F479082

General Info

Members Datasets Scaffolds Average Seq Length
751 381 706 231

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10035174|rootH1_100351742
Length 259
Sequence LRKFNSEIELPKSEIIIINLYKISFKTVARLTKNQKVALSKIEANKAYSLQDASALVKDITNTKFDSSVDIDVRLGVDPRKANQMVRGIATLPHGTGKTVRVLVLCTPDKEQEAKDAGADYVGLDDYIAKIEGGWTDVDIIITMPSVMAKVGRLGRVLGPRNLMPNPKSGTVTTEVGKAVTEVKGGKIDFKVDKTGIIHTSIXXXSFSADKIYENALEVLQTISKLKPSAAKGTYFKSIHISSTMSPGIEIETKTVAGI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
5 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
6 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
7 2738541283 Pedobacter sp. OK701 Isolate Unclassified
8 2738541284 Pedobacter sp. YR016 Isolate Unclassified
9 2738541302 Pedobacter sp. CF074 Isolate Unclassified
10 2738543023 Pedobacter sp. OK628 Isolate Unclassified
11 2739367651 Pedobacter sp. OK291 Isolate Unclassified
12 2739367656 Pedobacter sp. CF523 Isolate Unclassified
13 2739367663 Pedobacter sp. YR510 Isolate Unclassified
14 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
15 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
16 2818991437 Pedobacter terrae 518 Isolate Unclassified
17 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
18 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
19 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
20 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
21 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
22 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
23 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
24 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
25 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
26 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
27 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
28 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
29 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
30 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
31 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
32 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
33 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
34 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
35 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
36 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
37 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
38 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
39 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
40 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
41 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
42 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
43 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
44 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
45 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
46 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
47 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
48 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
49 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
50 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
51 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
52 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
53 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
54 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
55 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
56 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
57 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
58 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
59 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
60 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
61 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
62 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
63 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
64 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
66 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
67 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
70 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
72 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
74 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
75 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
78 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
81 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
88 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
89 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
90 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
91 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
136 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
147 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
195 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
201 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
202 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
203 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
204 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
205 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
206 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
207 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
213 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
240 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
241 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
242 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
243 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
244 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
245 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
246 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
249 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
250 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
251 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
252 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
256 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
288 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
289 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
290 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
291 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
292 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
293 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
311 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
333 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
334 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
335 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
336 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
339 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
340 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
344 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
347 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
350 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
351 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
352 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
353 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
354 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 62.05
Metatranscriptomes 31.96
Isolates 5.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.92
Nodule 0
Rhizoplane 0.67
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 7.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_9405 2124908027 Bacteria 1869
2 MBSR1b_contig_6515855 2162886012 Bacteria 1091
3 JGI24740J21852_10015326 3300001979 Bacteria 2803
4 JGI24739J22299_10047850 3300001989 Bacteria 1393
5 JGI24737J22298_10000614 3300001990 Bacteria 12575
6 JGI24737J22298_10001905 3300001990 Bacteria 7459
7 JGI24737J22298_10003582 3300001990 Bacteria 5476
8 JGI24737J22298_10005403 3300001990 Bacteria 4415
9 JGI24743J22301_10020627 3300001991 Bacteria 1255
10 JGI24735J21928_10000009 3300002067 Bacteria 247425
11 JGI24735J21928_10021163 3300002067 Bacteria 1988
12 JGI25162J39368_1000120 3300002737 Bacteria 86031
13 JGI25162J39368_1001524 3300002737 Bacteria 11972
14 JGI25157J39369_1002820 3300002741 Bacteria 3946
15 JGI25157J39369_1004397 3300002741 Bacteria 2564
16 JGI25164J39214_1000824 3300002772 Bacteria 10827
17 JGI25152J39213_1000022 3300002773 Bacteria 105664
18 JGI25150J39212_1000001 3300002774 Bacteria 1318726
19 JGI25151J46595_10000001 3300003187 Bacteria 887211
20 JGI25165J46597_1000923 3300003214 Bacteria 20349
21 JGI25153J46596_10000001 3300003215 Bacteria 748985
22 rootH1_10025186 3300003316 Bacteria 2889
23 rootH2_10094915 3300003320 Bacteria 1772
24 rootH2_10133361 3300003320 Bacteria 1255
25 rootL2_10024334 3300003322 Bacteria 1301
26 rootL2_10051773 3300003322 Bacteria 3799
27 rootH1_10003520 3300003323 Bacteria 6470
28 rootH1_10035174 3300003323 Bacteria 1091
29 rootH1_10067560 3300003323 Bacteria 2906
30 rootH1_10081742 3300003323 Bacteria 1789
31 rootH1_10107846 3300003323 Bacteria 1569
32 rootH1_10144272 3300003323 Bacteria 1828
33 Ga0032354_1069350 3300003693 Bacteria 1297
34 Ga0055536_1000001 3300003781 Bacteria 630663
35 Ga0055536_1013448 3300003781 Bacteria 2951
36 Ga0055530_10008207 3300003791 Bacteria 4224
37 Ga0058863_10005116 3300004799 Bacteria 14404
38 Ga0058861_10088285 3300004800 Bacteria 3413
39 Ga0058860_12228446 3300004801 Bacteria 2527
40 Ga0058862_10247728 3300004803 Bacteria 8738
41 Ga0065165_1002853 3300005262 Bacteria 13414
42 Ga0065165_1007781 3300005262 Bacteria 5172
43 Ga0065714_10005413 3300005288 Bacteria 4818
44 Ga0065714_10007805 3300005288 Bacteria 3491
45 Ga0065714_10009921 3300005288 Bacteria 2213
46 Ga0065714_10083664 3300005288 Bacteria 2221
47 Ga0065714_10087528 3300005288 Bacteria 2043
48 Ga0065714_10118201 3300005288 Bacteria 1382
49 Ga0065704_10000757 3300005289 Bacteria 16510
50 Ga0065712_10251685 3300005290 Bacteria 958
51 Ga0065715_10001084 3300005293 Bacteria 8622
52 Ga0070658_10000014 3300005327 Bacteria 244978
53 Ga0070658_10129449 3300005327 Bacteria 2103
54 Ga0070676_10004106 3300005328 Bacteria 7650
55 Ga0070683_100016707 3300005329 Bacteria 6475
56 Ga0068869_100171345 3300005334 Bacteria 1696
57 Ga0070682_100461467 3300005337 Unclassified 975
58 Ga0068868_100235346 3300005338 Bacteria 1537
59 Ga0070671_100005487 3300005355 Bacteria 10117
60 Ga0070674_100626513 3300005356 Bacteria 912
61 Ga0070673_100015276 3300005364 Bacteria 5387
62 Ga0070659_100000402 3300005366 Bacteria 32771
63 Ga0070659_100016784 3300005366 Bacteria 5501
64 Ga0070659_100061430 3300005366 Bacteria 2969
65 Ga0070714_100173670 3300005435 Bacteria 1957
66 Ga0070678_100001822 3300005456 Bacteria 11482
67 Ga0070662_100059100 3300005457 Bacteria 2792
68 Ga0070681_10008372 3300005458 Bacteria 10130
69 Ga0068867_100001197 3300005459 Bacteria 17799
70 Ga0070679_100014038 3300005530 Bacteria 7681
71 Ga0070679_100252125 3300005530 Bacteria 1721
72 Ga0070665_100000032 3300005548 Bacteria 333352
73 Ga0068855_100000026 3300005563 Bacteria 175140
74 Ga0068855_100042965 3300005563 Bacteria 5355
75 Ga0068855_100079811 3300005563 Bacteria 3794
76 Ga0068855_100088358 3300005563 Bacteria 3580
77 Ga0068857_100505495 3300005577 Bacteria 1135
78 Ga0068854_100049164 3300005578 Bacteria 3011
79 Ga0068854_100185625 3300005578 Bacteria 1627
80 Ga0068856_100000014 3300005614 Bacteria 163480
81 Ga0068856_100003360 3300005614 Bacteria 16215
82 Ga0068856_100039856 3300005614 Bacteria 4612
83 Ga0068856_100083237 3300005614 Bacteria 3177
84 Ga0068856_100223306 3300005614 Bacteria 1899
85 Ga0068856_100360582 3300005614 Bacteria 1472
86 Ga0068856_101055924 3300005614 Bacteria 830
87 Ga0068852_100001456 3300005616 Bacteria 15984
88 Ga0068852_100501427 3300005616 Bacteria 1209
89 Ga0068866_10152491 3300005718 Bacteria 1340
90 Ga0068863_100205953 3300005841 Bacteria 1893
91 Ga0075366_10068860 3300006195 Bacteria 2106
92 Ga0075366_10105465 3300006195 Bacteria 1694
93 Ga0075366_10186058 3300006195 Bacteria 1262
94 Ga0097621_100000057 3300006237 Bacteria 58430
95 Ga0097621_100431254 3300006237 Bacteria 1185
96 Ga0075370_10099499 3300006353 Bacteria 1682
97 Ga0068871_100000094 3300006358 Bacteria 52461
98 Ga0068865_100000200 3300006881 Bacteria 33423
99 Ga0105244_10020501 3300009036 Bacteria 3671
100 Ga0105240_10067718 3300009093 Bacteria 4425
101 Ga0105240_10111763 3300009093 Bacteria 3304
102 Ga0105240_10129348 3300009093 Bacteria 3030
103 Ga0105240_10332980 3300009093 Bacteria 1727
104 Ga0105240_10429871 3300009093 Bacteria 1482
105 Ga0105240_10616692 3300009093 Bacteria 1193
106 Ga0111539_10159065 3300009094 Bacteria 2642
107 Ga0105243_10000018 3300009148 Bacteria 227618
108 Ga0105243_10380221 3300009148 Bacteria 1306
109 Ga0105241_10019243 3300009174 Bacteria 5034
110 Ga0105242_10040711 3300009176 Bacteria 3745
111 Ga0105242_10505299 3300009176 Bacteria 1150
112 Ga0105242_10595052 3300009176 Bacteria 1067
113 Ga0105237_10001287 3300009545 Bacteria 33378
114 Ga0105237_10001321 3300009545 Bacteria 32889
115 Ga0105237_10012788 3300009545 Bacteria 8828
116 Ga0105237_10060769 3300009545 Bacteria 3779
117 Ga0105238_10003742 3300009551 Bacteria 15125
118 Ga0105238_10097306 3300009551 Bacteria 2929
119 Ga0105238_10781559 3300009551 Bacteria 970
120 Ga0105239_10000001 3300010375 Bacteria 617353
121 Ga0105239_10001363 3300010375 Bacteria 32814
122 Ga0105239_10005053 3300010375 Bacteria 15586
123 Ga0105239_10364930 3300010375 Bacteria 1631
124 Ga0157373_10000448 3300013100 Bacteria 32580
125 Ga0157373_10016881 3300013100 Bacteria 5323
126 Ga0157373_10225466 3300013100 Bacteria 1323
127 Ga0157371_10002095 3300013102 Bacteria 19477
128 Ga0157371_10019347 3300013102 Bacteria 5023
129 Ga0157371_10132755 3300013102 Bacteria 1772
130 Ga0157371_10178349 3300013102 Bacteria 1519
131 Ga0157371_10262802 3300013102 Bacteria 1244
132 Ga0157370_10044584 3300013104 Bacteria 4261
133 Ga0157370_10209085 3300013104 Bacteria 1809
134 Ga0157370_10281686 3300013104 Bacteria 1536
135 Ga0157370_10563883 3300013104 Bacteria 1044
136 Ga0157369_10000478 3300013105 Bacteria 53035
137 Ga0157369_10001799 3300013105 Bacteria 25953
138 Ga0157369_10058386 3300013105 Bacteria 4162
139 Ga0157369_10064414 3300013105 Bacteria 3948
140 Ga0157369_10241115 3300013105 Bacteria 1888
141 Ga0157369_10358700 3300013105 Bacteria 1514
142 Ga0157374_10772124 3300013296 Bacteria 976
143 Ga0157378_10022748 3300013297 Bacteria 5516
144 Ga0157378_10041902 3300013297 Bacteria 4062
145 Ga0163162_10000052 3300013306 Bacteria 112651
146 Ga0163162_10038959 3300013306 Bacteria 4746
147 Ga0157372_10000020 3300013307 Bacteria 208056
148 Ga0157372_10000254 3300013307 Bacteria 59194
149 Ga0157372_10001280 3300013307 Bacteria 27216
150 Ga0157372_10042429 3300013307 Bacteria 5032
151 Ga0157372_10087139 3300013307 Bacteria 3542
152 Ga0157372_10122899 3300013307 Bacteria 2983
153 Ga0157372_10504382 3300013307 Bacteria 1411
154 Ga0157375_10044048 3300013308 Bacteria 4331
155 Ga0157375_10076034 3300013308 Bacteria 3383
156 Ga0157375_10106910 3300013308 Bacteria 2891
157 Ga0157375_10244028 3300013308 Bacteria 1956
158 Ga0163163_10060719 3300014325 Bacteria 3744
159 Ga0157380_10000015 3300014326 Bacteria 129842
160 Ga0182008_10006054 3300014497 Bacteria 6805
161 Ga0182008_10021142 3300014497 Bacteria 3345
162 Ga0157379_10268826 3300014968 Bacteria 1550
163 Ga0157376_10279806 3300014969 Bacteria 1571
164 Ga0182006_1002415 3300015261 Bacteria 10209
165 Ga0182006_1070067 3300015261 Bacteria 1302
166 Ga0182007_10000003 3300015262 Bacteria 548244
167 Ga0182007_10049861 3300015262 Bacteria 1382
168 Ga0183373_1001 3300015682 Bacteria 1410374
169 Ga0163161_10000641 3300017792 Bacteria 27918
170 Ga0163161_10040013 3300017792 Bacteria 3366
171 Ga0163161_10041013 3300017792 Bacteria 3325
172 Ga0163161_10701163 3300017792 Bacteria 843
173 Ga0197907_10160647 3300020069 Bacteria 3064
174 Ga0197907_10706642 3300020069 Bacteria 2159
175 Ga0197907_10819694 3300020069 Bacteria 4207
176 Ga0197907_10908526 3300020069 Bacteria 1876
177 Ga0206356_10124111 3300020070 Bacteria 3100
178 Ga0206356_11795532 3300020070 Bacteria 2420
179 Ga0206356_11849337 3300020070 Bacteria 1449
180 Ga0206349_1110078 3300020075 Bacteria 1260
181 Ga0206349_1596541 3300020075 Bacteria 1951
182 Ga0206355_1018008 3300020076 Bacteria 1812
183 Ga0206351_10078727 3300020077 Bacteria 4984
184 Ga0206351_10106046 3300020077 Bacteria 13123
185 Ga0206351_10462283 3300020077 Bacteria 11313
186 Ga0206351_10586730 3300020077 Bacteria 2505
187 Ga0206352_10727185 3300020078 Bacteria 3045
188 Ga0206352_11107574 3300020078 Bacteria 1831
189 Ga0206350_10111961 3300020080 Bacteria 11279
190 Ga0206350_10297200 3300020080 Bacteria 8943
191 Ga0206350_10622310 3300020080 Bacteria 4443
192 Ga0206354_10771971 3300020081 Bacteria 2472
193 Ga0206354_10858690 3300020081 Bacteria 1022
194 Ga0206354_11003734 3300020081 Bacteria 965
195 Ga0206354_11089144 3300020081 Bacteria 2333
196 Ga0206354_11204833 3300020081 Bacteria 1496
197 Ga0206353_10132441 3300020082 Bacteria 1131
198 Ga0206353_10698887 3300020082 Bacteria 3028
199 Ga0206353_10800764 3300020082 Bacteria 2247
200 Ga0206353_11125333 3300020082 Bacteria 3606
201 Ga0206353_11187972 3300020082 Bacteria 1052
202 Ga0154015_1073617 3300020610 Bacteria 4307
203 Ga0154015_1153066 3300020610 Bacteria 6861
204 Ga0154015_1236635 3300020610 Bacteria 10577
205 Ga0213872_10048147 3300021361 Bacteria 1937
206 Ga0224712_10000859 3300022467 Bacteria 6497
207 Ga0224712_10005983 3300022467 Bacteria 3435
208 Ga0224712_10006283 3300022467 Bacteria 3375
209 Ga0224712_10014258 3300022467 Bacteria 2553
210 Ga0207427_100236 3300025231 Bacteria 45297
211 Ga0209437_100034 3300025233 Bacteria 494007
212 Ga0209437_100143 3300025233 Bacteria 164970
213 Ga0207425_1000002 3300025245 Bacteria 1362590
214 Ga0209026_1000463 3300025250 Bacteria 31275
215 Ga0209026_1002304 3300025250 Bacteria 7279
216 Ga0209129_1000002 3300025258 Bacteria 1359086
217 Ga0209129_1013234 3300025258 Bacteria 1829
218 Ga0209233_1000038 3300025261 Bacteria 548972
219 Ga0209455_1001279 3300025272 Bacteria 11764
220 Ga0209455_1007272 3300025272 Bacteria 3148
221 Ga0209676_1000008 3300025292 Bacteria 991778
222 Ga0209676_1000294 3300025292 Bacteria 101100
223 Ga0209025_1000004 3300025294 Bacteria 1361782
224 Ga0209758_1000006 3300025297 Bacteria 1359562
225 Ga0209050_1000045 3300025298 Bacteria 388022
226 Ga0207426_1055039 3300025302 Bacteria 1167
227 Ga0207656_10057491 3300025321 Bacteria 1697
228 Ga0207647_10003884 3300025904 Bacteria 11172
229 Ga0207647_10007050 3300025904 Bacteria 8148
230 Ga0207645_10002281 3300025907 Bacteria 15210
231 Ga0207705_10000043 3300025909 Bacteria 181491
232 Ga0207654_10005184 3300025911 Bacteria 6575
233 Ga0207695_10000053 3300025913 Bacteria 396740
234 Ga0207695_10029659 3300025913 Bacteria 6038
235 Ga0207695_10034034 3300025913 Bacteria 5548
236 Ga0207695_10044139 3300025913 Bacteria 4744
237 Ga0207695_10196503 3300025913 Bacteria 1933
238 Ga0207671_10002869 3300025914 Bacteria 17871
239 Ga0207671_10003103 3300025914 Bacteria 16910
240 Ga0207671_10007516 3300025914 Bacteria 9448
241 Ga0207671_10012211 3300025914 Bacteria 6926
242 Ga0207671_10032530 3300025914 Bacteria 3882
243 Ga0207671_10037359 3300025914 Bacteria 3602
244 Ga0207671_10069032 3300025914 Bacteria 2635
245 Ga0207657_10091410 3300025919 Bacteria 2538
246 Ga0207652_10027983 3300025921 Bacteria 4701
247 Ga0207694_10022814 3300025924 Bacteria 4747
248 Ga0207690_10000365 3300025932 Bacteria 30004
249 Ga0207690_10037427 3300025932 Bacteria 3150
250 Ga0207706_10000057 3300025933 Bacteria 112805
251 Ga0207706_10169742 3300025933 Bacteria 1917
252 Ga0207686_10007982 3300025934 Bacteria 5706
253 Ga0207709_10000021 3300025935 Bacteria 386722
254 Ga0207669_10136118 3300025937 Bacteria 1697
255 Ga0207704_10000052 3300025938 Bacteria 80866
256 Ga0207665_10301290 3300025939 Bacteria 1198
257 Ga0207665_10334263 3300025939 Bacteria 1140
258 Ga0207689_10080823 3300025942 Bacteria 2672
259 Ga0207661_10010757 3300025944 Bacteria 6597
260 Ga0207667_10000022 3300025949 Bacteria 369570
261 Ga0207667_10001325 3300025949 Bacteria 31070
262 Ga0207667_10012833 3300025949 Bacteria 9627
263 Ga0207667_10073046 3300025949 Bacteria 3565
264 Ga0207667_10236032 3300025949 Bacteria 1872
265 Ga0207651_10027165 3300025960 Bacteria 3590
266 Ga0207640_10033694 3300025981 Bacteria 3189
267 Ga0207658_10500098 3300025986 Bacteria 1083
268 Ga0207677_10091392 3300026023 Bacteria 2214
269 Ga0207703_10031399 3300026035 Bacteria 4200
270 Ga0207639_10140200 3300026041 Bacteria 2013
271 Ga0207678_10032515 3300026067 Bacteria 4546
272 Ga0207708_10377458 3300026075 Bacteria 1168
273 Ga0207702_10000036 3300026078 Bacteria 154106
274 Ga0207702_10034672 3300026078 Bacteria 4220
275 Ga0207702_10063299 3300026078 Bacteria 3162
276 Ga0207702_10098980 3300026078 Bacteria 2570
277 Ga0207702_10314486 3300026078 Bacteria 1490
278 Ga0207702_10425580 3300026078 Bacteria 1285
279 Ga0207641_10535181 3300026088 Bacteria 1141
280 Ga0207648_10002788 3300026089 Bacteria 18537
281 Ga0207676_10409747 3300026095 Bacteria 1269
282 Ga0207683_10010796 3300026121 Bacteria 7788
283 Ga0207698_10005473 3300026142 Bacteria 7852
284 Ga0207698_10732621 3300026142 Bacteria 986
285 Ga0207428_10571149 3300027907 Bacteria 817
286 Ga0268266_10000030 3300028379 Bacteria 417120
287 Ga0268264_10467476 3300028381 Bacteria 1225
288 Ga0265334_10036858 3300028573 Bacteria 1930
289 Ga0265323_10000038 3300028653 Bacteria 70544
290 Ga0265323_10015327 3300028653 Unclassified 3018
291 Ga0265322_10007311 3300028654 Bacteria 3231
292 Ga0265322_10091967 3300028654 Bacteria 862
293 Ga0307517_10006168 3300028786 Bacteria 17856
294 Ga0307515_10049612 3300028794 Bacteria 6307
295 Ga0307515_10244807 3300028794 Bacteria 1556
296 Ga0265338_10049114 3300028800 Bacteria 3829
297 Ga0265338_10071330 3300028800 Bacteria 2973
298 Ga0265324_10031804 3300029957 Bacteria 1847
299 Ga0316177_1003967 3300030731 Bacteria 16835
300 Ga0316176_1151771 3300030732 Bacteria 9599
301 Ga0314311_1080887 3300030733 Bacteria 2510
302 Ga0316183_1095896 3300030742 Bacteria 133299
303 Ga0316181_1088295 3300030744 Bacteria 6327
304 Ga0316181_1201818 3300030744 Bacteria 1920
305 Ga0316181_1282363 3300030744 Bacteria 2852
306 Ga0316182_1171482 3300030745 Bacteria 4017
307 Ga0265330_10172809 3300031235 Bacteria 916
308 Ga0265327_10017918 3300031251 Bacteria 4417
309 Ga0265327_10101179 3300031251 Bacteria 1390
310 Ga0265316_10000481 3300031344 Bacteria 45334
311 Ga0265316_10002116 3300031344 Bacteria 20863
312 Ga0265316_10151822 3300031344 Bacteria 1735
313 Ga0307509_10007266 3300031507 Bacteria 14552
314 Ga0307509_10101371 3300031507 Bacteria 2914
315 Ga0307509_10101439 3300031507 Bacteria 2913
316 Ga0307408_100000321 3300031548 Bacteria 45938
317 Ga0307408_100037589 3300031548 Bacteria 3411
318 Ga0307408_100070397 3300031548 Bacteria 2582
319 Ga0307408_100605987 3300031548 Bacteria 974
320 Ga0265342_10065670 3300031712 Bacteria 2126
321 Ga0316576_10017290 3300031727 Bacteria 4895
322 Ga0316576_10050475 3300031727 Bacteria 3026
323 Ga0316576_10096258 3300031727 Bacteria 2209
324 Ga0316576_10176452 3300031727 Bacteria 1612
325 Ga0316578_10084147 3300031728 Bacteria 1895
326 Ga0307405_10000003 3300031731 Bacteria 569064
327 Ga0307405_10001399 3300031731 Bacteria 10145
328 Ga0307405_10036088 3300031731 Bacteria 2959
329 Ga0307405_10308938 3300031731 Bacteria 1203
330 Ga0316577_10003141 3300031733 Bacteria 8302
331 Ga0307413_10173165 3300031824 Bacteria 1530
332 Ga0307406_10395533 3300031901 Bacteria 1094
333 Ga0307407_10000030 3300031903 Bacteria 97416
334 Ga0307412_10000065 3300031911 Bacteria 122279
335 Ga0307412_10000925 3300031911 Bacteria 16779
336 Ga0307412_10336902 3300031911 Bacteria 1206
337 Ga0307412_10466574 3300031911 Bacteria 1044
338 Ga0307412_10539410 3300031911 Bacteria 978
339 Ga0307409_100266165 3300031995 Bacteria 1576
340 Ga0307416_100000014 3300032002 Bacteria 249053
341 Ga0307416_100000800 3300032002 Bacteria 16562
342 Ga0307416_100504653 3300032002 Bacteria 1275
343 Ga0307414_10000069 3300032004 Bacteria 98243
344 Ga0307414_10007780 3300032004 Bacteria 6041
345 Ga0307414_10010548 3300032004 Bacteria 5369
346 Ga0307414_10167193 3300032004 Bacteria 1754
347 Ga0307414_10348866 3300032004 Bacteria 1269
348 Ga0307414_10481940 3300032004 Bacteria 1094
349 Ga0307414_10507110 3300032004 Bacteria 1068
350 Ga0307414_10514247 3300032004 Bacteria 1061
351 Ga0307414_10691375 3300032004 Bacteria 923
352 Ga0307414_10849893 3300032004 Bacteria 834
353 Ga0307411_10271759 3300032005 Bacteria 1344
354 Ga0316593_10000093 3300032168 Bacteria 11368
355 Ga0316593_10000991 3300032168 Bacteria 5875
356 Ga0316593_10005401 3300032168 Bacteria 3366
357 Ga0316593_10009431 3300032168 Bacteria 2755
358 Ga0316593_10017950 3300032168 Bacteria 2166
359 Ga0316593_10019182 3300032168 Bacteria 2111
360 Ga0316593_10020305 3300032168 Bacteria 2064
361 Ga0316593_10023475 3300032168 Bacteria 1946
362 Ga0316593_10045675 3300032168 Bacteria 1468
363 Ga0316593_10053466 3300032168 Bacteria 1368
364 Ga0316593_10061455 3300032168 Bacteria 1285
365 Ga0307507_10000032 3300033179 Bacteria 194155
366 Ga0316592_1003224 3300033524 Bacteria 2915
367 Ga0316592_1003832 3300033524 Bacteria 2756
368 Ga0316592_1008924 3300033524 Bacteria 1996
369 Ga0316592_1018891 3300033524 Bacteria 1455
370 Ga0316592_1019564 3300033524 Bacteria 1432
371 Ga0316592_1068743 3300033524 Bacteria 800
372 Ga0316588_1035028 3300033528 Bacteria 1188
373 Ga0316588_1042483 3300033528 Bacteria 1089
374 Ga0316588_1043695 3300033528 Bacteria 1076
375 Ga0316596_1000366 3300033541 Bacteria 7418
376 Ga0316596_1002234 3300033541 Bacteria 4104
377 Ga0316596_1003917 3300033541 Bacteria 3299
378 Ga0316596_1007933 3300033541 Bacteria 2518
379 Ga0316596_1008124 3300033541 Bacteria 2495
380 Ga0316596_1008922 3300033541 Bacteria 2399
381 Ga0316596_1013705 3300033541 Bacteria 2004
382 Ga0316596_1014553 3300033541 Bacteria 1952
383 Ga0316596_1015998 3300033541 Bacteria 1876
384 Ga0316596_1016243 3300033541 Bacteria 1863
385 Ga0316596_1016474 3300033541 Bacteria 1852
386 Ga0316596_1022724 3300033541 Bacteria 1604
387 Ga0316596_1027440 3300033541 Bacteria 1469
388 Ga0316596_1033701 3300033541 Bacteria 1335
389 Ga0316596_1037265 3300033541 Bacteria 1272
390 Ga0316596_1046705 3300033541 Bacteria 1144
391 Ga0316596_1072077 3300033541 Bacteria 925
392 Ga0316574_0014181 3300035398 Bacteria 4597
393 Ga0316574_0125607 3300035398 Bacteria 1649
394 Ga0373927_0150435 3300035695 Bacteria 1524
395 Ga0265778_001249 3300036457 Bacteria 2277
396 Ga0316582_0035511 3300036647 Bacteria 3079
397 Ga0316584_0000096 3300036712 Bacteria 35816
398 Ga0316584_0028358 3300036712 Bacteria 4128
399 Ga0316584_0036531 3300036712 Bacteria 3646
400 Ga0395899_0000002 3300037312 Bacteria 1324310
401 Ga0395899_0000061 3300037312 Bacteria 212002
402 Ga0395899_0000459 3300037312 Bacteria 46222
403 Ga0395899_0012421 3300037312 Bacteria 6524
404 Ga0395899_0046276 3300037312 Bacteria 3241
405 Ga0395900_0000143 3300037418 Bacteria 120234
406 Ga0395900_0000284 3300037418 Bacteria 75852
407 Ga0395900_0716555 3300037418 Bacteria 933
408 Ga0395898_0049674 3300037466 Bacteria 4109
409 Ga0395898_0059816 3300037466 Bacteria 3705
410 Ga0395905_0000011 3300037471 Bacteria 424563
411 Ga0395905_0000045 3300037471 Bacteria 241370
412 Ga0395905_0001507 3300037471 Bacteria 27862
413 Ga0395905_0003630 3300037471 Bacteria 16393
414 Ga0395901_0000976 3300038443 Bacteria 31051
415 Ga0395901_0003957 3300038443 Bacteria 14901
416 Ga0395901_0056763 3300038443 Bacteria 4073
417 Ga0395901_0213352 3300038443 Bacteria 2020
418 Ga0395901_0237197 3300038443 Bacteria 1903
419 Ga0400489_23224 3300039093 Bacteria 1319
420 Ga0400487_14420 3300039110 Bacteria 1113
421 Ga0436361_0285047 3300039447 Bacteria 6372
422 Ga0451790_02189 3300041444 Bacteria 1789
423 Ga0451790_30578 3300041444 Bacteria 962
424 Ga0451794_27951 3300041446 Bacteria 1260
425 Ga0451807_1843265 3300041486 Bacteria 1171
426 Ga0451837_1311701 3300041494 Bacteria 1305
427 Ga0451854_21462 3300041510 Bacteria 1378
428 Ga0451853_3267999 3300041512 Bacteria 1058
429 Ga0452268_22974 3300041907 Bacteria 1124
430 Ga0439448_0007567 3300042005 Bacteria 3153
431 Ga0439449_0050505 3300042007 Bacteria 1539
432 Ga0439452_019002 3300042010 Bacteria 1823
433 Ga0439457_009023 3300042014 Bacteria 2332
434 Ga0451577_0001856 3300042876 Bacteria 26925
435 Ga0451577_0022661 3300042876 Bacteria 5734
436 Ga0451577_0091907 3300042876 Bacteria 2709
437 Ga0453683_0245770 3300044673 Bacteria 1140
438 Ga0466966_0003065 3300044684 Bacteria 11018
439 Ga0466961_0031179 3300044693 Bacteria 3427
440 Ga0453684_0000413 3300044712 Bacteria 174924
441 Ga0453684_0001891 3300044712 Bacteria 54349
442 Ga0453684_0002943 3300044712 Bacteria 39941
443 Ga0453684_0006165 3300044712 Bacteria 23060
444 Ga0453684_0007249 3300044712 Bacteria 20528
445 Ga0453684_0013926 3300044712 Bacteria 12969
446 Ga0453684_0024439 3300044712 Bacteria 8830
447 Ga0453684_0043847 3300044712 Bacteria 6002
448 Ga0453684_0375729 3300044712 Bacteria 1597
449 Ga0453684_0425574 3300044712 Bacteria 1482
450 Ga0466968_0094163 3300044735 Bacteria 1331
451 Ga0466959_0038507 3300045049 Bacteria 3534
452 Ga0451576_0000003 3300045051 Bacteria 1550573
453 Ga0451576_0005986 3300045051 Bacteria 15039
454 Ga0451576_0006577 3300045051 Bacteria 14217
455 Ga0451576_0022593 3300045051 Bacteria 6819
456 Ga0451576_0161739 3300045051 Bacteria 2337
457 Ga0451576_0178682 3300045051 Bacteria 2216
458 Ga0451576_0608818 3300045051 Bacteria 1148
459 Ga0466958_0017929 3300045836 Bacteria 4102
460 Ga0495627_098218 3300046453 Bacteria 838
461 Ga0495651_0032684 3300046462 Bacteria 4057
462 Ga0495653_0150461 3300046463 Bacteria 1627
463 Ga0495650_0000594 3300046471 Bacteria 49931
464 Ga0495650_0032661 3300046471 Bacteria 2326
465 Ga0495585_0003458 3300046492 Bacteria 10667
466 Ga0495585_0004171 3300046492 Bacteria 9440
467 Ga0495596_0015612 3300046500 Bacteria 3174
468 Ga0495583_0028887 3300046506 Bacteria 2720
469 Ga0495583_0039788 3300046506 Bacteria 2212
470 Ga0495606_0027164 3300046507 Bacteria 4064
471 Ga0495606_0037734 3300046507 Bacteria 3278
472 Ga0495606_0057780 3300046507 Bacteria 2497
473 Ga0495606_0085902 3300046507 Bacteria 1945
474 Ga0495608_0181797 3300046511 Bacteria 1330
475 Ga0495610_0001861 3300046512 Bacteria 18285
476 Ga0495610_0007560 3300046512 Bacteria 7198
477 Ga0495610_0143679 3300046512 Bacteria 1024
478 Ga0495616_0006133 3300046513 Bacteria 7319
479 Ga0495616_0010222 3300046513 Bacteria 5443
480 Ga0495631_0158212 3300046518 Bacteria 972
481 Ga0495644_0005315 3300046523 Bacteria 5029
482 Ga0495648_0004657 3300046524 Bacteria 11632
483 Ga0495663_0026521 3300046525 Bacteria 1697
484 Ga0495652_0544982 3300046529 Bacteria 798
485 Ga0495609_0005251 3300046538 Bacteria 6875
486 Ga0495622_0026339 3300046557 Bacteria 2716
487 Ga0495633_0000021 3300046558 Bacteria 227171
488 Ga0495668_0000673 3300046616 Bacteria 41193
489 Ga0495668_0110755 3300046616 Bacteria 1502
490 Ga0495625_0000021 3300046660 Bacteria 282133
491 Ga0495625_0033407 3300046660 Bacteria 3805
492 Ga0495625_0047911 3300046660 Bacteria 3080
493 Ga0495625_0094724 3300046660 Bacteria 2059
494 Ga0495635_0384985 3300046663 Bacteria 933
495 Ga0495661_0000739 3300046665 Bacteria 31861
496 Ga0495661_0008232 3300046665 Bacteria 7223
497 Ga0495649_0000009 3300046694 Bacteria 451725
498 Ga0495649_0023066 3300046694 Bacteria 3477
499 Ga0495660_0005455 3300046810 Bacteria 7616
500 Ga0495683_0091552 3300047323 Bacteria 1473
501 Ga0495687_001340 3300047443 Bacteria 22938
502 Ga0495687_020359 3300047443 Bacteria 3233
503 Ga0495679_026403 3300047446 Bacteria 1929
504 Ga0495685_023166 3300047447 Bacteria 2137
505 Ga0495673_0016437 3300047469 Bacteria 3783
506 Ga0495681_0047893 3300047470 Bacteria 2031
507 Ga0495686_0041791 3300047472 Bacteria 2918
508 Ga0495686_0131215 3300047472 Bacteria 1485
509 Ga0496116_0005208 3300048919 Bacteria 12179
510 Ga0496117_0015077 3300048920 Bacteria 6618
511 Ga0496122_0000625 3300048925 Bacteria 72309
512 Ga0496122_0032264 3300048925 Bacteria 4335
513 Ga0496123_0015827 3300048926 Bacteria 6161
514 Ga0496123_0016547 3300048926 Bacteria 5980
515 Ga0496124_0197845 3300048927 Bacteria 1531
516 Ga0496125_0065617 3300048928 Bacteria 2874
517 Ga0496125_0100691 3300048928 Bacteria 2129
518 Ga0501306_000090 3300049127 Bacteria 4994
519 Ga0501306_001514 3300049127 Bacteria 2212
520 Ga0501306_003219 3300049127 Bacteria 1743
521 Ga0501306_003286 3300049127 Bacteria 1731
522 Ga0501306_006690 3300049127 Bacteria 1361
523 Ga0501308_000241 3300049128 Bacteria 3184
524 Ga0501308_001515 3300049128 Bacteria 1877
525 Ga0501308_003504 3300049128 Bacteria 1456
526 Ga0501308_005994 3300049128 Bacteria 1231
527 Ga0501309_001209 3300049129 Bacteria 2455
528 Ga0501309_005559 3300049129 Bacteria 1507
529 Ga0501309_006960 3300049129 Bacteria 1391
530 Ga0501309_013494 3300049129 Bacteria 1087
531 Ga0501310_000779 3300049130 Bacteria 2826
532 Ga0501310_000916 3300049130 Bacteria 2624
533 Ga0501310_001290 3300049130 Bacteria 2254
534 Ga0501310_004289 3300049130 Bacteria 1427
535 Ga0501310_005932 3300049130 Bacteria 1266
536 Ga0501343_003622 3300049132 Bacteria 1142
537 Ga0501343_004790 3300049132 Bacteria 1024
538 Ga0501345_00892 3300049134 Bacteria 1081
539 Ga0501304_000073 3300049160 Bacteria 3490
540 Ga0501304_003896 3300049160 Bacteria 1113
541 Ga0501304_004832 3300049160 Bacteria 1035
542 Ga0501304_007180 3300049160 Bacteria 914
543 Ga0501305_000527 3300049161 Bacteria 3182
544 Ga0501305_000794 3300049161 Bacteria 2794
545 Ga0501305_001549 3300049161 Bacteria 2277
546 Ga0501305_001909 3300049161 Bacteria 2150
547 Ga0501305_002509 3300049161 Bacteria 1990
548 Ga0501305_002800 3300049161 Bacteria 1920
549 Ga0501305_005953 3300049161 Bacteria 1499
550 Ga0501307_000427 3300049162 Bacteria 2816
551 Ga0501307_000560 3300049162 Bacteria 2636
552 Ga0501307_000602 3300049162 Bacteria 2573
553 Ga0501307_000909 3300049162 Bacteria 2272
554 Ga0501307_002306 3300049162 Bacteria 1760
555 Ga0501307_003893 3300049162 Bacteria 1493
556 Ga0495678_041511 3300049459 Bacteria 1840
557 Ga0501293_005397 3300049516 Bacteria 1026
558 Ga0501311_000833 3300049527 Bacteria 2405
559 Ga0501311_000890 3300049527 Bacteria 2359
560 Ga0501311_001075 3300049527 Bacteria 2252
561 Ga0501311_002484 3300049527 Bacteria 1772
562 Ga0501312_000226 3300049528 Bacteria 4004
563 Ga0501312_000486 3300049528 Bacteria 3226
564 Ga0501312_000493 3300049528 Bacteria 3219
565 Ga0501312_007331 3300049528 Bacteria 1402
566 Ga0501312_007409 3300049528 Bacteria 1398
567 Ga0501312_007957 3300049528 Bacteria 1364
568 Ga0501312_025010 3300049528 Bacteria 908
569 Ga0501312_039133 3300049528 Bacteria 770
570 Ga0501313_000170 3300049529 Bacteria 3613
571 Ga0501313_000829 3300049529 Bacteria 2374
572 Ga0501313_001041 3300049529 Bacteria 2239
573 Ga0501313_004034 3300049529 Bacteria 1492
574 Ga0501313_004733 3300049529 Bacteria 1411
575 Ga0501314_000363 3300049530 Bacteria 2733
576 Ga0501314_000485 3300049530 Bacteria 2490
577 Ga0501314_001176 3300049530 Bacteria 1845
578 Ga0501315_000064 3300049531 Bacteria 4778
579 Ga0501315_000281 3300049531 Bacteria 3269
580 Ga0501315_000629 3300049531 Bacteria 2561
581 Ga0501315_000715 3300049531 Bacteria 2460
582 Ga0501315_001860 3300049531 Bacteria 1890
583 Ga0501315_002700 3300049531 Bacteria 1702
584 Ga0501315_009283 3300049531 Bacteria 1160
585 Ga0501315_019422 3300049531 Bacteria 904
586 Ga0501315_035605 3300049531 Bacteria 735
587 Ga0501316_000593 3300049532 Bacteria 2609
588 Ga0501316_000650 3300049532 Bacteria 2551
589 Ga0501316_005035 3300049532 Bacteria 1355
590 Ga0501316_013778 3300049532 Bacteria 958
591 Ga0501316_017170 3300049532 Bacteria 886
592 Ga0501317_001389 3300049533 Bacteria 2081
593 Ga0501317_003488 3300049533 Bacteria 1573
594 Ga0501317_005631 3300049533 Bacteria 1350
595 Ga0501317_005736 3300049533 Bacteria 1341
596 Ga0501318_000652 3300049534 Bacteria 2335
597 Ga0501318_001035 3300049534 Bacteria 2047
598 Ga0501319_000383 3300049535 Bacteria 2045
599 Ga0501319_000428 3300049535 Bacteria 1988
600 Ga0501319_005309 3300049535 Bacteria 921
601 Ga0501320_000255 3300049536 Bacteria 2836
602 Ga0501320_000921 3300049536 Bacteria 1949
603 Ga0501320_002180 3300049536 Bacteria 1542
604 Ga0501320_002635 3300049536 Bacteria 1452
605 Ga0501320_003081 3300049536 Bacteria 1387
606 Ga0501320_005140 3300049536 Bacteria 1182
607 Ga0501321_000813 3300049537 Bacteria 2228
608 Ga0501321_000939 3300049537 Bacteria 2130
609 Ga0501321_001995 3300049537 Bacteria 1713
610 Ga0501321_012501 3300049537 Bacteria 962
611 Ga0501321_022211 3300049537 Bacteria 797
612 Ga0501323_001783 3300049539 Bacteria 1983
613 Ga0501323_002326 3300049539 Bacteria 1829
614 Ga0501323_004429 3300049539 Bacteria 1486
615 Ga0501323_012675 3300049539 Bacteria 1032
616 Ga0501324_004922 3300049540 Bacteria 1080
617 Ga0501324_011105 3300049540 Bacteria 829
618 Ga0501325_003222 3300049541 Bacteria 1175
619 Ga0501325_014404 3300049541 Bacteria 769
620 Ga0501329_00400 3300049545 Bacteria 1491
621 Ga0501330_003862 3300049546 Bacteria 912
622 Ga0501331_01871 3300049547 Bacteria 1064
623 Ga0501333_000591 3300049549 Bacteria 1729
624 Ga0501335_000798 3300049551 Bacteria 2199
625 Ga0501335_003543 3300049551 Bacteria 1327
626 Ga0501335_005839 3300049551 Bacteria 1108
627 Ga0501335_005857 3300049551 Bacteria 1106
628 Ga0501336_000444 3300049552 Bacteria 2044
629 Ga0501336_000701 3300049552 Bacteria 1777
630 Ga0501031_0071900 3300049568 Bacteria 2252
631 Ga0501222_006970 3300049662 Bacteria 1514
632 Ga0501223_002278 3300049663 Bacteria 4288
633 Ga0501227_022071 3300049665 Bacteria 1471
634 Ga0501240_000074 3300049673 Bacteria 6037
635 Ga0501242_010894 3300049674 Bacteria 1091
636 Ga0501257_002604 3300049686 Bacteria 3803
637 Ga0501257_036651 3300049686 Bacteria 1195
638 Ga0501225_0026515 3300049705 Bacteria 1593
639 Ga0501241_001570 3300049758 Bacteria 4587
640 Ga0501264_010699 3300049761 Bacteria 885
641 nmdc:mga0k408_173043_c1 3300050493 Bacteria 1287
642 nmdc:mga0k408_192815_c1 3300050493 Bacteria 1216
643 nmdc:mga0k408_350_c1 3300050493 Bacteria 25267
644 nmdc:mga0k408_38765_c1 3300050493 Bacteria 2736
645 nmdc:mga0k408_4120_c1 3300050493 Bacteria 7721
646 nmdc:mga07m45_126407_c1 3300050496 Bacteria 1478
647 nmdc:mga07m45_140197_c1 3300050496 Bacteria 1400
648 nmdc:mga07m45_164171_c1 3300050496 Bacteria 1290
649 Ga0500635_0001097 3300053080 Bacteria 6481
650 Ga0500651_0000124 3300053093 Bacteria 47212
651 Ga0500608_006222 3300053122 Bacteria 4839
652 Ga0500614_008477 3300053123 Bacteria 2180
653 Ga0500618_000080 3300053125 Bacteria 78455
654 Ga0500642_0083553 3300053130 Bacteria 1469
655 Ga0500655_027683 3300053133 Bacteria 1083
656 Ga0500573_0033087 3300053140 Bacteria 2984
657 Ga0500573_0225472 3300053140 Bacteria 980
658 Ga0500619_063074 3300053154 Bacteria 1223
659 Ga0500622_0001219 3300053156 Bacteria 21136
660 Ga0500634_0114798 3300053161 Bacteria 1321
661 Ga0587084_002476 3300059477 Bacteria 1918
662 Ga0587093_006246 3300059478 Bacteria 1291
663 Ga0587093_019759 3300059478 Bacteria 890
664 Ga0587066_003653 3300059490 Bacteria 1827
665 Ga0587070_000220 3300059491 Bacteria 3977
666 Ga0587070_015923 3300059491 Bacteria 1197
667 Ga0587073_0052786 3300059492 Bacteria 927
668 Ga0587077_000327 3300059493 Bacteria 3754
669 Ga0587077_003067 3300059493 Bacteria 2065
670 Ga0587077_003693 3300059493 Bacteria 1948
671 Ga0587077_019684 3300059493 Bacteria 1178
672 Ga0587083_0000996 3300059505 Bacteria 2952
673 Ga0587083_0012424 3300059505 Bacteria 1429
674 Ga0587083_0013735 3300059505 Bacteria 1383
675 Ga0587085_003141 3300059506 Bacteria 1765
676 Ga0587086_004801 3300059507 Bacteria 1432
677 Ga0587088_011151 3300059508 Bacteria 1333
678 Ga0587090_000102 3300059510 Bacteria 5197
679 Ga0587090_001380 3300059510 Bacteria 2450
680 Ga0587090_008145 3300059510 Bacteria 1397
681 Ga0587091_001706 3300059511 Bacteria 2450
682 Ga0587092_000379 3300059512 Bacteria 3407
683 Ga0587092_010678 3300059512 Bacteria 1262
684 Ga0587094_016263 3300059513 Bacteria 1034
685 Ga0587125_000722 3300059607 Bacteria 2115
686 Ga0587101_004054 3300059623 Bacteria 1540
687 Ga0587109_002139 3300059624 Bacteria 2459
688 Ga0587117_000256 3300059627 Bacteria 3264
689 Ga0587117_005332 3300059627 Bacteria 1386
690 Ga0587062_000297 3300059639 Bacteria 3210
691 Ga0587062_000616 3300059639 Bacteria 2623
692 Ga0587062_001829 3300059639 Bacteria 1925
693 Ga0587067_000818 3300059640 Bacteria 3043
694 Ga0587068_000740 3300059641 Bacteria 3246
695 Ga0587068_009729 3300059641 Bacteria 1421
696 Ga0587069_016609 3300059642 Bacteria 1054
697 Ga0587069_024431 3300059642 Bacteria 932
698 Ga0587072_005484 3300059643 Bacteria 1895
699 Ga0587076_000772 3300059645 Bacteria 2886
700 Ga0587076_001127 3300059645 Bacteria 2613
701 Ga0587076_003836 3300059645 Bacteria 1827
702 Ga0587076_042404 3300059645 Bacteria 855
703 Ga0587079_005766 3300059647 Bacteria 1769
704 Ga0587108_000400 3300059653 Bacteria 2170
705 Ga0587111_0000072 3300060346 Bacteria 6196
706 Ga0587111_0006838 3300060346 Bacteria 1826

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049129 Ga0501309_013494 Ga0501309_013494_20_646 208
2 3300049162 Ga0501307_000909 Ga0501307_000909_1623_2249 208
3 3300049160 Ga0501304_004832 Ga0501304_004832_388_1020 210
4 3300049161 Ga0501305_002509 Ga0501305_002509_1344_1976 210
5 3300033541 Ga0316596_1008124 Ga0316596_10081242 213
6 3300005289 Ga0065704_10000757 Ga0065704_100007576 216
7 3300009148 Ga0105243_10000018 Ga0105243_10000018193 216
8 3300025935 Ga0207709_10000021 Ga0207709_100000215 216
9 3300032004 Ga0307414_10507110 Ga0307414_105071102 216
10 3300041444 Ga0451790_02189 Ga0451790_02189_597_1295 216
11 3300048919 Ga0496116_0005208 Ga0496116_0005208_9966_10664 216
12 3300048920 Ga0496117_0015077 Ga0496117_0015077_497_1195 216
13 3300048925 Ga0496122_0032264 Ga0496122_0032264_906_1604 216
14 3300048926 Ga0496123_0016547 Ga0496123_0016547_4902_5600 216
15 3300048927 Ga0496124_0197845 Ga0496124_0197845_277_975 216
16 3300048928 Ga0496125_0065617 Ga0496125_0065617_1639_2337 216
17 3300046471 Ga0495650_0032661 Ga0495650_0032661_1195_1893 217
18 3300046506 Ga0495583_0039788 Ga0495583_0039788_51_749 217
19 3300028653 Ga0265323_10000038 Ga0265323_1000003829 219
20 3300031344 Ga0265316_10000481 Ga0265316_1000048130 219
21 3300031712 Ga0265342_10065670 Ga0265342_100656701 219
22 3300009093 Ga0105240_10429871 Ga0105240_104298712 220
23 3300042876 Ga0451577_0091907 Ga0451577_0091907_1152_1847 220
24 3300044712 Ga0453684_0001891 Ga0453684_0001891_32898_33593 220
25 3300031727 Ga0316576_10050475 Ga0316576_100504754 221
26 3300036712 Ga0316584_0036531 Ga0316584_0036531_307_999 221
27 3300059627 Ga0587117_005332 Ga0587117_005332_47_808 221
28 3300031911 Ga0307412_10336902 Ga0307412_103369022 222
29 3300002067 JGI24735J21928_10000009 JGI24735J21928_10000009208 223
30 3300002737 JGI25162J39368_1001524 JGI25162J39368_10015244 223
31 3300002772 JGI25164J39214_1000824 JGI25164J39214_100082415 223
32 3300003214 JGI25165J46597_1000923 JGI25165J46597_100092314 223
33 3300005614 Ga0068856_100003360 Ga0068856_1000033607 223
34 3300006195 Ga0075366_10068860 Ga0075366_100688602 223
35 3300020077 Ga0206351_10078727 Ga0206351_100787272 223
36 3300020077 Ga0206351_10106046 Ga0206351_101060468 223
37 3300020080 Ga0206350_10297200 Ga0206350_102972005 223
38 3300020080 Ga0206350_10622310 Ga0206350_106223104 223
39 3300020610 Ga0154015_1073617 Ga0154015_10736173 223
40 3300020610 Ga0154015_1153066 Ga0154015_11530667 223
41 3300022467 Ga0224712_10000859 Ga0224712_100008599 223
42 3300025231 Ga0207427_100236 Ga0207427_10023616 223
43 3300025233 Ga0209437_100034 Ga0209437_10003414 223
44 3300025261 Ga0209233_1000038 Ga0209233_100003814 223
45 3300025904 Ga0207647_10007050 Ga0207647_100070504 223
46 3300026067 Ga0207678_10032515 Ga0207678_100325154 223
47 3300026078 Ga0207702_10034672 Ga0207702_100346724 223
48 3300044673 Ga0453683_0245770 Ga0453683_0245770_151_843 224
49 3300046523 Ga0495644_0005315 Ga0495644_0005315_1294_1992 224
50 3300047447 Ga0495685_023166 Ga0495685_023166_348_1046 224
51 3300059513 Ga0587094_016263 Ga0587094_016263_212_910 224
52 3300020080 Ga0206350_10111961 Ga0206350_101119614 225
53 3300045051 Ga0451576_0000003 Ga0451576_0000003_869325_870026 225
54 3300049528 Ga0501312_039133 Ga0501312_039133_35_730 225
55 3300044735 Ga0466968_0094163 Ga0466968_0094163_348_1067 226
56 iso_pu_bacteria 2839989709 2839990137 226
57 3300003781 Ga0055536_1000001 Ga0055536_1000001433 227
58 3300003791 Ga0055530_10008207 Ga0055530_100082074 227
59 3300009036 Ga0105244_10020501 Ga0105244_100205012 227
60 3300013100 Ga0157373_10225466 Ga0157373_102254662 227
61 3300013105 Ga0157369_10000478 Ga0157369_1000047844 227
62 3300013306 Ga0163162_10038959 Ga0163162_100389596 227
63 3300014497 Ga0182008_10006054 Ga0182008_100060544 227
64 3300015261 Ga0182006_1070067 Ga0182006_10700671 227
65 3300015262 Ga0182007_10000003 Ga0182007_10000003434 227
66 3300015682 Ga0183373_1001 Ga0183373_1001541 227
67 3300025292 Ga0209676_1000008 Ga0209676_1000008428 227
68 3300025298 Ga0209050_1000045 Ga0209050_1000045357 227
69 3300025949 Ga0207667_10236032 Ga0207667_102360323 227
70 3300032002 Ga0307416_100504653 Ga0307416_1005046532 227
71 3300041510 Ga0451854_21462 Ga0451854_21462_539_1237 227
72 3300046512 Ga0495610_0143679 Ga0495610_0143679_234_932 227
73 iso_pu_bacteria 2739367866 2740031516 227
74 3300005356 Ga0070674_100626513 Ga0070674_1006265131 228
75 3300009176 Ga0105242_10505299 Ga0105242_105052991 228
76 3300026075 Ga0207708_10377458 Ga0207708_103774581 228
77 3300049568 Ga0501031_0071900 Ga0501031_0071900_338_1045 228
78 iso_pu_bacteria 2522125168 2522552601 228
79 iso_pu_bacteria 2585427687 2586210452 228
80 iso_pu_bacteria 2599185184 2599479162 228
81 iso_pu_bacteria 2721755487 2722726631 228
82 iso_pu_bacteria 2738541283 2738755463 228
83 iso_pu_bacteria 2738541302 2738851931 228
84 iso_pu_bacteria 2738543023 2739303600 228
85 iso_pu_bacteria 2739367651 2739590821 228
86 iso_pu_bacteria 2739367656 2739617018 228
87 iso_pu_bacteria 2739367663 2739647324 228
88 iso_pu_bacteria 2775506987 2776615087 228
89 iso_pu_bacteria 2818991437 2819546476 228
90 iso_pu_bacteria 2842722452 2842725172 228
91 iso_pu_bacteria 2842903701 2842905876 228
92 iso_pu_bacteria 2842909656 2842912447 228
93 iso_pu_bacteria 2849281842 2849286039 228
94 iso_pu_bacteria 2852623160 2852625292 228
95 iso_pu_bacteria 2857627736 2857629755 228
96 iso_pu_bacteria 2884634485 2884637393 228
97 iso_pu_bacteria 2884933994 2884934305 228
98 iso_pu_bacteria 2890737413 2890738050 228
99 iso_pu_bacteria 2896317667 2896321222 228
100 iso_pu_bacteria 2896344016 2896345745 228
101 iso_pu_bacteria 2898713307 2898713531 228
102 iso_pu_bacteria 2902048731 2902052508 228
103 iso_pu_bacteria 2904445276 2904446636 228
104 iso_pu_bacteria 2904780799 2904785861 228
105 iso_pu_bacteria 2910245624 2910249772 228
106 iso_pu_bacteria 2919177583 2919182477 228
107 iso_pu_bacteria 2919186247 2919190322 228
108 iso_pu_bacteria 2919437846 2919438213 228
109 iso_pu_bacteria 2919692658 2919697442 228
110 iso_pu_bacteria 2928078545 2928082523 228
111 iso_pu_bacteria 2928147474 2928148889 228
112 iso_pu_bacteria 2932082852 2932086313 228
113 iso_pu_bacteria 2939664404 2939668603 228
114 iso_pu_bacteria 2945997725 2946002099 228
115 iso_pu_bacteria 2954016120 2954018997 228
116 iso_pu_bacteria 2977232053 2977233775 228
117 iso_pu_bacteria 3003233435 3003235166 228
118 iso_pu_bacteria 8055588893 8055590022 228
119 3300031548 Ga0307408_100605987 Ga0307408_1006059872 229
120 3300031731 Ga0307405_10308938 Ga0307405_103089382 229
121 3300031911 Ga0307412_10539410 Ga0307412_105394101 229
122 3300033541 Ga0316596_1016243 Ga0316596_10162433 229
123 3300042010 Ga0439452_019002 Ga0439452_019002_947_1657 229
124 3300046518 Ga0495631_0158212 Ga0495631_0158212_130_819 229
125 3300049128 Ga0501308_003504 Ga0501308_003504_639_1328 229
126 3300049132 Ga0501343_003622 Ga0501343_003622_155_844 229
127 3300049527 Ga0501311_000833 Ga0501311_000833_992_1681 229
128 3300049528 Ga0501312_007409 Ga0501312_007409_217_906 229
129 3300049531 Ga0501315_035605 Ga0501315_035605_23_712 229
130 3300049532 Ga0501316_017170 Ga0501316_017170_96_785 229
131 3300049535 Ga0501319_005309 Ga0501319_005309_37_726 229
132 3300049536 Ga0501320_002635 Ga0501320_002635_43_732 229
133 3300049537 Ga0501321_000939 Ga0501321_000939_975_1664 229
134 3300049539 Ga0501323_004429 Ga0501323_004429_775_1464 229
135 3300049539 Ga0501323_012675 Ga0501323_012675_310_999 229
136 3300049540 Ga0501324_004922 Ga0501324_004922_347_1036 229
137 3300049541 Ga0501325_003222 Ga0501325_003222_397_1086 229
138 3300003322 rootL2_10051773 rootL2_100517735 230
139 3300005290 Ga0065712_10251685 Ga0065712_102516852 230
140 3300005435 Ga0070714_100173670 Ga0070714_1001736702 230
141 3300005614 Ga0068856_100223306 Ga0068856_1002233062 230
142 3300005614 Ga0068856_100360582 Ga0068856_1003605822 230
143 3300013308 Ga0157375_10076034 Ga0157375_100760344 230
144 3300014325 Ga0163163_10060719 Ga0163163_100607194 230
145 3300025939 Ga0207665_10334263 Ga0207665_103342631 230
146 3300026078 Ga0207702_10314486 Ga0207702_103144862 230
147 3300026078 Ga0207702_10425580 Ga0207702_104255802 230
148 3300028573 Ga0265334_10036858 Ga0265334_100368583 230
149 3300029957 Ga0265324_10031804 Ga0265324_100318043 230
150 3300031251 Ga0265327_10017918 Ga0265327_100179184 230
151 3300031251 Ga0265327_10101179 Ga0265327_101011792 230
152 3300032004 Ga0307414_10691375 Ga0307414_106913752 230
153 3300037312 Ga0395899_0000061 Ga0395899_0000061_206850_207542 230
154 3300038443 Ga0395901_0000976 Ga0395901_0000976_1727_2419 230
155 3300039110 Ga0400487_14420 Ga0400487_14420_253_945 230
156 3300041907 Ga0452268_22974 Ga0452268_22974_214_906 230
157 3300049127 Ga0501306_003286 Ga0501306_003286_470_1162 230
158 3300049161 Ga0501305_000794 Ga0501305_000794_483_1175 230
159 3300049528 Ga0501312_025010 Ga0501312_025010_93_833 230
160 3300049529 Ga0501313_000829 Ga0501313_000829_1212_1904 230
161 3300049531 Ga0501315_009283 Ga0501315_009283_10_702 230
162 3300049549 Ga0501333_000591 Ga0501333_000591_460_1152 230
163 3300059478 Ga0587093_019759 Ga0587093_019759_32_724 230
164 3300059491 Ga0587070_000220 Ga0587070_000220_2783_3475 230
165 3300059493 Ga0587077_000327 Ga0587077_000327_2184_2876 230
166 3300059493 Ga0587077_019684 Ga0587077_019684_245_937 230
167 3300059505 Ga0587083_0000996 Ga0587083_0000996_71_763 230
168 3300059505 Ga0587083_0013735 Ga0587083_0013735_65_757 230
169 3300059512 Ga0587092_000379 Ga0587092_000379_2202_2894 230
170 3300059627 Ga0587117_000256 Ga0587117_000256_1710_2402 230
171 3300059639 Ga0587062_000297 Ga0587062_000297_333_1025 230
172 3300059641 Ga0587068_000740 Ga0587068_000740_374_1066 230
173 3300059642 Ga0587069_016609 Ga0587069_016609_304_996 230
174 3300004801 Ga0058860_12228446 Ga0058860_122284461 231
175 3300005288 Ga0065714_10087528 Ga0065714_100875284 231
176 3300005614 Ga0068856_101055924 Ga0068856_1010559241 231
177 3300005841 Ga0068863_100205953 Ga0068863_1002059533 231
178 3300009093 Ga0105240_10332980 Ga0105240_103329803 231
179 3300013296 Ga0157374_10772124 Ga0157374_107721242 231
180 3300013307 Ga0157372_10001280 Ga0157372_1000128013 231
181 3300013307 Ga0157372_10504382 Ga0157372_105043822 231
182 3300014326 Ga0157380_10000015 Ga0157380_1000001532 231
183 3300020070 Ga0206356_11849337 Ga0206356_118493372 231
184 3300026088 Ga0207641_10535181 Ga0207641_105351812 231
185 3300028653 Ga0265323_10015327 Ga0265323_100153273 231
186 3300028654 Ga0265322_10007311 Ga0265322_100073114 231
187 3300028654 Ga0265322_10091967 Ga0265322_100919672 231
188 3300031235 Ga0265330_10172809 Ga0265330_101728092 231
189 3300031344 Ga0265316_10002116 Ga0265316_1000211611 231
190 3300031344 Ga0265316_10151822 Ga0265316_101518222 231
191 3300031507 Ga0307509_10007266 Ga0307509_100072665 231
192 3300031727 Ga0316576_10017290 Ga0316576_100172904 231
193 3300031727 Ga0316576_10096258 Ga0316576_100962582 231
194 3300031728 Ga0316578_10084147 Ga0316578_100841473 231
195 3300031733 Ga0316577_10003141 Ga0316577_100031414 231
196 3300032168 Ga0316593_10000093 Ga0316593_100000935 231
197 3300032168 Ga0316593_10000991 Ga0316593_100009912 231
198 3300032168 Ga0316593_10005401 Ga0316593_100054014 231
199 3300032168 Ga0316593_10009431 Ga0316593_100094313 231
200 3300032168 Ga0316593_10017950 Ga0316593_100179504 231
201 3300032168 Ga0316593_10020305 Ga0316593_100203052 231
202 3300032168 Ga0316593_10023475 Ga0316593_100234752 231
203 3300032168 Ga0316593_10053466 Ga0316593_100534662 231
204 3300032168 Ga0316593_10061455 Ga0316593_100614551 231
205 3300033524 Ga0316592_1003224 Ga0316592_10032242 231
206 3300033524 Ga0316592_1003832 Ga0316592_10038321 231
207 3300033524 Ga0316592_1008924 Ga0316592_10089243 231
208 3300033524 Ga0316592_1018891 Ga0316592_10188912 231
209 3300033524 Ga0316592_1019564 Ga0316592_10195641 231
210 3300033528 Ga0316588_1042483 Ga0316588_10424832 231
211 3300033541 Ga0316596_1000366 Ga0316596_10003664 231
212 3300033541 Ga0316596_1002234 Ga0316596_10022344 231
213 3300033541 Ga0316596_1007933 Ga0316596_10079334 231
214 3300033541 Ga0316596_1013705 Ga0316596_10137053 231
215 3300033541 Ga0316596_1015998 Ga0316596_10159982 231
216 3300033541 Ga0316596_1022724 Ga0316596_10227242 231
217 3300033541 Ga0316596_1027440 Ga0316596_10274401 231
218 3300033541 Ga0316596_1033701 Ga0316596_10337012 231
219 3300033541 Ga0316596_1037265 Ga0316596_10372652 231
220 3300033541 Ga0316596_1046705 Ga0316596_10467052 231
221 3300033541 Ga0316596_1072077 Ga0316596_10720772 231
222 3300035398 Ga0316574_0014181 Ga0316574_0014181_1978_2673 231
223 3300035398 Ga0316574_0125607 Ga0316574_0125607_519_1214 231
224 3300035695 Ga0373927_0150435 Ga0373927_0150435_746_1441 231
225 3300036647 Ga0316582_0035511 Ga0316582_0035511_1677_2372 231
226 3300036712 Ga0316584_0000096 Ga0316584_0000096_8385_9080 231
227 3300037418 Ga0395900_0716555 Ga0395900_0716555_26_721 231
228 3300037471 Ga0395905_0000011 Ga0395905_0000011_322504_323199 231
229 3300037471 Ga0395905_0003630 Ga0395905_0003630_4015_4710 231
230 3300038443 Ga0395901_0213352 Ga0395901_0213352_604_1299 231
231 3300039093 Ga0400489_23224 Ga0400489_23224_317_1012 231
232 3300042876 Ga0451577_0022661 Ga0451577_0022661_2340_3035 231
233 3300044712 Ga0453684_0002943 Ga0453684_0002943_19766_20461 231
234 3300044712 Ga0453684_0013926 Ga0453684_0013926_5986_6681 231
235 3300044712 Ga0453684_0024439 Ga0453684_0024439_2393_3088 231
236 3300044712 Ga0453684_0043847 Ga0453684_0043847_4828_5523 231
237 3300044712 Ga0453684_0425574 Ga0453684_0425574_102_797 231
238 3300045051 Ga0451576_0006577 Ga0451576_0006577_12381_13076 231
239 3300045051 Ga0451576_0022593 Ga0451576_0022593_3564_4259 231
240 3300049129 Ga0501309_006960 Ga0501309_006960_674_1369 231
241 3300049130 Ga0501310_005932 Ga0501310_005932_401_1096 231
242 3300049532 Ga0501316_013778 Ga0501316_013778_161_856 231
243 3300049537 Ga0501321_001995 Ga0501321_001995_888_1583 231
244 3300049539 Ga0501323_002326 Ga0501323_002326_471_1166 231
245 3300049541 Ga0501325_014404 Ga0501325_014404_20_715 231
246 3300049546 Ga0501330_003862 Ga0501330_003862_161_856 231
247 3300049551 Ga0501335_005857 Ga0501335_005857_161_856 231
248 3300049552 Ga0501336_000444 Ga0501336_000444_607_1302 231
249 3300053133 Ga0500655_027683 Ga0500655_027683_255_950 231
250 3300059493 Ga0587077_003693 Ga0587077_003693_1233_1928 231
251 3300059510 Ga0587090_008145 Ga0587090_008145_367_1062 231
252 3300059512 Ga0587092_010678 Ga0587092_010678_502_1197 231
253 3300059641 Ga0587068_009729 Ga0587068_009729_271_966 231
254 3300059642 Ga0587069_024431 Ga0587069_024431_50_745 231
255 3300059645 Ga0587076_003836 Ga0587076_003836_427_1122 231
256 2124908027 MRS2a_Contig_9405 MRS2a_00295820 232
257 2162886012 MBSR1b_contig_6515855 MBSR1b_0162.00000050 232
258 3300001979 JGI24740J21852_10015326 JGI24740J21852_100153263 232
259 3300001989 JGI24739J22299_10047850 JGI24739J22299_100478502 232
260 3300001990 JGI24737J22298_10000614 JGI24737J22298_1000061413 232
261 3300001990 JGI24737J22298_10001905 JGI24737J22298_100019058 232
262 3300001990 JGI24737J22298_10003582 JGI24737J22298_100035824 232
263 3300001990 JGI24737J22298_10005403 JGI24737J22298_100054032 232
264 3300001991 JGI24743J22301_10020627 JGI24743J22301_100206272 232
265 3300002067 JGI24735J21928_10021163 JGI24735J21928_100211632 232
266 3300002737 JGI25162J39368_1000120 JGI25162J39368_100012045 232
267 3300002741 JGI25157J39369_1002820 JGI25157J39369_10028205 232
268 3300002741 JGI25157J39369_1004397 JGI25157J39369_10043972 232
269 3300002773 JGI25152J39213_1000022 JGI25152J39213_100002226 232
270 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001342 232
271 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001458 232
272 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001347 232
273 3300003316 rootH1_10025186 rootH1_100251865 232
274 3300003320 rootH2_10094915 rootH2_100949152 232
275 3300003320 rootH2_10133361 rootH2_101333612 232
276 3300003322 rootL2_10024334 rootL2_100243342 232
277 3300003323 rootH1_10003520 rootH1_100035204 232
278 3300003323 rootH1_10035174 rootH1_100351742 232
279 3300003323 rootH1_10067560 rootH1_100675605 232
280 3300003323 rootH1_10081742 rootH1_100817422 232
281 3300003323 rootH1_10107846 rootH1_101078462 232
282 3300003323 rootH1_10144272 rootH1_101442722 232
283 3300003693 Ga0032354_1069350 Ga0032354_10693502 232
284 3300003781 Ga0055536_1013448 Ga0055536_10134482 232
285 3300004799 Ga0058863_10005116 Ga0058863_1000511610 232
286 3300004800 Ga0058861_10088285 Ga0058861_100882853 232
287 3300004803 Ga0058862_10247728 Ga0058862_102477285 232
288 3300005262 Ga0065165_1002853 Ga0065165_10028537 232
289 3300005262 Ga0065165_1007781 Ga0065165_10077813 232
290 3300005288 Ga0065714_10005413 Ga0065714_100054134 232
291 3300005288 Ga0065714_10007805 Ga0065714_100078053 232
292 3300005288 Ga0065714_10009921 Ga0065714_100099213 232
293 3300005288 Ga0065714_10083664 Ga0065714_100836643 232
294 3300005288 Ga0065714_10118201 Ga0065714_101182012 232
295 3300005293 Ga0065715_10001084 Ga0065715_100010844 232
296 3300005327 Ga0070658_10000014 Ga0070658_10000014109 232
297 3300005327 Ga0070658_10129449 Ga0070658_101294492 232
298 3300005328 Ga0070676_10004106 Ga0070676_100041063 232
299 3300005329 Ga0070683_100016707 Ga0070683_1000167075 232
300 3300005334 Ga0068869_100171345 Ga0068869_1001713452 232
301 3300005337 Ga0070682_100461467 Ga0070682_1004614671 232
302 3300005338 Ga0068868_100235346 Ga0068868_1002353462 232
303 3300005355 Ga0070671_100005487 Ga0070671_1000054876 232
304 3300005364 Ga0070673_100015276 Ga0070673_1000152763 232
305 3300005366 Ga0070659_100000402 Ga0070659_10000040216 232
306 3300005366 Ga0070659_100016784 Ga0070659_1000167844 232
307 3300005366 Ga0070659_100061430 Ga0070659_1000614304 232
308 3300005456 Ga0070678_100001822 Ga0070678_1000018224 232
309 3300005457 Ga0070662_100059100 Ga0070662_1000591002 232
310 3300005458 Ga0070681_10008372 Ga0070681_1000837218 232
311 3300005459 Ga0068867_100001197 Ga0068867_1000011976 232
312 3300005530 Ga0070679_100014038 Ga0070679_10001403810 232
313 3300005530 Ga0070679_100252125 Ga0070679_1002521252 232
314 3300005548 Ga0070665_100000032 Ga0070665_100000032117 232
315 3300005563 Ga0068855_100000026 Ga0068855_1000000264 232
316 3300005563 Ga0068855_100042965 Ga0068855_1000429656 232
317 3300005563 Ga0068855_100079811 Ga0068855_1000798113 232
318 3300005563 Ga0068855_100088358 Ga0068855_1000883584 232
319 3300005577 Ga0068857_100505495 Ga0068857_1005054952 232
320 3300005578 Ga0068854_100049164 Ga0068854_1000491646 232
321 3300005578 Ga0068854_100185625 Ga0068854_1001856252 232
322 3300005614 Ga0068856_100000014 Ga0068856_1000000145 232
323 3300005614 Ga0068856_100039856 Ga0068856_1000398566 232
324 3300005614 Ga0068856_100083237 Ga0068856_1000832372 232
325 3300005616 Ga0068852_100001456 Ga0068852_1000014567 232
326 3300005616 Ga0068852_100501427 Ga0068852_1005014272 232
327 3300005718 Ga0068866_10152491 Ga0068866_101524912 232
328 3300006195 Ga0075366_10105465 Ga0075366_101054652 232
329 3300006195 Ga0075366_10186058 Ga0075366_101860582 232
330 3300006237 Ga0097621_100000057 Ga0097621_10000005739 232
331 3300006237 Ga0097621_100431254 Ga0097621_1004312542 232
332 3300006353 Ga0075370_10099499 Ga0075370_100994992 232
333 3300006358 Ga0068871_100000094 Ga0068871_10000009440 232
334 3300006881 Ga0068865_100000200 Ga0068865_10000020017 232
335 3300009093 Ga0105240_10067718 Ga0105240_100677184 232
336 3300009093 Ga0105240_10111763 Ga0105240_101117632 232
337 3300009093 Ga0105240_10129348 Ga0105240_101293483 232
338 3300009093 Ga0105240_10616692 Ga0105240_106166922 232
339 3300009094 Ga0111539_10159065 Ga0111539_101590656 232
340 3300009148 Ga0105243_10380221 Ga0105243_103802212 232
341 3300009174 Ga0105241_10019243 Ga0105241_100192436 232
342 3300009176 Ga0105242_10040711 Ga0105242_100407114 232
343 3300009176 Ga0105242_10595052 Ga0105242_105950522 232
344 3300009545 Ga0105237_10001287 Ga0105237_1000128731 232
345 3300009545 Ga0105237_10001321 Ga0105237_1000132119 232
346 3300009545 Ga0105237_10012788 Ga0105237_100127883 232
347 3300009545 Ga0105237_10060769 Ga0105237_100607693 232
348 3300009551 Ga0105238_10003742 Ga0105238_100037425 232
349 3300009551 Ga0105238_10097306 Ga0105238_100973062 232
350 3300009551 Ga0105238_10781559 Ga0105238_107815591 232
351 3300010375 Ga0105239_10000001 Ga0105239_10000001379 232
352 3300010375 Ga0105239_10001363 Ga0105239_1000136345 232
353 3300010375 Ga0105239_10005053 Ga0105239_1000505324 232
354 3300010375 Ga0105239_10364930 Ga0105239_103649302 232
355 3300013100 Ga0157373_10000448 Ga0157373_1000044826 232
356 3300013100 Ga0157373_10016881 Ga0157373_100168816 232
357 3300013102 Ga0157371_10002095 Ga0157371_1000209521 232
358 3300013102 Ga0157371_10019347 Ga0157371_100193476 232
359 3300013102 Ga0157371_10132755 Ga0157371_101327553 232
360 3300013102 Ga0157371_10178349 Ga0157371_101783492 232
361 3300013102 Ga0157371_10262802 Ga0157371_102628022 232
362 3300013104 Ga0157370_10044584 Ga0157370_100445846 232
363 3300013104 Ga0157370_10209085 Ga0157370_102090852 232
364 3300013104 Ga0157370_10281686 Ga0157370_102816862 232
365 3300013104 Ga0157370_10563883 Ga0157370_105638831 232
366 3300013105 Ga0157369_10001799 Ga0157369_100017997 232
367 3300013105 Ga0157369_10058386 Ga0157369_100583865 232
368 3300013105 Ga0157369_10064414 Ga0157369_100644143 232
369 3300013105 Ga0157369_10241115 Ga0157369_102411152 232
370 3300013105 Ga0157369_10358700 Ga0157369_103587002 232
371 3300013297 Ga0157378_10022748 Ga0157378_100227486 232
372 3300013297 Ga0157378_10041902 Ga0157378_100419025 232
373 3300013306 Ga0163162_10000052 Ga0163162_1000005252 232
374 3300013307 Ga0157372_10000020 Ga0157372_100000207 232
375 3300013307 Ga0157372_10000254 Ga0157372_1000025434 232
376 3300013307 Ga0157372_10042429 Ga0157372_100424292 232
377 3300013307 Ga0157372_10087139 Ga0157372_100871394 232
378 3300013307 Ga0157372_10122899 Ga0157372_101228996 232
379 3300013308 Ga0157375_10044048 Ga0157375_100440483 232
380 3300013308 Ga0157375_10106910 Ga0157375_101069101 232
381 3300013308 Ga0157375_10244028 Ga0157375_102440283 232
382 3300014497 Ga0182008_10021142 Ga0182008_100211423 232
383 3300014968 Ga0157379_10268826 Ga0157379_102688262 232
384 3300014969 Ga0157376_10279806 Ga0157376_102798062 232
385 3300015261 Ga0182006_1002415 Ga0182006_10024153 232
386 3300015262 Ga0182007_10049861 Ga0182007_100498612 232
387 3300017792 Ga0163161_10000641 Ga0163161_100006413 232
388 3300017792 Ga0163161_10040013 Ga0163161_100400132 232
389 3300017792 Ga0163161_10041013 Ga0163161_100410136 232
390 3300017792 Ga0163161_10701163 Ga0163161_107011631 232
391 3300020069 Ga0197907_10160647 Ga0197907_101606472 232
392 3300020069 Ga0197907_10706642 Ga0197907_107066423 232
393 3300020069 Ga0197907_10819694 Ga0197907_108196944 232
394 3300020069 Ga0197907_10908526 Ga0197907_109085262 232
395 3300020070 Ga0206356_10124111 Ga0206356_101241114 232
396 3300020070 Ga0206356_11795532 Ga0206356_117955323 232
397 3300020075 Ga0206349_1110078 Ga0206349_11100782 232
398 3300020075 Ga0206349_1596541 Ga0206349_15965412 232
399 3300020076 Ga0206355_1018008 Ga0206355_10180082 232
400 3300020077 Ga0206351_10462283 Ga0206351_104622834 232
401 3300020077 Ga0206351_10586730 Ga0206351_105867302 232
402 3300020078 Ga0206352_10727185 Ga0206352_107271851 232
403 3300020078 Ga0206352_11107574 Ga0206352_111075742 232
404 3300020081 Ga0206354_10771971 Ga0206354_107719712 232
405 3300020081 Ga0206354_10858690 Ga0206354_108586902 232
406 3300020081 Ga0206354_11003734 Ga0206354_110037342 232
407 3300020081 Ga0206354_11089144 Ga0206354_110891443 232
408 3300020081 Ga0206354_11204833 Ga0206354_112048332 232
409 3300020082 Ga0206353_10132441 Ga0206353_101324411 232
410 3300020082 Ga0206353_10698887 Ga0206353_106988874 232
411 3300020082 Ga0206353_10800764 Ga0206353_108007642 232
412 3300020082 Ga0206353_11125333 Ga0206353_111253333 232
413 3300020082 Ga0206353_11187972 Ga0206353_111879722 232
414 3300020610 Ga0154015_1236635 Ga0154015_12366352 232
415 3300021361 Ga0213872_10048147 Ga0213872_100481472 232
416 3300022467 Ga0224712_10005983 Ga0224712_100059832 232
417 3300022467 Ga0224712_10006283 Ga0224712_100062833 232
418 3300022467 Ga0224712_10014258 Ga0224712_100142582 232
419 3300025233 Ga0209437_100143 Ga0209437_10014334 232
420 3300025245 Ga0207425_1000002 Ga0207425_1000002826 232
421 3300025250 Ga0209026_1000463 Ga0209026_100046321 232
422 3300025250 Ga0209026_1002304 Ga0209026_10023047 232
423 3300025258 Ga0209129_1000002 Ga0209129_1000002826 232
424 3300025258 Ga0209129_1013234 Ga0209129_10132342 232
425 3300025272 Ga0209455_1001279 Ga0209455_10012793 232
426 3300025272 Ga0209455_1007272 Ga0209455_10072723 232
427 3300025292 Ga0209676_1000294 Ga0209676_10002945 232
428 3300025294 Ga0209025_1000004 Ga0209025_1000004364 232
429 3300025297 Ga0209758_1000006 Ga0209758_1000006364 232
430 3300025302 Ga0207426_1055039 Ga0207426_10550392 232
431 3300025321 Ga0207656_10057491 Ga0207656_100574912 232
432 3300025904 Ga0207647_10003884 Ga0207647_100038846 232
433 3300025907 Ga0207645_10002281 Ga0207645_1000228119 232
434 3300025909 Ga0207705_10000043 Ga0207705_10000043151 232
435 3300025911 Ga0207654_10005184 Ga0207654_100051844 232
436 3300025913 Ga0207695_10000053 Ga0207695_10000053158 232
437 3300025913 Ga0207695_10029659 Ga0207695_1002965914 232
438 3300025913 Ga0207695_10034034 Ga0207695_100340344 232
439 3300025913 Ga0207695_10044139 Ga0207695_100441392 232
440 3300025913 Ga0207695_10196503 Ga0207695_101965032 232
441 3300025914 Ga0207671_10002869 Ga0207671_100028697 232
442 3300025914 Ga0207671_10003103 Ga0207671_1000310311 232
443 3300025914 Ga0207671_10007516 Ga0207671_100075165 232
444 3300025914 Ga0207671_10012211 Ga0207671_100122119 232
445 3300025914 Ga0207671_10032530 Ga0207671_100325302 232
446 3300025914 Ga0207671_10037359 Ga0207671_100373596 232
447 3300025914 Ga0207671_10069032 Ga0207671_100690322 232
448 3300025919 Ga0207657_10091410 Ga0207657_100914102 232
449 3300025921 Ga0207652_10027983 Ga0207652_100279834 232
450 3300025924 Ga0207694_10022814 Ga0207694_100228143 232
451 3300025932 Ga0207690_10000365 Ga0207690_1000036514 232
452 3300025932 Ga0207690_10037427 Ga0207690_100374274 232
453 3300025933 Ga0207706_10000057 Ga0207706_1000005713 232
454 3300025933 Ga0207706_10169742 Ga0207706_101697422 232
455 3300025934 Ga0207686_10007982 Ga0207686_100079824 232
456 3300025937 Ga0207669_10136118 Ga0207669_101361182 232
457 3300025938 Ga0207704_10000052 Ga0207704_1000005248 232
458 3300025939 Ga0207665_10301290 Ga0207665_103012902 232
459 3300025942 Ga0207689_10080823 Ga0207689_100808233 232
460 3300025944 Ga0207661_10010757 Ga0207661_100107572 232
461 3300025949 Ga0207667_10000022 Ga0207667_10000022168 232
462 3300025949 Ga0207667_10001325 Ga0207667_1000132542 232
463 3300025949 Ga0207667_10012833 Ga0207667_100128335 232
464 3300025949 Ga0207667_10073046 Ga0207667_100730465 232
465 3300025960 Ga0207651_10027165 Ga0207651_100271653 232
466 3300025981 Ga0207640_10033694 Ga0207640_100336942 232
467 3300025986 Ga0207658_10500098 Ga0207658_105000982 232
468 3300026023 Ga0207677_10091392 Ga0207677_100913923 232
469 3300026035 Ga0207703_10031399 Ga0207703_100313996 232
470 3300026041 Ga0207639_10140200 Ga0207639_101402003 232
471 3300026078 Ga0207702_10000036 Ga0207702_10000036129 232
472 3300026078 Ga0207702_10063299 Ga0207702_100632992 232
473 3300026078 Ga0207702_10098980 Ga0207702_100989801 232
474 3300026089 Ga0207648_10002788 Ga0207648_100027886 232
475 3300026095 Ga0207676_10409747 Ga0207676_104097472 232
476 3300026121 Ga0207683_10010796 Ga0207683_100107964 232
477 3300026142 Ga0207698_10005473 Ga0207698_100054736 232
478 3300026142 Ga0207698_10732621 Ga0207698_107326212 232
479 3300027907 Ga0207428_10571149 Ga0207428_105711491 232
480 3300028379 Ga0268266_10000030 Ga0268266_10000030212 232
481 3300028381 Ga0268264_10467476 Ga0268264_104674762 232
482 3300028786 Ga0307517_10006168 Ga0307517_100061686 232
483 3300028794 Ga0307515_10049612 Ga0307515_100496124 232
484 3300028794 Ga0307515_10244807 Ga0307515_102448072 232
485 3300028800 Ga0265338_10049114 Ga0265338_100491143 232
486 3300028800 Ga0265338_10071330 Ga0265338_100713304 232
487 3300030731 Ga0316177_1003967 Ga0316177_100396712 232
488 3300030732 Ga0316176_1151771 Ga0316176_11517715 232
489 3300030733 Ga0314311_1080887 Ga0314311_10808872 232
490 3300030742 Ga0316183_1095896 Ga0316183_109589677 232
491 3300030744 Ga0316181_1088295 Ga0316181_10882956 232
492 3300030744 Ga0316181_1201818 Ga0316181_12018182 232
493 3300030744 Ga0316181_1282363 Ga0316181_12823633 232
494 3300030745 Ga0316182_1171482 Ga0316182_11714828 232
495 3300031507 Ga0307509_10101371 Ga0307509_101013715 232
496 3300031507 Ga0307509_10101439 Ga0307509_101014392 232
497 3300031548 Ga0307408_100000321 Ga0307408_10000032136 232
498 3300031548 Ga0307408_100037589 Ga0307408_1000375894 232
499 3300031548 Ga0307408_100070397 Ga0307408_1000703975 232
500 3300031727 Ga0316576_10176452 Ga0316576_101764522 232
501 3300031731 Ga0307405_10000003 Ga0307405_10000003214 232
502 3300031731 Ga0307405_10001399 Ga0307405_1000139913 232
503 3300031731 Ga0307405_10036088 Ga0307405_100360886 232
504 3300031824 Ga0307413_10173165 Ga0307413_101731651 232
505 3300031901 Ga0307406_10395533 Ga0307406_103955332 232
506 3300031903 Ga0307407_10000030 Ga0307407_1000003035 232
507 3300031911 Ga0307412_10000065 Ga0307412_1000006528 232
508 3300031911 Ga0307412_10000925 Ga0307412_1000092521 232
509 3300031911 Ga0307412_10466574 Ga0307412_104665742 232
510 3300031995 Ga0307409_100266165 Ga0307409_1002661653 232
511 3300032002 Ga0307416_100000014 Ga0307416_10000001428 232
512 3300032002 Ga0307416_100000800 Ga0307416_10000080014 232
513 3300032004 Ga0307414_10000069 Ga0307414_100000699 232
514 3300032004 Ga0307414_10007780 Ga0307414_100077804 232
515 3300032004 Ga0307414_10010548 Ga0307414_100105484 232
516 3300032004 Ga0307414_10167193 Ga0307414_101671932 232
517 3300032004 Ga0307414_10348866 Ga0307414_103488662 232
518 3300032004 Ga0307414_10481940 Ga0307414_104819402 232
519 3300032004 Ga0307414_10514247 Ga0307414_105142471 232
520 3300032004 Ga0307414_10849893 Ga0307414_108498931 232
521 3300032005 Ga0307411_10271759 Ga0307411_102717592 232
522 3300032168 Ga0316593_10019182 Ga0316593_100191825 232
523 3300032168 Ga0316593_10045675 Ga0316593_100456752 232
524 3300033179 Ga0307507_10000032 Ga0307507_1000003243 232
525 3300033524 Ga0316592_1068743 Ga0316592_10687431 232
526 3300033528 Ga0316588_1035028 Ga0316588_10350282 232
527 3300033528 Ga0316588_1043695 Ga0316588_10436952 232
528 3300033541 Ga0316596_1003917 Ga0316596_10039175 232
529 3300033541 Ga0316596_1008922 Ga0316596_10089225 232
530 3300033541 Ga0316596_1014553 Ga0316596_10145533 232
531 3300033541 Ga0316596_1016474 Ga0316596_10164743 232
532 3300036457 Ga0265778_001249 Ga0265778_001249_622_1320 232
533 3300036712 Ga0316584_0028358 Ga0316584_0028358_984_1682 232
534 3300037312 Ga0395899_0000002 Ga0395899_0000002_11991_12689 232
535 3300037312 Ga0395899_0000459 Ga0395899_0000459_35451_36149 232
536 3300037312 Ga0395899_0012421 Ga0395899_0012421_5169_5867 232
537 3300037312 Ga0395899_0046276 Ga0395899_0046276_2016_2714 232
538 3300037418 Ga0395900_0000143 Ga0395900_0000143_100967_101665 232
539 3300037418 Ga0395900_0000284 Ga0395900_0000284_72679_73377 232
540 3300037466 Ga0395898_0049674 Ga0395898_0049674_2320_3018 232
541 3300037466 Ga0395898_0059816 Ga0395898_0059816_1070_1768 232
542 3300037471 Ga0395905_0000045 Ga0395905_0000045_169247_169945 232
543 3300037471 Ga0395905_0001507 Ga0395905_0001507_24467_25165 232
544 3300038443 Ga0395901_0003957 Ga0395901_0003957_3104_3802 232
545 3300038443 Ga0395901_0056763 Ga0395901_0056763_71_769 232
546 3300038443 Ga0395901_0237197 Ga0395901_0237197_470_1168 232
547 3300039447 Ga0436361_0285047 Ga0436361_0285047_4908_5606 232
548 3300041444 Ga0451790_30578 Ga0451790_30578_64_762 232
549 3300041446 Ga0451794_27951 Ga0451794_27951_130_828 232
550 3300041486 Ga0451807_1843265 Ga0451807_1843265_257_955 232
551 3300041494 Ga0451837_1311701 Ga0451837_1311701_91_789 232
552 3300041512 Ga0451853_3267999 Ga0451853_3267999_134_832 232
553 3300042005 Ga0439448_0007567 Ga0439448_0007567_299_997 232
554 3300042007 Ga0439449_0050505 Ga0439449_0050505_190_888 232
555 3300042014 Ga0439457_009023 Ga0439457_009023_1443_2141 232
556 3300042876 Ga0451577_0001856 Ga0451577_0001856_14899_15597 232
557 3300044684 Ga0466966_0003065 Ga0466966_0003065_2399_3097 232
558 3300044693 Ga0466961_0031179 Ga0466961_0031179_867_1565 232
559 3300044712 Ga0453684_0000413 Ga0453684_0000413_100548_101246 232
560 3300044712 Ga0453684_0006165 Ga0453684_0006165_18286_18987 232
561 3300044712 Ga0453684_0007249 Ga0453684_0007249_2521_3219 232
562 3300044712 Ga0453684_0375729 Ga0453684_0375729_345_1046 232
563 3300045049 Ga0466959_0038507 Ga0466959_0038507_2594_3292 232
564 3300045051 Ga0451576_0005986 Ga0451576_0005986_10428_11126 232
565 3300045051 Ga0451576_0161739 Ga0451576_0161739_925_1626 232
566 3300045051 Ga0451576_0178682 Ga0451576_0178682_308_1006 232
567 3300045051 Ga0451576_0608818 Ga0451576_0608818_108_806 232
568 3300045836 Ga0466958_0017929 Ga0466958_0017929_1791_2489 232
569 3300046453 Ga0495627_098218 Ga0495627_098218_119_817 232
570 3300046462 Ga0495651_0032684 Ga0495651_0032684_698_1396 232
571 3300046463 Ga0495653_0150461 Ga0495653_0150461_18_716 232
572 3300046471 Ga0495650_0000594 Ga0495650_0000594_48538_49236 232
573 3300046492 Ga0495585_0003458 Ga0495585_0003458_3555_4253 232
574 3300046492 Ga0495585_0004171 Ga0495585_0004171_6392_7090 232
575 3300046500 Ga0495596_0015612 Ga0495596_0015612_2260_2958 232
576 3300046506 Ga0495583_0028887 Ga0495583_0028887_1183_1881 232
577 3300046507 Ga0495606_0027164 Ga0495606_0027164_595_1293 232
578 3300046507 Ga0495606_0037734 Ga0495606_0037734_1720_2418 232
579 3300046507 Ga0495606_0057780 Ga0495606_0057780_548_1246 232
580 3300046507 Ga0495606_0085902 Ga0495606_0085902_696_1394 232
581 3300046511 Ga0495608_0181797 Ga0495608_0181797_502_1200 232
582 3300046512 Ga0495610_0001861 Ga0495610_0001861_9013_9711 232
583 3300046512 Ga0495610_0007560 Ga0495610_0007560_5978_6676 232
584 3300046513 Ga0495616_0006133 Ga0495616_0006133_5842_6540 232
585 3300046513 Ga0495616_0010222 Ga0495616_0010222_3871_4569 232
586 3300046524 Ga0495648_0004657 Ga0495648_0004657_6800_7498 232
587 3300046525 Ga0495663_0026521 Ga0495663_0026521_297_995 232
588 3300046529 Ga0495652_0544982 Ga0495652_0544982_27_725 232
589 3300046538 Ga0495609_0005251 Ga0495609_0005251_5348_6046 232
590 3300046557 Ga0495622_0026339 Ga0495622_0026339_1384_2082 232
591 3300046558 Ga0495633_0000021 Ga0495633_0000021_80607_81305 232
592 3300046616 Ga0495668_0000673 Ga0495668_0000673_34440_35138 232
593 3300046616 Ga0495668_0110755 Ga0495668_0110755_64_762 232
594 3300046660 Ga0495625_0000021 Ga0495625_0000021_275184_275882 232
595 3300046660 Ga0495625_0033407 Ga0495625_0033407_2356_3054 232
596 3300046660 Ga0495625_0047911 Ga0495625_0047911_650_1348 232
597 3300046660 Ga0495625_0094724 Ga0495625_0094724_46_744 232
598 3300046663 Ga0495635_0384985 Ga0495635_0384985_77_775 232
599 3300046665 Ga0495661_0000739 Ga0495661_0000739_24868_25566 232
600 3300046665 Ga0495661_0008232 Ga0495661_0008232_1765_2463 232
601 3300046694 Ga0495649_0000009 Ga0495649_0000009_183644_184342 232
602 3300046694 Ga0495649_0023066 Ga0495649_0023066_1775_2473 232
603 3300046810 Ga0495660_0005455 Ga0495660_0005455_5003_5701 232
604 3300047323 Ga0495683_0091552 Ga0495683_0091552_312_1010 232
605 3300047443 Ga0495687_001340 Ga0495687_001340_493_1191 232
606 3300047443 Ga0495687_020359 Ga0495687_020359_485_1183 232
607 3300047446 Ga0495679_026403 Ga0495679_026403_204_902 232
608 3300047469 Ga0495673_0016437 Ga0495673_0016437_1922_2620 232
609 3300047470 Ga0495681_0047893 Ga0495681_0047893_941_1639 232
610 3300047472 Ga0495686_0041791 Ga0495686_0041791_119_817 232
611 3300047472 Ga0495686_0131215 Ga0495686_0131215_240_938 232
612 3300048925 Ga0496122_0000625 Ga0496122_0000625_23500_24198 232
613 3300048926 Ga0496123_0015827 Ga0496123_0015827_2397_3095 232
614 3300048928 Ga0496125_0100691 Ga0496125_0100691_1116_1814 232
615 3300049127 Ga0501306_000090 Ga0501306_000090_2826_3524 232
616 3300049127 Ga0501306_001514 Ga0501306_001514_94_792 232
617 3300049127 Ga0501306_003219 Ga0501306_003219_128_826 232
618 3300049127 Ga0501306_006690 Ga0501306_006690_613_1311 232
619 3300049128 Ga0501308_000241 Ga0501308_000241_500_1198 232
620 3300049128 Ga0501308_001515 Ga0501308_001515_515_1213 232
621 3300049128 Ga0501308_005994 Ga0501308_005994_296_994 232
622 3300049129 Ga0501309_001209 Ga0501309_001209_1077_1775 232
623 3300049129 Ga0501309_005559 Ga0501309_005559_117_818 232
624 3300049130 Ga0501310_000779 Ga0501310_000779_1603_2301 232
625 3300049130 Ga0501310_000916 Ga0501310_000916_967_1665 232
626 3300049130 Ga0501310_001290 Ga0501310_001290_1140_1838 232
627 3300049130 Ga0501310_004289 Ga0501310_004289_364_1062 232
628 3300049132 Ga0501343_004790 Ga0501343_004790_93_791 232
629 3300049134 Ga0501345_00892 Ga0501345_00892_212_910 232
630 3300049160 Ga0501304_000073 Ga0501304_000073_1237_1935 232
631 3300049160 Ga0501304_003896 Ga0501304_003896_49_747 232
632 3300049160 Ga0501304_007180 Ga0501304_007180_73_771 232
633 3300049161 Ga0501305_000527 Ga0501305_000527_496_1194 232
634 3300049161 Ga0501305_001549 Ga0501305_001549_930_1628 232
635 3300049161 Ga0501305_001909 Ga0501305_001909_406_1104 232
636 3300049161 Ga0501305_002800 Ga0501305_002800_596_1294 232
637 3300049161 Ga0501305_005953 Ga0501305_005953_567_1265 232
638 3300049162 Ga0501307_000427 Ga0501307_000427_570_1268 232
639 3300049162 Ga0501307_000560 Ga0501307_000560_828_1526 232
640 3300049162 Ga0501307_000602 Ga0501307_000602_856_1554 232
641 3300049162 Ga0501307_002306 Ga0501307_002306_449_1147 232
642 3300049162 Ga0501307_003893 Ga0501307_003893_139_837 232
643 3300049459 Ga0495678_041511 Ga0495678_041511_89_787 232
644 3300049516 Ga0501293_005397 Ga0501293_005397_142_840 232
645 3300049527 Ga0501311_000890 Ga0501311_000890_485_1183 232
646 3300049527 Ga0501311_001075 Ga0501311_001075_1130_1828 232
647 3300049527 Ga0501311_002484 Ga0501311_002484_428_1126 232
648 3300049528 Ga0501312_000226 Ga0501312_000226_2786_3484 232
649 3300049528 Ga0501312_000486 Ga0501312_000486_1824_2522 232
650 3300049528 Ga0501312_000493 Ga0501312_000493_571_1269 232
651 3300049528 Ga0501312_007331 Ga0501312_007331_688_1386 232
652 3300049528 Ga0501312_007957 Ga0501312_007957_107_805 232
653 3300049529 Ga0501313_000170 Ga0501313_000170_1592_2290 232
654 3300049529 Ga0501313_001041 Ga0501313_001041_406_1104 232
655 3300049529 Ga0501313_004034 Ga0501313_004034_136_834 232
656 3300049529 Ga0501313_004733 Ga0501313_004733_475_1173 232
657 3300049530 Ga0501314_000363 Ga0501314_000363_1559_2257 232
658 3300049530 Ga0501314_000485 Ga0501314_000485_1112_1810 232
659 3300049530 Ga0501314_001176 Ga0501314_001176_653_1351 232
660 3300049531 Ga0501315_000064 Ga0501315_000064_1086_1784 232
661 3300049531 Ga0501315_000281 Ga0501315_000281_585_1283 232
662 3300049531 Ga0501315_000629 Ga0501315_000629_406_1104 232
663 3300049531 Ga0501315_000715 Ga0501315_000715_1705_2403 232
664 3300049531 Ga0501315_001860 Ga0501315_001860_688_1386 232
665 3300049531 Ga0501315_002700 Ga0501315_002700_554_1252 232
666 3300049531 Ga0501315_019422 Ga0501315_019422_153_851 232
667 3300049532 Ga0501316_000593 Ga0501316_000593_1368_2066 232
668 3300049532 Ga0501316_000650 Ga0501316_000650_406_1104 232
669 3300049532 Ga0501316_005035 Ga0501316_005035_515_1213 232
670 3300049533 Ga0501317_001389 Ga0501317_001389_678_1376 232
671 3300049533 Ga0501317_003488 Ga0501317_003488_473_1171 232
672 3300049533 Ga0501317_005631 Ga0501317_005631_510_1208 232
673 3300049533 Ga0501317_005736 Ga0501317_005736_465_1163 232
674 3300049534 Ga0501318_000652 Ga0501318_000652_984_1682 232
675 3300049534 Ga0501318_001035 Ga0501318_001035_933_1631 232
676 3300049535 Ga0501319_000383 Ga0501319_000383_651_1349 232
677 3300049535 Ga0501319_000428 Ga0501319_000428_593_1291 232
678 3300049536 Ga0501320_000255 Ga0501320_000255_603_1301 232
679 3300049536 Ga0501320_000921 Ga0501320_000921_863_1561 232
680 3300049536 Ga0501320_002180 Ga0501320_002180_201_899 232
681 3300049536 Ga0501320_003081 Ga0501320_003081_123_857 232
682 3300049536 Ga0501320_005140 Ga0501320_005140_342_1040 232
683 3300049537 Ga0501321_000813 Ga0501321_000813_1142_1840 232
684 3300049537 Ga0501321_012501 Ga0501321_012501_191_889 232
685 3300049537 Ga0501321_022211 Ga0501321_022211_33_731 232
686 3300049539 Ga0501323_001783 Ga0501323_001783_579_1277 232
687 3300049540 Ga0501324_011105 Ga0501324_011105_85_783 232
688 3300049545 Ga0501329_00400 Ga0501329_00400_431_1129 232
689 3300049547 Ga0501331_01871 Ga0501331_01871_128_826 232
690 3300049551 Ga0501335_000798 Ga0501335_000798_642_1340 232
691 3300049551 Ga0501335_003543 Ga0501335_003543_606_1304 232
692 3300049551 Ga0501335_005839 Ga0501335_005839_172_870 232
693 3300049552 Ga0501336_000701 Ga0501336_000701_764_1462 232
694 3300049662 Ga0501222_006970 Ga0501222_006970_644_1342 232
695 3300049663 Ga0501223_002278 Ga0501223_002278_3118_3816 232
696 3300049665 Ga0501227_022071 Ga0501227_022071_337_1035 232
697 3300049673 Ga0501240_000074 Ga0501240_000074_962_1660 232
698 3300049674 Ga0501242_010894 Ga0501242_010894_227_925 232
699 3300049686 Ga0501257_002604 Ga0501257_002604_2153_2851 232
700 3300049686 Ga0501257_036651 Ga0501257_036651_297_995 232
701 3300049705 Ga0501225_0026515 Ga0501225_0026515_684_1382 232
702 3300049758 Ga0501241_001570 Ga0501241_001570_3217_3915 232
703 3300049761 Ga0501264_010699 Ga0501264_010699_163_861 232
704 3300050493 nmdc:mga0k408_173043_c1 nmdc:mga0k408_173043_c1_19_717 232
705 3300050493 nmdc:mga0k408_192815_c1 nmdc:mga0k408_192815_c1_127_825 232
706 3300050493 nmdc:mga0k408_350_c1 nmdc:mga0k408_350_c1_9976_10674 232
707 3300050493 nmdc:mga0k408_38765_c1 nmdc:mga0k408_38765_c1_1480_2178 232
708 3300050493 nmdc:mga0k408_4120_c1 nmdc:mga0k408_4120_c1_5487_6185 232
709 3300050496 nmdc:mga07m45_126407_c1 nmdc:mga07m45_126407_c1_435_1133 232
710 3300050496 nmdc:mga07m45_140197_c1 nmdc:mga07m45_140197_c1_362_1060 232
711 3300050496 nmdc:mga07m45_164171_c1 nmdc:mga07m45_164171_c1_58_756 232
712 3300053080 Ga0500635_0001097 Ga0500635_0001097_1628_2326 232
713 3300053093 Ga0500651_0000124 Ga0500651_0000124_16317_17015 232
714 3300053122 Ga0500608_006222 Ga0500608_006222_2576_3274 232
715 3300053123 Ga0500614_008477 Ga0500614_008477_537_1235 232
716 3300053125 Ga0500618_000080 Ga0500618_000080_34785_35483 232
717 3300053130 Ga0500642_0083553 Ga0500642_0083553_682_1380 232
718 3300053140 Ga0500573_0033087 Ga0500573_0033087_1511_2209 232
719 3300053140 Ga0500573_0225472 Ga0500573_0225472_235_936 232
720 3300053154 Ga0500619_063074 Ga0500619_063074_482_1180 232
721 3300053156 Ga0500622_0001219 Ga0500622_0001219_13817_14515 232
722 3300053161 Ga0500634_0114798 Ga0500634_0114798_349_1047 232
723 3300059477 Ga0587084_002476 Ga0587084_002476_510_1208 232
724 3300059478 Ga0587093_006246 Ga0587093_006246_141_839 232
725 3300059490 Ga0587066_003653 Ga0587066_003653_711_1409 232
726 3300059491 Ga0587070_015923 Ga0587070_015923_443_1141 232
727 3300059492 Ga0587073_0052786 Ga0587073_0052786_110_808 232
728 3300059493 Ga0587077_003067 Ga0587077_003067_538_1236 232
729 3300059505 Ga0587083_0012424 Ga0587083_0012424_105_803 232
730 3300059506 Ga0587085_003141 Ga0587085_003141_757_1455 232
731 3300059507 Ga0587086_004801 Ga0587086_004801_711_1409 232
732 3300059508 Ga0587088_011151 Ga0587088_011151_128_826 232
733 3300059510 Ga0587090_000102 Ga0587090_000102_2987_3685 232
734 3300059510 Ga0587090_001380 Ga0587090_001380_711_1409 232
735 3300059511 Ga0587091_001706 Ga0587091_001706_1040_1738 232
736 3300059607 Ga0587125_000722 Ga0587125_000722_1169_1867 232
737 3300059623 Ga0587101_004054 Ga0587101_004054_404_1102 232
738 3300059624 Ga0587109_002139 Ga0587109_002139_718_1416 232
739 3300059639 Ga0587062_000616 Ga0587062_000616_1034_1732 232
740 3300059639 Ga0587062_001829 Ga0587062_001829_510_1208 232
741 3300059640 Ga0587067_000818 Ga0587067_000818_293_991 232
742 3300059643 Ga0587072_005484 Ga0587072_005484_445_1143 232
743 3300059645 Ga0587076_000772 Ga0587076_000772_1574_2272 232
744 3300059645 Ga0587076_001127 Ga0587076_001127_544_1242 232
745 3300059645 Ga0587076_042404 Ga0587076_042404_69_767 232
746 3300059647 Ga0587079_005766 Ga0587079_005766_481_1179 232
747 3300059653 Ga0587108_000400 Ga0587108_000400_762_1460 232
748 3300060346 Ga0587111_0000072 Ga0587111_0000072_3502_4200 232
749 3300060346 Ga0587111_0006838 Ga0587111_0006838_412_1110 232
750 iso_pu_bacteria 2738541284 2738763475 232
751 iso_pu_bacteria 2852627209 2852629339 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

50

247

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vpl-assembly1.cif.gz_A the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii 0.976 3 225
2hw8-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9719 6 225
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.9675 6 225
5npm-assembly1.cif.gz_A crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus 0.9673 19 227
4v9h-assembly1.cif.gz_BC crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state 0.9673 3 225
ID Description Score Start End Superfamily
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.984 73 159 3.40.50.790
af_P9WHC7_16_229_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9805 16 225 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9749 19 232 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.973 73 159 3.40.50.790
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9727 16 225 3.30.190.20
ID Description Score Start End GO Terms
AF-A0A6B3PGT9-F1-model_v4 deleted 0.9916 1 230
AF-A0A3D0FNT0-F1-model_v4 Large ribosomal subunit protein uL1 0.9916 1 229 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A699PAG0-F1-model_v4 deleted 0.9906 7 226
AF-A0A2E6BUT7-F1-model_v4 Large ribosomal subunit protein uL1 0.9898 3 228 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A6A5LA17-F1-model_v4 deleted 0.9896 1 232

Feature Viewer

pLDDT pTM Quality
85.76 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map