0501040_0012841_759_1550 | 243 |
| 561 | 3300049577 | Ga0501041_0096193 | Ga0501041_0096193_457_1248 | 243 |
| 562 | 3300049580 | Ga0501046_0078427 | Ga0501046_0078427_640_1431 | 243 |
| 563 | 3300049582 | Ga0501048_0112403 | Ga0501048_0112403_1111_1902 | 243 |
| 564 | 3300049585 | Ga0501069_0162641 | Ga0501069_0162641_249_1040 | 243 |
| 565 | 3300049587 | Ga0501071_0032008 | Ga0501071_0032008_2490_3281 | 243 |
| 566 | 3300049587 | Ga0501071_0448650 | Ga0501071_0448650_16_795 | 243 |
| 567 | 3300049588 | Ga0501072_0059576 | Ga0501072_0059576_869_1660 | 243 |
| 568 | 3300049588 | Ga0501072_0098812 | Ga0501072_0098812_131_874 | 243 |
| 569 | 3300049590 | Ga0501074_0191911 | Ga0501074_0191911_460_1251 | 243 |
| 570 | 3300049591 | Ga0501075_0145032 | Ga0501075_0145032_873_1664 | 243 |
| 571 | 3300049592 | Ga0501076_0007978 | Ga0501076_0007978_6879_7670 | 243 |
| 572 | 3300049593 | Ga0501077_0085255 | Ga0501077_0085255_91_882 | 243 |
| 573 | 3300049741 | Ga0501079_0121616 | Ga0501079_0121616_372_1163 | 243 |
| 574 | 3300049742 | Ga0501080_0190582 | Ga0501080_0190582_83_874 | 243 |
| 575 | 3300049743 | Ga0501081_0034845 | Ga0501081_0034845_129_920 | 243 |
| 576 | 3300049822 | Ga0501035_0042510 | Ga0501035_0042510_2067_2858 | 243 |
| 577 | 3300049823 | Ga0501044_0085116 | Ga0501044_0085116_1928_2686 | 243 |
| 578 | 3300049824 | Ga0501045_0094897 | Ga0501045_0094897_321_1112 | 243 |
| 579 | 3300050508 | nmdc:mga09592_16026_c1 | nmdc:mga09592_16026_c1_4038_4832 | 243 |
| 580 | 3300053077 | Ga0495601_0100116 | Ga0495601_0100116_221_1063 | 243 |
| 581 | 3300053078 | Ga0495612_0007523 | Ga0495612_0007523_1222_2028 | 243 |
| 582 | 3300053084 | Ga0495595_0008824 | Ga0495595_0008824_2938_3780 | 243 |
| 583 | 3300053084 | Ga0495595_0022435 | Ga0495595_0022435_1779_2585 | 243 |
| 584 | 3300053085 | Ga0495619_0008048 | Ga0495619_0008048_5585_6391 | 243 |
| 585 | 3300054114 | Ga0501084_0038908 | Ga0501084_0038908_1093_1884 | 243 |
| 586 | 3300061734 | Ga0530510_0051263 | Ga0530510_0051263_1371_2162 | 243 |
| 587 | iso_pu_bacteria | 2675903058 | 2676475787 | 243 |
| 588 | iso_pu_bacteria | 2811994882 | 2812374923 | 243 |
| 589 | iso_pu_bacteria | 2818991458 | 2819666525 | 243 |
| 590 | iso_pu_bacteria | 2827628540 | 2827630348 | 243 |
| 591 | 3300006028 | Ga0070717_10117030 | Ga0070717_101170302 | 244 |
| 592 | 3300006175 | Ga0070712_100054075 | Ga0070712_1000540751 | 244 |
| 593 | 3300014326 | Ga0157380_10545556 | Ga0157380_105455562 | 244 |
| 594 | 3300014745 | Ga0157377_10015569 | Ga0157377_100155695 | 244 |
| 595 | 3300021388 | Ga0213875_10000246 | Ga0213875_1000024633 | 244 |
| 596 | 3300031456 | Ga0307513_10015320 | Ga0307513_100153203 | 244 |
| 597 | 3300031903 | Ga0307407_10432911 | Ga0307407_104329111 | 244 |
| 598 | 3300031995 | Ga0307409_100674669 | Ga0307409_1006746691 | 244 |
| 599 | 3300032002 | Ga0307416_100790717 | Ga0307416_1007907172 | 244 |
| 600 | 3300037312 | Ga0395899_0221190 | Ga0395899_0221190_243_1025 | 244 |
| 601 | 3300037853 | Ga0436364_0330965 | Ga0436364_0330965_168615_169460 | 244 |
| 602 | 3300044901 | Ga0466960_0309215 | Ga0466960_0309215_127_870 | 244 |
| 603 | 3300047315 | Ga0495581_0102609 | Ga0495581_0102609_326_1087 | 244 |
| 604 | 3300049571 | Ga0501034_0687686 | Ga0501034_0687686_137_904 | 244 |
| 605 | 3300049572 | Ga0501036_0001833 | Ga0501036_0001833_10428_11195 | 244 |
| 606 | 3300049574 | Ga0501038_0032357 | Ga0501038_0032357_2989_3756 | 244 |
| 607 | 3300049575 | Ga0501039_0042421 | Ga0501039_0042421_1622_2389 | 244 |
| 608 | 3300049576 | Ga0501040_0090813 | Ga0501040_0090813_1237_1977 | 244 |
| 609 | 3300049577 | Ga0501041_0020790 | Ga0501041_0020790_213_980 | 244 |
| 610 | 3300049578 | Ga0501042_0000649 | Ga0501042_0000649_407_1174 | 244 |
| 611 | 3300049580 | Ga0501046_0005754 | Ga0501046_0005754_4136_4903 | 244 |
| 612 | 3300049582 | Ga0501048_0009775 | Ga0501048_0009775_2459_3226 | 244 |
| 613 | 3300049587 | Ga0501071_0002819 | Ga0501071_0002819_5455_6222 | 244 |
| 614 | 3300049591 | Ga0501075_0002567 | Ga0501075_0002567_4200_4967 | 244 |
| 615 | 3300049592 | Ga0501076_0000957 | Ga0501076_0000957_12771_13538 | 244 |
| 616 | 3300049741 | Ga0501079_0010125 | Ga0501079_0010125_4864_5631 | 244 |
| 617 | 3300049742 | Ga0501080_0060935 | Ga0501080_0060935_862_1629 | 244 |
| 618 | 3300049822 | Ga0501035_0024974 | Ga0501035_0024974_928_1695 | 244 |
| 619 | 3300049823 | Ga0501044_0469996 | Ga0501044_0469996_308_1141 | 244 |
| 620 | 3300060353 | Ga0501082_0125486 | Ga0501082_0125486_1439_2206 | 244 |
| 621 | 3300061734 | Ga0530510_0567861 | Ga0530510_0567861_11_754 | 244 |
| 622 | iso_pu_bacteria | 8057568493 | 8057572157 | 244 |
| 623 | 3300005435 | Ga0070714_100283418 | Ga0070714_1002834182 | 245 |
| 624 | 3300005530 | Ga0070679_100724094 | Ga0070679_1007240941 | 245 |
| 625 | 3300022467 | Ga0224712_10031501 | Ga0224712_100315012 | 245 |
| 626 | 3300025900 | Ga0207710_10062505 | Ga0207710_100625052 | 245 |
| 627 | 3300025929 | Ga0207664_10251096 | Ga0207664_102510962 | 245 |
| 628 | 3300031824 | Ga0307413_10071465 | Ga0307413_100714652 | 245 |
| 629 | 3300031903 | Ga0307407_10018572 | Ga0307407_100185722 | 245 |
| 630 | 3300035119 | Ga0373956_0000526 | Ga0373956_0000526_2969_3814 | 245 |
| 631 | 3300045976 | Ga0466967_0516811 | Ga0466967_0516811_162_1016 | 245 |
| 632 | 3300049572 | Ga0501036_0415271 | Ga0501036_0415271_255_1103 | 245 |
| 633 | 3300050513 | nmdc:mga0rr50_648762_c1 | nmdc:mga0rr50_648762_c1_54_881 | 245 |
| 634 | iso_pu_bacteria | 2622736605 | 2623498814 | 245 |
| 635 | 3300005345 | Ga0070692_10161264 | Ga0070692_101612642 | 246 |
| 636 | 3300005437 | Ga0070710_10117965 | Ga0070710_101179652 | 246 |
| 637 | 3300005536 | Ga0070697_100549754 | Ga0070697_1005497541 | 246 |
| 638 | 3300005563 | Ga0068855_100264061 | Ga0068855_1002640612 | 246 |
| 639 | 3300005841 | Ga0068863_100030070 | Ga0068863_1000300704 | 246 |
| 640 | 3300005842 | Ga0068858_100027567 | Ga0068858_1000275672 | 246 |
| 641 | 3300006028 | Ga0070717_10506124 | Ga0070717_105061241 | 246 |
| 642 | 3300009174 | Ga0105241_10405854 | Ga0105241_104058541 | 246 |
| 643 | 3300009545 | Ga0105237_10324604 | Ga0105237_103246041 | 246 |
| 644 | 3300013105 | Ga0157369_10365266 | Ga0157369_103652662 | 246 |
| 645 | 3300020082 | Ga0206353_10923945 | Ga0206353_109239452 | 246 |
| 646 | 3300025906 | Ga0207699_10020192 | Ga0207699_100201923 | 246 |
| 647 | 3300025916 | Ga0207663_10011212 | Ga0207663_100112124 | 246 |
| 648 | 3300025949 | Ga0207667_10216254 | Ga0207667_102162542 | 246 |
| 649 | 3300026035 | Ga0207703_10332427 | Ga0207703_103324272 | 246 |
| 650 | 3300026078 | Ga0207702_10345493 | Ga0207702_103454932 | 246 |
| 651 | 3300026088 | Ga0207641_10046249 | Ga0207641_100462493 | 246 |
| 652 | 3300026121 | Ga0207683_10090790 | Ga0207683_100907902 | 246 |
| 653 | 3300031852 | Ga0307410_10006399 | Ga0307410_100063994 | 246 |
| 654 | 3300031995 | Ga0307409_100245395 | Ga0307409_1002453951 | 246 |
| 655 | 3300035083 | Ga0373926_0018669 | Ga0373926_0018669_779_1675 | 246 |
| 656 | 3300035692 | Ga0373935_0011145 | Ga0373935_0011145_225_1121 | 246 |
| 657 | 3300035725 | Ga0373947_0000001 | Ga0373947_0000001_20655_21551 | 246 |
| 658 | 3300044901 | Ga0466960_0006004 | Ga0466960_0006004_3331_4101 | 246 |
| 659 | 3300045836 | Ga0466958_0060857 | Ga0466958_0060857_724_1494 | 246 |
| 660 | 3300045976 | Ga0466967_0126443 | Ga0466967_0126443_58_828 | 246 |
| 661 | 3300048907 | Ga0496104_0006942 | Ga0496104_0006942_5069_6001 | 246 |
| 662 | 3300048911 | Ga0496108_0008373 | Ga0496108_0008373_938_1870 | 246 |
| 663 | 3300048912 | Ga0496109_0230463 | Ga0496109_0230463_100_981 | 246 |
| 664 | 3300048914 | Ga0496111_0124228 | Ga0496111_0124228_263_1195 | 246 |
| 665 | 3300048917 | Ga0496114_0300059 | Ga0496114_0300059_470_1249 | 246 |
| 666 | 3300049581 | Ga0501047_0128325 | Ga0501047_0128325_92_955 | 246 |
| 667 | 3300049587 | Ga0501071_0550768 | Ga0501071_0550768_17_820 | 246 |
| 668 | 3300049593 | Ga0501077_0090877 | Ga0501077_0090877_44_907 | 246 |
| 669 | iso_pu_bacteria | 2808606365 | 2808874244 | 246 |
| 670 | 3300025928 | Ga0207700_10523641 | Ga0207700_105236412 | 247 |
| 671 | 3300031665 | Ga0316575_10005740 | Ga0316575_100057402 | 247 |
| 672 | 3300031665 | Ga0316575_10062298 | Ga0316575_100622982 | 247 |
| 673 | 3300031691 | Ga0316579_10025305 | Ga0316579_100253053 | 247 |
| 674 | 3300031691 | Ga0316579_10036343 | Ga0316579_100363432 | 247 |
| 675 | 3300031727 | Ga0316576_10156747 | Ga0316576_101567472 | 247 |
| 676 | 3300031728 | Ga0316578_10003554 | Ga0316578_100035547 | 247 |
| 677 | 3300032133 | Ga0316583_10018043 | Ga0316583_100180432 | 247 |
| 678 | 3300032139 | Ga0316580_10010623 | Ga0316580_100106232 | 247 |
| 679 | 3300032139 | Ga0316580_10038578 | Ga0316580_100385782 | 247 |
| 680 | 3300035117 | Ga0373953_0051884 | Ga0373953_0051884_425_1360 | 247 |
| 681 | 3300035398 | Ga0316574_0002178 | Ga0316574_0002178_1521_2387 | 247 |
| 682 | 3300035398 | Ga0316574_0004825 | Ga0316574_0004825_3296_4162 | 247 |
| 683 | 3300036647 | Ga0316582_0000920 | Ga0316582_0000920_5161_6027 | 247 |
| 684 | 3300036647 | Ga0316582_0003300 | Ga0316582_0003300_4336_5202 | 247 |
| 685 | 3300036712 | Ga0316584_0004008 | Ga0316584_0004008_5155_6021 | 247 |
| 686 | 3300038443 | Ga0395901_0055761 | Ga0395901_0055761_414_1265 | 247 |
| 687 | 3300044842 | Ga0466957_0424456 | Ga0466957_0424456_107_850 | 247 |
| 688 | 3300044901 | Ga0466960_0078548 | Ga0466960_0078548_700_1494 | 247 |
| 689 | 3300046473 | Ga0495582_0051181 | Ga0495582_0051181_356_1153 | 247 |
| 690 | 3300048903 | Ga0496100_0010356 | Ga0496100_0010356_2520_3347 | 247 |
| 691 | 3300048904 | Ga0496101_0010359 | Ga0496101_0010359_2189_3016 | 247 |
| 692 | 3300048905 | Ga0496102_0005931 | Ga0496102_0005931_8969_9796 | 247 |
| 693 | 3300048905 | Ga0496102_0169839 | Ga0496102_0169839_652_1446 | 247 |
| 694 | 3300048906 | Ga0496103_0003620 | Ga0496103_0003620_3628_4455 | 247 |
| 695 | 3300048907 | Ga0496104_0023189 | Ga0496104_0023189_1068_1895 | 247 |
| 696 | 3300048908 | Ga0496105_0030630 | Ga0496105_0030630_1930_2757 | 247 |
| 697 | 3300048909 | Ga0496106_0258829 | Ga0496106_0258829_553_1368 | 247 |
| 698 | 3300048910 | Ga0496107_0271197 | Ga0496107_0271197_311_1138 | 247 |
| 699 | 3300048912 | Ga0496109_0024968 | Ga0496109_0024968_3946_4755 | 247 |
| 700 | 3300048913 | Ga0496110_0119418 | Ga0496110_0119418_1543_2352 | 247 |
| 701 | 3300048917 | Ga0496114_0019240 | Ga0496114_0019240_2804_3631 | 247 |
| 702 | 3300048918 | Ga0496115_0179456 | Ga0496115_0179456_884_1678 | 247 |
| 703 | iso_pu_bacteria | 2643221711 | 2644609769 | 247 |
| 704 | iso_pu_bacteria | 2818991462 | 2819691680 | 247 |
| 705 | iso_pu_bacteria | 2818991469 | 2819729540 | 247 |
| 706 | iso_pu_bacteria | 2919446982 | 2919450356 | 247 |
| 707 | iso_pu_bacteria | 8053945823 | 8053953271 | 247 |
| 708 | 3300000549 | LJQas_1005059 | LJQas_10050592 | 248 |
| 709 | 3300005366 | Ga0070659_100704001 | Ga0070659_1007040011 | 248 |
| 710 | 3300005535 | Ga0070684_100264206 | Ga0070684_1002642062 | 248 |
| 711 | 3300005615 | Ga0070702_100511370 | Ga0070702_1005113701 | 248 |
| 712 | 3300005985 | Ga0081539_10044133 | Ga0081539_100441332 | 248 |
| 713 | 3300013105 | Ga0157369_10624857 | Ga0157369_106248572 | 248 |
| 714 | 3300020082 | Ga0206353_11320916 | Ga0206353_113209162 | 248 |
| 715 | 3300025944 | Ga0207661_10111374 | Ga0207661_101113741 | 248 |
| 716 | 3300031548 | Ga0307408_100640688 | Ga0307408_1006406882 | 248 |
| 717 | 3300031731 | Ga0307405_10288906 | Ga0307405_102889061 | 248 |
| 718 | 3300031731 | Ga0307405_10320123 | Ga0307405_103201232 | 248 |
| 719 | 3300031824 | Ga0307413_10032019 | Ga0307413_100320193 | 248 |
| 720 | 3300031903 | Ga0307407_10129827 | Ga0307407_101298272 | 248 |
| 721 | 3300031911 | Ga0307412_10083650 | Ga0307412_100836502 | 248 |
| 722 | 3300031995 | Ga0307409_100017289 | Ga0307409_1000172896 | 248 |
| 723 | 3300031995 | Ga0307409_100050997 | Ga0307409_1000509973 | 248 |
| 724 | 3300031995 | Ga0307409_100054320 | Ga0307409_1000543204 | 248 |
| 725 | 3300031995 | Ga0307409_100289150 | Ga0307409_1002891502 | 248 |
| 726 | 3300031995 | Ga0307409_100342953 | Ga0307409_1003429532 | 248 |
| 727 | 3300032002 | Ga0307416_100179539 | Ga0307416_1001795392 | 248 |
| 728 | 3300032002 | Ga0307416_100280868 | Ga0307416_1002808682 | 248 |
| 729 | 3300032004 | Ga0307414_10382740 | Ga0307414_103827402 | 248 |
| 730 | 3300032004 | Ga0307414_10838568 | Ga0307414_108385681 | 248 |
| 731 | 3300032005 | Ga0307411_10272949 | Ga0307411_102729492 | 248 |
| 732 | 3300032126 | Ga0307415_100034933 | Ga0307415_1000349332 | 248 |
| 733 | 3300032126 | Ga0307415_100155672 | Ga0307415_1001556722 | 248 |
| 734 | 3300032126 | Ga0307415_100155731 | Ga0307415_1001557312 | 248 |
| 735 | 3300038443 | Ga0395901_0011041 | Ga0395901_0011041_3639_4385 | 248 |
| 736 | 3300044658 | Ga0466972_0148186 | Ga0466972_0148186_154_960 | 248 |
| 737 | 3300044694 | Ga0466963_0058036 | Ga0466963_0058036_535_1314 | 248 |
| 738 | 3300044694 | Ga0466963_0077566 | Ga0466963_0077566_787_1533 | 248 |
| 739 | 3300044719 | Ga0466971_0116137 | Ga0466971_0116137_15_761 | 248 |
| 740 | 3300044765 | Ga0466970_0064875 | Ga0466970_0064875_826_1572 | 248 |
| 741 | 3300044842 | Ga0466957_0093478 | Ga0466957_0093478_145_891 | 248 |
| 742 | 3300044842 | Ga0466957_0171524 | Ga0466957_0171524_402_1208 | 248 |
| 743 | 3300044901 | Ga0466960_0097842 | Ga0466960_0097842_591_1364 | 248 |
| 744 | 3300045049 | Ga0466959_0076439 | Ga0466959_0076439_324_1070 | 248 |
| 745 | 3300045836 | Ga0466958_0103389 | Ga0466958_0103389_759_1505 | 248 |
| 746 | 3300045836 | Ga0466958_0197067 | Ga0466958_0197067_141_920 | 248 |
| 747 | 3300045836 | Ga0466958_0324865 | Ga0466958_0324865_169_975 | 248 |
| 748 | 3300045976 | Ga0466967_0012950 | Ga0466967_0012950_1974_2723 | 248 |
| 749 | 3300049580 | Ga0501046_0315915 | Ga0501046_0315915_98_856 | 248 |
| 750 | 3300049591 | Ga0501075_0482994 | Ga0501075_0482994_32_790 | 248 |
| 751 | 3300061719 | Ga0466962_0068918 | Ga0466962_0068918_387_1133 | 248 |
| 752 | 3300061719 | Ga0466962_0091563 | Ga0466962_0091563_650_1396 | 248 |
| 753 | iso_pu_bacteria | 2643221679 | 2644444997 | 248 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r3u-assembly1.cif.gz_C | crystal structure of 2-hydroxyisobutyryl-coa mutase | 0.83 | 105 | 241 |
| 2i2x-assembly1.cif.gz_B | crystal structure of methanol:cobalamin methyltransferase complex mtabc from methanosarcina barkeri | 0.8182 | 107 | 244 |
| 1y80-assembly1.cif.gz_A | structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica | 0.8084 | 104 | 237 |
| 2yxb-assembly1.cif.gz_A | crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix | 0.8071 | 104 | 239 |
| 1ccw-assembly1.cif.gz_C | structure of the coenzyme b12 dependent enzyme glutamate mutase from clostridium cochlearium | 0.8005 | 104 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xrsB01 | Alpha Beta;2-Layer Sandwich;Defensin A-like;D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain | 0.978 | 19 | 69 | 3.30.30.60 |
| 1xrsB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9561 | 87 | 241 | 3.40.50.280 |
| 1xrsB01 | Alpha Beta;2-Layer Sandwich;Defensin A-like;D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain | 0.9419 | 19 | 69 | 3.30.30.60 |
| 1xrsB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.9216 | 87 | 241 | 3.40.50.280 |
| 3kowB04 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain | 0.908 | 89 | 240 | 3.40.50.280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A645GME8-F1-model_v4 | Lysine 5,6-aminomutase beta subunit (EC 5.4.3.3) | 0.9581 | 89 | 242 |
GO:0031419
GO:0046872 GO:0047826 |
| AF-A0A353LXU6-F1-model_v4 | B12-binding domain-containing protein | 0.9568 | 105 | 241 |
GO:0031419
GO:0046872 |
| AF-A0A3D1QZG5-F1-model_v4 | B12-binding domain-containing protein | 0.9507 | 125 | 240 |
GO:0031419
GO:0046872 |
| AF-A0A838KJI0-F1-model_v4 | Cobalamin B12-binding domain-containing protein | 0.9436 | 93 | 248 |
GO:0031419
GO:0046872 |
| AF-A0A3C0FCE1-F1-model_v4 | B12-binding domain-containing protein | 0.9389 | 146 | 241 |
GO:0031419
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar