F479082
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 751 | 381 | 706 | 231 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10035174|rootH1_100351742 |
| Length | 259 |
| Sequence | LRKFNSEIELPKSEIIIINLYKISFKTVARLTKNQKVALSKIEANKAYSLQDASALVKDITNTKFDSSVDIDVRLGVDPRKANQMVRGIATLPHGTGKTVRVLVLCTPDKEQEAKDAGADYVGLDDYIAKIEGGWTDVDIIITMPSVMAKVGRLGRVLGPRNLMPNPKSGTVTTEVGKAVTEVKGGKIDFKVDKTGIIHTSIXXXSFSADKIYENALEVLQTISKLKPSAAKGTYFKSIHISSTMSPGIEIETKTVAGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 4 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 5 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 6 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 7 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 8 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 9 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 10 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 11 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 12 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 13 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 14 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 15 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 16 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 17 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 18 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 19 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 20 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 21 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 22 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 23 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 24 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 25 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 26 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 27 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 28 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 29 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 30 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 31 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 32 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 33 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 34 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 35 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 36 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 37 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 38 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 39 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 40 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 41 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 42 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 43 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 44 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 45 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 46 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 47 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 48 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 49 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 50 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 51 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 52 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 53 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 54 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 56 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 57 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 58 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 59 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 60 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 61 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 62 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 63 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 64 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 66 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 68 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 69 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 70 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 71 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 72 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 73 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 74 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 75 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 80 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 91 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 136 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 201 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 202 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 203 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 204 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 205 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 206 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 213 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 240 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 241 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 242 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 243 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 244 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 246 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 249 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 250 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 251 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 252 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 262 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 295 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 333 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 340 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 344 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 345 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 347 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 349 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 350 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 351 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 353 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 354 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 62.05 |
| Metatranscriptomes | 31.96 |
| Isolates | 5.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.92 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 84.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_9405 | 2124908027 | Bacteria | 1869 |
| 2 | MBSR1b_contig_6515855 | 2162886012 | Bacteria | 1091 |
| 3 | JGI24740J21852_10015326 | 3300001979 | Bacteria | 2803 |
| 4 | JGI24739J22299_10047850 | 3300001989 | Bacteria | 1393 |
| 5 | JGI24737J22298_10000614 | 3300001990 | Bacteria | 12575 |
| 6 | JGI24737J22298_10001905 | 3300001990 | Bacteria | 7459 |
| 7 | JGI24737J22298_10003582 | 3300001990 | Bacteria | 5476 |
| 8 | JGI24737J22298_10005403 | 3300001990 | Bacteria | 4415 |
| 9 | JGI24743J22301_10020627 | 3300001991 | Bacteria | 1255 |
| 10 | JGI24735J21928_10000009 | 3300002067 | Bacteria | 247425 |
| 11 | JGI24735J21928_10021163 | 3300002067 | Bacteria | 1988 |
| 12 | JGI25162J39368_1000120 | 3300002737 | Bacteria | 86031 |
| 13 | JGI25162J39368_1001524 | 3300002737 | Bacteria | 11972 |
| 14 | JGI25157J39369_1002820 | 3300002741 | Bacteria | 3946 |
| 15 | JGI25157J39369_1004397 | 3300002741 | Bacteria | 2564 |
| 16 | JGI25164J39214_1000824 | 3300002772 | Bacteria | 10827 |
| 17 | JGI25152J39213_1000022 | 3300002773 | Bacteria | 105664 |
| 18 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 19 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 20 | JGI25165J46597_1000923 | 3300003214 | Bacteria | 20349 |
| 21 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 22 | rootH1_10025186 | 3300003316 | Bacteria | 2889 |
| 23 | rootH2_10094915 | 3300003320 | Bacteria | 1772 |
| 24 | rootH2_10133361 | 3300003320 | Bacteria | 1255 |
| 25 | rootL2_10024334 | 3300003322 | Bacteria | 1301 |
| 26 | rootL2_10051773 | 3300003322 | Bacteria | 3799 |
| 27 | rootH1_10003520 | 3300003323 | Bacteria | 6470 |
| 28 | rootH1_10035174 | 3300003323 | Bacteria | 1091 |
| 29 | rootH1_10067560 | 3300003323 | Bacteria | 2906 |
| 30 | rootH1_10081742 | 3300003323 | Bacteria | 1789 |
| 31 | rootH1_10107846 | 3300003323 | Bacteria | 1569 |
| 32 | rootH1_10144272 | 3300003323 | Bacteria | 1828 |
| 33 | Ga0032354_1069350 | 3300003693 | Bacteria | 1297 |
| 34 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 35 | Ga0055536_1013448 | 3300003781 | Bacteria | 2951 |
| 36 | Ga0055530_10008207 | 3300003791 | Bacteria | 4224 |
| 37 | Ga0058863_10005116 | 3300004799 | Bacteria | 14404 |
| 38 | Ga0058861_10088285 | 3300004800 | Bacteria | 3413 |
| 39 | Ga0058860_12228446 | 3300004801 | Bacteria | 2527 |
| 40 | Ga0058862_10247728 | 3300004803 | Bacteria | 8738 |
| 41 | Ga0065165_1002853 | 3300005262 | Bacteria | 13414 |
| 42 | Ga0065165_1007781 | 3300005262 | Bacteria | 5172 |
| 43 | Ga0065714_10005413 | 3300005288 | Bacteria | 4818 |
| 44 | Ga0065714_10007805 | 3300005288 | Bacteria | 3491 |
| 45 | Ga0065714_10009921 | 3300005288 | Bacteria | 2213 |
| 46 | Ga0065714_10083664 | 3300005288 | Bacteria | 2221 |
| 47 | Ga0065714_10087528 | 3300005288 | Bacteria | 2043 |
| 48 | Ga0065714_10118201 | 3300005288 | Bacteria | 1382 |
| 49 | Ga0065704_10000757 | 3300005289 | Bacteria | 16510 |
| 50 | Ga0065712_10251685 | 3300005290 | Bacteria | 958 |
| 51 | Ga0065715_10001084 | 3300005293 | Bacteria | 8622 |
| 52 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 53 | Ga0070658_10129449 | 3300005327 | Bacteria | 2103 |
| 54 | Ga0070676_10004106 | 3300005328 | Bacteria | 7650 |
| 55 | Ga0070683_100016707 | 3300005329 | Bacteria | 6475 |
| 56 | Ga0068869_100171345 | 3300005334 | Bacteria | 1696 |
| 57 | Ga0070682_100461467 | 3300005337 | Unclassified | 975 |
| 58 | Ga0068868_100235346 | 3300005338 | Bacteria | 1537 |
| 59 | Ga0070671_100005487 | 3300005355 | Bacteria | 10117 |
| 60 | Ga0070674_100626513 | 3300005356 | Bacteria | 912 |
| 61 | Ga0070673_100015276 | 3300005364 | Bacteria | 5387 |
| 62 | Ga0070659_100000402 | 3300005366 | Bacteria | 32771 |
| 63 | Ga0070659_100016784 | 3300005366 | Bacteria | 5501 |
| 64 | Ga0070659_100061430 | 3300005366 | Bacteria | 2969 |
| 65 | Ga0070714_100173670 | 3300005435 | Bacteria | 1957 |
| 66 | Ga0070678_100001822 | 3300005456 | Bacteria | 11482 |
| 67 | Ga0070662_100059100 | 3300005457 | Bacteria | 2792 |
| 68 | Ga0070681_10008372 | 3300005458 | Bacteria | 10130 |
| 69 | Ga0068867_100001197 | 3300005459 | Bacteria | 17799 |
| 70 | Ga0070679_100014038 | 3300005530 | Bacteria | 7681 |
| 71 | Ga0070679_100252125 | 3300005530 | Bacteria | 1721 |
| 72 | Ga0070665_100000032 | 3300005548 | Bacteria | 333352 |
| 73 | Ga0068855_100000026 | 3300005563 | Bacteria | 175140 |
| 74 | Ga0068855_100042965 | 3300005563 | Bacteria | 5355 |
| 75 | Ga0068855_100079811 | 3300005563 | Bacteria | 3794 |
| 76 | Ga0068855_100088358 | 3300005563 | Bacteria | 3580 |
| 77 | Ga0068857_100505495 | 3300005577 | Bacteria | 1135 |
| 78 | Ga0068854_100049164 | 3300005578 | Bacteria | 3011 |
| 79 | Ga0068854_100185625 | 3300005578 | Bacteria | 1627 |
| 80 | Ga0068856_100000014 | 3300005614 | Bacteria | 163480 |
| 81 | Ga0068856_100003360 | 3300005614 | Bacteria | 16215 |
| 82 | Ga0068856_100039856 | 3300005614 | Bacteria | 4612 |
| 83 | Ga0068856_100083237 | 3300005614 | Bacteria | 3177 |
| 84 | Ga0068856_100223306 | 3300005614 | Bacteria | 1899 |
| 85 | Ga0068856_100360582 | 3300005614 | Bacteria | 1472 |
| 86 | Ga0068856_101055924 | 3300005614 | Bacteria | 830 |
| 87 | Ga0068852_100001456 | 3300005616 | Bacteria | 15984 |
| 88 | Ga0068852_100501427 | 3300005616 | Bacteria | 1209 |
| 89 | Ga0068866_10152491 | 3300005718 | Bacteria | 1340 |
| 90 | Ga0068863_100205953 | 3300005841 | Bacteria | 1893 |
| 91 | Ga0075366_10068860 | 3300006195 | Bacteria | 2106 |
| 92 | Ga0075366_10105465 | 3300006195 | Bacteria | 1694 |
| 93 | Ga0075366_10186058 | 3300006195 | Bacteria | 1262 |
| 94 | Ga0097621_100000057 | 3300006237 | Bacteria | 58430 |
| 95 | Ga0097621_100431254 | 3300006237 | Bacteria | 1185 |
| 96 | Ga0075370_10099499 | 3300006353 | Bacteria | 1682 |
| 97 | Ga0068871_100000094 | 3300006358 | Bacteria | 52461 |
| 98 | Ga0068865_100000200 | 3300006881 | Bacteria | 33423 |
| 99 | Ga0105244_10020501 | 3300009036 | Bacteria | 3671 |
| 100 | Ga0105240_10067718 | 3300009093 | Bacteria | 4425 |
| 101 | Ga0105240_10111763 | 3300009093 | Bacteria | 3304 |
| 102 | Ga0105240_10129348 | 3300009093 | Bacteria | 3030 |
| 103 | Ga0105240_10332980 | 3300009093 | Bacteria | 1727 |
| 104 | Ga0105240_10429871 | 3300009093 | Bacteria | 1482 |
| 105 | Ga0105240_10616692 | 3300009093 | Bacteria | 1193 |
| 106 | Ga0111539_10159065 | 3300009094 | Bacteria | 2642 |
| 107 | Ga0105243_10000018 | 3300009148 | Bacteria | 227618 |
| 108 | Ga0105243_10380221 | 3300009148 | Bacteria | 1306 |
| 109 | Ga0105241_10019243 | 3300009174 | Bacteria | 5034 |
| 110 | Ga0105242_10040711 | 3300009176 | Bacteria | 3745 |
| 111 | Ga0105242_10505299 | 3300009176 | Bacteria | 1150 |
| 112 | Ga0105242_10595052 | 3300009176 | Bacteria | 1067 |
| 113 | Ga0105237_10001287 | 3300009545 | Bacteria | 33378 |
| 114 | Ga0105237_10001321 | 3300009545 | Bacteria | 32889 |
| 115 | Ga0105237_10012788 | 3300009545 | Bacteria | 8828 |
| 116 | Ga0105237_10060769 | 3300009545 | Bacteria | 3779 |
| 117 | Ga0105238_10003742 | 3300009551 | Bacteria | 15125 |
| 118 | Ga0105238_10097306 | 3300009551 | Bacteria | 2929 |
| 119 | Ga0105238_10781559 | 3300009551 | Bacteria | 970 |
| 120 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 121 | Ga0105239_10001363 | 3300010375 | Bacteria | 32814 |
| 122 | Ga0105239_10005053 | 3300010375 | Bacteria | 15586 |
| 123 | Ga0105239_10364930 | 3300010375 | Bacteria | 1631 |
| 124 | Ga0157373_10000448 | 3300013100 | Bacteria | 32580 |
| 125 | Ga0157373_10016881 | 3300013100 | Bacteria | 5323 |
| 126 | Ga0157373_10225466 | 3300013100 | Bacteria | 1323 |
| 127 | Ga0157371_10002095 | 3300013102 | Bacteria | 19477 |
| 128 | Ga0157371_10019347 | 3300013102 | Bacteria | 5023 |
| 129 | Ga0157371_10132755 | 3300013102 | Bacteria | 1772 |
| 130 | Ga0157371_10178349 | 3300013102 | Bacteria | 1519 |
| 131 | Ga0157371_10262802 | 3300013102 | Bacteria | 1244 |
| 132 | Ga0157370_10044584 | 3300013104 | Bacteria | 4261 |
| 133 | Ga0157370_10209085 | 3300013104 | Bacteria | 1809 |
| 134 | Ga0157370_10281686 | 3300013104 | Bacteria | 1536 |
| 135 | Ga0157370_10563883 | 3300013104 | Bacteria | 1044 |
| 136 | Ga0157369_10000478 | 3300013105 | Bacteria | 53035 |
| 137 | Ga0157369_10001799 | 3300013105 | Bacteria | 25953 |
| 138 | Ga0157369_10058386 | 3300013105 | Bacteria | 4162 |
| 139 | Ga0157369_10064414 | 3300013105 | Bacteria | 3948 |
| 140 | Ga0157369_10241115 | 3300013105 | Bacteria | 1888 |
| 141 | Ga0157369_10358700 | 3300013105 | Bacteria | 1514 |
| 142 | Ga0157374_10772124 | 3300013296 | Bacteria | 976 |
| 143 | Ga0157378_10022748 | 3300013297 | Bacteria | 5516 |
| 144 | Ga0157378_10041902 | 3300013297 | Bacteria | 4062 |
| 145 | Ga0163162_10000052 | 3300013306 | Bacteria | 112651 |
| 146 | Ga0163162_10038959 | 3300013306 | Bacteria | 4746 |
| 147 | Ga0157372_10000020 | 3300013307 | Bacteria | 208056 |
| 148 | Ga0157372_10000254 | 3300013307 | Bacteria | 59194 |
| 149 | Ga0157372_10001280 | 3300013307 | Bacteria | 27216 |
| 150 | Ga0157372_10042429 | 3300013307 | Bacteria | 5032 |
| 151 | Ga0157372_10087139 | 3300013307 | Bacteria | 3542 |
| 152 | Ga0157372_10122899 | 3300013307 | Bacteria | 2983 |
| 153 | Ga0157372_10504382 | 3300013307 | Bacteria | 1411 |
| 154 | Ga0157375_10044048 | 3300013308 | Bacteria | 4331 |
| 155 | Ga0157375_10076034 | 3300013308 | Bacteria | 3383 |
| 156 | Ga0157375_10106910 | 3300013308 | Bacteria | 2891 |
| 157 | Ga0157375_10244028 | 3300013308 | Bacteria | 1956 |
| 158 | Ga0163163_10060719 | 3300014325 | Bacteria | 3744 |
| 159 | Ga0157380_10000015 | 3300014326 | Bacteria | 129842 |
| 160 | Ga0182008_10006054 | 3300014497 | Bacteria | 6805 |
| 161 | Ga0182008_10021142 | 3300014497 | Bacteria | 3345 |
| 162 | Ga0157379_10268826 | 3300014968 | Bacteria | 1550 |
| 163 | Ga0157376_10279806 | 3300014969 | Bacteria | 1571 |
| 164 | Ga0182006_1002415 | 3300015261 | Bacteria | 10209 |
| 165 | Ga0182006_1070067 | 3300015261 | Bacteria | 1302 |
| 166 | Ga0182007_10000003 | 3300015262 | Bacteria | 548244 |
| 167 | Ga0182007_10049861 | 3300015262 | Bacteria | 1382 |
| 168 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 169 | Ga0163161_10000641 | 3300017792 | Bacteria | 27918 |
| 170 | Ga0163161_10040013 | 3300017792 | Bacteria | 3366 |
| 171 | Ga0163161_10041013 | 3300017792 | Bacteria | 3325 |
| 172 | Ga0163161_10701163 | 3300017792 | Bacteria | 843 |
| 173 | Ga0197907_10160647 | 3300020069 | Bacteria | 3064 |
| 174 | Ga0197907_10706642 | 3300020069 | Bacteria | 2159 |
| 175 | Ga0197907_10819694 | 3300020069 | Bacteria | 4207 |
| 176 | Ga0197907_10908526 | 3300020069 | Bacteria | 1876 |
| 177 | Ga0206356_10124111 | 3300020070 | Bacteria | 3100 |
| 178 | Ga0206356_11795532 | 3300020070 | Bacteria | 2420 |
| 179 | Ga0206356_11849337 | 3300020070 | Bacteria | 1449 |
| 180 | Ga0206349_1110078 | 3300020075 | Bacteria | 1260 |
| 181 | Ga0206349_1596541 | 3300020075 | Bacteria | 1951 |
| 182 | Ga0206355_1018008 | 3300020076 | Bacteria | 1812 |
| 183 | Ga0206351_10078727 | 3300020077 | Bacteria | 4984 |
| 184 | Ga0206351_10106046 | 3300020077 | Bacteria | 13123 |
| 185 | Ga0206351_10462283 | 3300020077 | Bacteria | 11313 |
| 186 | Ga0206351_10586730 | 3300020077 | Bacteria | 2505 |
| 187 | Ga0206352_10727185 | 3300020078 | Bacteria | 3045 |
| 188 | Ga0206352_11107574 | 3300020078 | Bacteria | 1831 |
| 189 | Ga0206350_10111961 | 3300020080 | Bacteria | 11279 |
| 190 | Ga0206350_10297200 | 3300020080 | Bacteria | 8943 |
| 191 | Ga0206350_10622310 | 3300020080 | Bacteria | 4443 |
| 192 | Ga0206354_10771971 | 3300020081 | Bacteria | 2472 |
| 193 | Ga0206354_10858690 | 3300020081 | Bacteria | 1022 |
| 194 | Ga0206354_11003734 | 3300020081 | Bacteria | 965 |
| 195 | Ga0206354_11089144 | 3300020081 | Bacteria | 2333 |
| 196 | Ga0206354_11204833 | 3300020081 | Bacteria | 1496 |
| 197 | Ga0206353_10132441 | 3300020082 | Bacteria | 1131 |
| 198 | Ga0206353_10698887 | 3300020082 | Bacteria | 3028 |
| 199 | Ga0206353_10800764 | 3300020082 | Bacteria | 2247 |
| 200 | Ga0206353_11125333 | 3300020082 | Bacteria | 3606 |
| 201 | Ga0206353_11187972 | 3300020082 | Bacteria | 1052 |
| 202 | Ga0154015_1073617 | 3300020610 | Bacteria | 4307 |
| 203 | Ga0154015_1153066 | 3300020610 | Bacteria | 6861 |
| 204 | Ga0154015_1236635 | 3300020610 | Bacteria | 10577 |
| 205 | Ga0213872_10048147 | 3300021361 | Bacteria | 1937 |
| 206 | Ga0224712_10000859 | 3300022467 | Bacteria | 6497 |
| 207 | Ga0224712_10005983 | 3300022467 | Bacteria | 3435 |
| 208 | Ga0224712_10006283 | 3300022467 | Bacteria | 3375 |
| 209 | Ga0224712_10014258 | 3300022467 | Bacteria | 2553 |
| 210 | Ga0207427_100236 | 3300025231 | Bacteria | 45297 |
| 211 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 212 | Ga0209437_100143 | 3300025233 | Bacteria | 164970 |
| 213 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 214 | Ga0209026_1000463 | 3300025250 | Bacteria | 31275 |
| 215 | Ga0209026_1002304 | 3300025250 | Bacteria | 7279 |
| 216 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 217 | Ga0209129_1013234 | 3300025258 | Bacteria | 1829 |
| 218 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 219 | Ga0209455_1001279 | 3300025272 | Bacteria | 11764 |
| 220 | Ga0209455_1007272 | 3300025272 | Bacteria | 3148 |
| 221 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 222 | Ga0209676_1000294 | 3300025292 | Bacteria | 101100 |
| 223 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 224 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 225 | Ga0209050_1000045 | 3300025298 | Bacteria | 388022 |
| 226 | Ga0207426_1055039 | 3300025302 | Bacteria | 1167 |
| 227 | Ga0207656_10057491 | 3300025321 | Bacteria | 1697 |
| 228 | Ga0207647_10003884 | 3300025904 | Bacteria | 11172 |
| 229 | Ga0207647_10007050 | 3300025904 | Bacteria | 8148 |
| 230 | Ga0207645_10002281 | 3300025907 | Bacteria | 15210 |
| 231 | Ga0207705_10000043 | 3300025909 | Bacteria | 181491 |
| 232 | Ga0207654_10005184 | 3300025911 | Bacteria | 6575 |
| 233 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 234 | Ga0207695_10029659 | 3300025913 | Bacteria | 6038 |
| 235 | Ga0207695_10034034 | 3300025913 | Bacteria | 5548 |
| 236 | Ga0207695_10044139 | 3300025913 | Bacteria | 4744 |
| 237 | Ga0207695_10196503 | 3300025913 | Bacteria | 1933 |
| 238 | Ga0207671_10002869 | 3300025914 | Bacteria | 17871 |
| 239 | Ga0207671_10003103 | 3300025914 | Bacteria | 16910 |
| 240 | Ga0207671_10007516 | 3300025914 | Bacteria | 9448 |
| 241 | Ga0207671_10012211 | 3300025914 | Bacteria | 6926 |
| 242 | Ga0207671_10032530 | 3300025914 | Bacteria | 3882 |
| 243 | Ga0207671_10037359 | 3300025914 | Bacteria | 3602 |
| 244 | Ga0207671_10069032 | 3300025914 | Bacteria | 2635 |
| 245 | Ga0207657_10091410 | 3300025919 | Bacteria | 2538 |
| 246 | Ga0207652_10027983 | 3300025921 | Bacteria | 4701 |
| 247 | Ga0207694_10022814 | 3300025924 | Bacteria | 4747 |
| 248 | Ga0207690_10000365 | 3300025932 | Bacteria | 30004 |
| 249 | Ga0207690_10037427 | 3300025932 | Bacteria | 3150 |
| 250 | Ga0207706_10000057 | 3300025933 | Bacteria | 112805 |
| 251 | Ga0207706_10169742 | 3300025933 | Bacteria | 1917 |
| 252 | Ga0207686_10007982 | 3300025934 | Bacteria | 5706 |
| 253 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 254 | Ga0207669_10136118 | 3300025937 | Bacteria | 1697 |
| 255 | Ga0207704_10000052 | 3300025938 | Bacteria | 80866 |
| 256 | Ga0207665_10301290 | 3300025939 | Bacteria | 1198 |
| 257 | Ga0207665_10334263 | 3300025939 | Bacteria | 1140 |
| 258 | Ga0207689_10080823 | 3300025942 | Bacteria | 2672 |
| 259 | Ga0207661_10010757 | 3300025944 | Bacteria | 6597 |
| 260 | Ga0207667_10000022 | 3300025949 | Bacteria | 369570 |
| 261 | Ga0207667_10001325 | 3300025949 | Bacteria | 31070 |
| 262 | Ga0207667_10012833 | 3300025949 | Bacteria | 9627 |
| 263 | Ga0207667_10073046 | 3300025949 | Bacteria | 3565 |
| 264 | Ga0207667_10236032 | 3300025949 | Bacteria | 1872 |
| 265 | Ga0207651_10027165 | 3300025960 | Bacteria | 3590 |
| 266 | Ga0207640_10033694 | 3300025981 | Bacteria | 3189 |
| 267 | Ga0207658_10500098 | 3300025986 | Bacteria | 1083 |
| 268 | Ga0207677_10091392 | 3300026023 | Bacteria | 2214 |
| 269 | Ga0207703_10031399 | 3300026035 | Bacteria | 4200 |
| 270 | Ga0207639_10140200 | 3300026041 | Bacteria | 2013 |
| 271 | Ga0207678_10032515 | 3300026067 | Bacteria | 4546 |
| 272 | Ga0207708_10377458 | 3300026075 | Bacteria | 1168 |
| 273 | Ga0207702_10000036 | 3300026078 | Bacteria | 154106 |
| 274 | Ga0207702_10034672 | 3300026078 | Bacteria | 4220 |
| 275 | Ga0207702_10063299 | 3300026078 | Bacteria | 3162 |
| 276 | Ga0207702_10098980 | 3300026078 | Bacteria | 2570 |
| 277 | Ga0207702_10314486 | 3300026078 | Bacteria | 1490 |
| 278 | Ga0207702_10425580 | 3300026078 | Bacteria | 1285 |
| 279 | Ga0207641_10535181 | 3300026088 | Bacteria | 1141 |
| 280 | Ga0207648_10002788 | 3300026089 | Bacteria | 18537 |
| 281 | Ga0207676_10409747 | 3300026095 | Bacteria | 1269 |
| 282 | Ga0207683_10010796 | 3300026121 | Bacteria | 7788 |
| 283 | Ga0207698_10005473 | 3300026142 | Bacteria | 7852 |
| 284 | Ga0207698_10732621 | 3300026142 | Bacteria | 986 |
| 285 | Ga0207428_10571149 | 3300027907 | Bacteria | 817 |
| 286 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 287 | Ga0268264_10467476 | 3300028381 | Bacteria | 1225 |
| 288 | Ga0265334_10036858 | 3300028573 | Bacteria | 1930 |
| 289 | Ga0265323_10000038 | 3300028653 | Bacteria | 70544 |
| 290 | Ga0265323_10015327 | 3300028653 | Unclassified | 3018 |
| 291 | Ga0265322_10007311 | 3300028654 | Bacteria | 3231 |
| 292 | Ga0265322_10091967 | 3300028654 | Bacteria | 862 |
| 293 | Ga0307517_10006168 | 3300028786 | Bacteria | 17856 |
| 294 | Ga0307515_10049612 | 3300028794 | Bacteria | 6307 |
| 295 | Ga0307515_10244807 | 3300028794 | Bacteria | 1556 |
| 296 | Ga0265338_10049114 | 3300028800 | Bacteria | 3829 |
| 297 | Ga0265338_10071330 | 3300028800 | Bacteria | 2973 |
| 298 | Ga0265324_10031804 | 3300029957 | Bacteria | 1847 |
| 299 | Ga0316177_1003967 | 3300030731 | Bacteria | 16835 |
| 300 | Ga0316176_1151771 | 3300030732 | Bacteria | 9599 |
| 301 | Ga0314311_1080887 | 3300030733 | Bacteria | 2510 |
| 302 | Ga0316183_1095896 | 3300030742 | Bacteria | 133299 |
| 303 | Ga0316181_1088295 | 3300030744 | Bacteria | 6327 |
| 304 | Ga0316181_1201818 | 3300030744 | Bacteria | 1920 |
| 305 | Ga0316181_1282363 | 3300030744 | Bacteria | 2852 |
| 306 | Ga0316182_1171482 | 3300030745 | Bacteria | 4017 |
| 307 | Ga0265330_10172809 | 3300031235 | Bacteria | 916 |
| 308 | Ga0265327_10017918 | 3300031251 | Bacteria | 4417 |
| 309 | Ga0265327_10101179 | 3300031251 | Bacteria | 1390 |
| 310 | Ga0265316_10000481 | 3300031344 | Bacteria | 45334 |
| 311 | Ga0265316_10002116 | 3300031344 | Bacteria | 20863 |
| 312 | Ga0265316_10151822 | 3300031344 | Bacteria | 1735 |
| 313 | Ga0307509_10007266 | 3300031507 | Bacteria | 14552 |
| 314 | Ga0307509_10101371 | 3300031507 | Bacteria | 2914 |
| 315 | Ga0307509_10101439 | 3300031507 | Bacteria | 2913 |
| 316 | Ga0307408_100000321 | 3300031548 | Bacteria | 45938 |
| 317 | Ga0307408_100037589 | 3300031548 | Bacteria | 3411 |
| 318 | Ga0307408_100070397 | 3300031548 | Bacteria | 2582 |
| 319 | Ga0307408_100605987 | 3300031548 | Bacteria | 974 |
| 320 | Ga0265342_10065670 | 3300031712 | Bacteria | 2126 |
| 321 | Ga0316576_10017290 | 3300031727 | Bacteria | 4895 |
| 322 | Ga0316576_10050475 | 3300031727 | Bacteria | 3026 |
| 323 | Ga0316576_10096258 | 3300031727 | Bacteria | 2209 |
| 324 | Ga0316576_10176452 | 3300031727 | Bacteria | 1612 |
| 325 | Ga0316578_10084147 | 3300031728 | Bacteria | 1895 |
| 326 | Ga0307405_10000003 | 3300031731 | Bacteria | 569064 |
| 327 | Ga0307405_10001399 | 3300031731 | Bacteria | 10145 |
| 328 | Ga0307405_10036088 | 3300031731 | Bacteria | 2959 |
| 329 | Ga0307405_10308938 | 3300031731 | Bacteria | 1203 |
| 330 | Ga0316577_10003141 | 3300031733 | Bacteria | 8302 |
| 331 | Ga0307413_10173165 | 3300031824 | Bacteria | 1530 |
| 332 | Ga0307406_10395533 | 3300031901 | Bacteria | 1094 |
| 333 | Ga0307407_10000030 | 3300031903 | Bacteria | 97416 |
| 334 | Ga0307412_10000065 | 3300031911 | Bacteria | 122279 |
| 335 | Ga0307412_10000925 | 3300031911 | Bacteria | 16779 |
| 336 | Ga0307412_10336902 | 3300031911 | Bacteria | 1206 |
| 337 | Ga0307412_10466574 | 3300031911 | Bacteria | 1044 |
| 338 | Ga0307412_10539410 | 3300031911 | Bacteria | 978 |
| 339 | Ga0307409_100266165 | 3300031995 | Bacteria | 1576 |
| 340 | Ga0307416_100000014 | 3300032002 | Bacteria | 249053 |
| 341 | Ga0307416_100000800 | 3300032002 | Bacteria | 16562 |
| 342 | Ga0307416_100504653 | 3300032002 | Bacteria | 1275 |
| 343 | Ga0307414_10000069 | 3300032004 | Bacteria | 98243 |
| 344 | Ga0307414_10007780 | 3300032004 | Bacteria | 6041 |
| 345 | Ga0307414_10010548 | 3300032004 | Bacteria | 5369 |
| 346 | Ga0307414_10167193 | 3300032004 | Bacteria | 1754 |
| 347 | Ga0307414_10348866 | 3300032004 | Bacteria | 1269 |
| 348 | Ga0307414_10481940 | 3300032004 | Bacteria | 1094 |
| 349 | Ga0307414_10507110 | 3300032004 | Bacteria | 1068 |
| 350 | Ga0307414_10514247 | 3300032004 | Bacteria | 1061 |
| 351 | Ga0307414_10691375 | 3300032004 | Bacteria | 923 |
| 352 | Ga0307414_10849893 | 3300032004 | Bacteria | 834 |
| 353 | Ga0307411_10271759 | 3300032005 | Bacteria | 1344 |
| 354 | Ga0316593_10000093 | 3300032168 | Bacteria | 11368 |
| 355 | Ga0316593_10000991 | 3300032168 | Bacteria | 5875 |
| 356 | Ga0316593_10005401 | 3300032168 | Bacteria | 3366 |
| 357 | Ga0316593_10009431 | 3300032168 | Bacteria | 2755 |
| 358 | Ga0316593_10017950 | 3300032168 | Bacteria | 2166 |
| 359 | Ga0316593_10019182 | 3300032168 | Bacteria | 2111 |
| 360 | Ga0316593_10020305 | 3300032168 | Bacteria | 2064 |
| 361 | Ga0316593_10023475 | 3300032168 | Bacteria | 1946 |
| 362 | Ga0316593_10045675 | 3300032168 | Bacteria | 1468 |
| 363 | Ga0316593_10053466 | 3300032168 | Bacteria | 1368 |
| 364 | Ga0316593_10061455 | 3300032168 | Bacteria | 1285 |
| 365 | Ga0307507_10000032 | 3300033179 | Bacteria | 194155 |
| 366 | Ga0316592_1003224 | 3300033524 | Bacteria | 2915 |
| 367 | Ga0316592_1003832 | 3300033524 | Bacteria | 2756 |
| 368 | Ga0316592_1008924 | 3300033524 | Bacteria | 1996 |
| 369 | Ga0316592_1018891 | 3300033524 | Bacteria | 1455 |
| 370 | Ga0316592_1019564 | 3300033524 | Bacteria | 1432 |
| 371 | Ga0316592_1068743 | 3300033524 | Bacteria | 800 |
| 372 | Ga0316588_1035028 | 3300033528 | Bacteria | 1188 |
| 373 | Ga0316588_1042483 | 3300033528 | Bacteria | 1089 |
| 374 | Ga0316588_1043695 | 3300033528 | Bacteria | 1076 |
| 375 | Ga0316596_1000366 | 3300033541 | Bacteria | 7418 |
| 376 | Ga0316596_1002234 | 3300033541 | Bacteria | 4104 |
| 377 | Ga0316596_1003917 | 3300033541 | Bacteria | 3299 |
| 378 | Ga0316596_1007933 | 3300033541 | Bacteria | 2518 |
| 379 | Ga0316596_1008124 | 3300033541 | Bacteria | 2495 |
| 380 | Ga0316596_1008922 | 3300033541 | Bacteria | 2399 |
| 381 | Ga0316596_1013705 | 3300033541 | Bacteria | 2004 |
| 382 | Ga0316596_1014553 | 3300033541 | Bacteria | 1952 |
| 383 | Ga0316596_1015998 | 3300033541 | Bacteria | 1876 |
| 384 | Ga0316596_1016243 | 3300033541 | Bacteria | 1863 |
| 385 | Ga0316596_1016474 | 3300033541 | Bacteria | 1852 |
| 386 | Ga0316596_1022724 | 3300033541 | Bacteria | 1604 |
| 387 | Ga0316596_1027440 | 3300033541 | Bacteria | 1469 |
| 388 | Ga0316596_1033701 | 3300033541 | Bacteria | 1335 |
| 389 | Ga0316596_1037265 | 3300033541 | Bacteria | 1272 |
| 390 | Ga0316596_1046705 | 3300033541 | Bacteria | 1144 |
| 391 | Ga0316596_1072077 | 3300033541 | Bacteria | 925 |
| 392 | Ga0316574_0014181 | 3300035398 | Bacteria | 4597 |
| 393 | Ga0316574_0125607 | 3300035398 | Bacteria | 1649 |
| 394 | Ga0373927_0150435 | 3300035695 | Bacteria | 1524 |
| 395 | Ga0265778_001249 | 3300036457 | Bacteria | 2277 |
| 396 | Ga0316582_0035511 | 3300036647 | Bacteria | 3079 |
| 397 | Ga0316584_0000096 | 3300036712 | Bacteria | 35816 |
| 398 | Ga0316584_0028358 | 3300036712 | Bacteria | 4128 |
| 399 | Ga0316584_0036531 | 3300036712 | Bacteria | 3646 |
| 400 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 401 | Ga0395899_0000061 | 3300037312 | Bacteria | 212002 |
| 402 | Ga0395899_0000459 | 3300037312 | Bacteria | 46222 |
| 403 | Ga0395899_0012421 | 3300037312 | Bacteria | 6524 |
| 404 | Ga0395899_0046276 | 3300037312 | Bacteria | 3241 |
| 405 | Ga0395900_0000143 | 3300037418 | Bacteria | 120234 |
| 406 | Ga0395900_0000284 | 3300037418 | Bacteria | 75852 |
| 407 | Ga0395900_0716555 | 3300037418 | Bacteria | 933 |
| 408 | Ga0395898_0049674 | 3300037466 | Bacteria | 4109 |
| 409 | Ga0395898_0059816 | 3300037466 | Bacteria | 3705 |
| 410 | Ga0395905_0000011 | 3300037471 | Bacteria | 424563 |
| 411 | Ga0395905_0000045 | 3300037471 | Bacteria | 241370 |
| 412 | Ga0395905_0001507 | 3300037471 | Bacteria | 27862 |
| 413 | Ga0395905_0003630 | 3300037471 | Bacteria | 16393 |
| 414 | Ga0395901_0000976 | 3300038443 | Bacteria | 31051 |
| 415 | Ga0395901_0003957 | 3300038443 | Bacteria | 14901 |
| 416 | Ga0395901_0056763 | 3300038443 | Bacteria | 4073 |
| 417 | Ga0395901_0213352 | 3300038443 | Bacteria | 2020 |
| 418 | Ga0395901_0237197 | 3300038443 | Bacteria | 1903 |
| 419 | Ga0400489_23224 | 3300039093 | Bacteria | 1319 |
| 420 | Ga0400487_14420 | 3300039110 | Bacteria | 1113 |
| 421 | Ga0436361_0285047 | 3300039447 | Bacteria | 6372 |
| 422 | Ga0451790_02189 | 3300041444 | Bacteria | 1789 |
| 423 | Ga0451790_30578 | 3300041444 | Bacteria | 962 |
| 424 | Ga0451794_27951 | 3300041446 | Bacteria | 1260 |
| 425 | Ga0451807_1843265 | 3300041486 | Bacteria | 1171 |
| 426 | Ga0451837_1311701 | 3300041494 | Bacteria | 1305 |
| 427 | Ga0451854_21462 | 3300041510 | Bacteria | 1378 |
| 428 | Ga0451853_3267999 | 3300041512 | Bacteria | 1058 |
| 429 | Ga0452268_22974 | 3300041907 | Bacteria | 1124 |
| 430 | Ga0439448_0007567 | 3300042005 | Bacteria | 3153 |
| 431 | Ga0439449_0050505 | 3300042007 | Bacteria | 1539 |
| 432 | Ga0439452_019002 | 3300042010 | Bacteria | 1823 |
| 433 | Ga0439457_009023 | 3300042014 | Bacteria | 2332 |
| 434 | Ga0451577_0001856 | 3300042876 | Bacteria | 26925 |
| 435 | Ga0451577_0022661 | 3300042876 | Bacteria | 5734 |
| 436 | Ga0451577_0091907 | 3300042876 | Bacteria | 2709 |
| 437 | Ga0453683_0245770 | 3300044673 | Bacteria | 1140 |
| 438 | Ga0466966_0003065 | 3300044684 | Bacteria | 11018 |
| 439 | Ga0466961_0031179 | 3300044693 | Bacteria | 3427 |
| 440 | Ga0453684_0000413 | 3300044712 | Bacteria | 174924 |
| 441 | Ga0453684_0001891 | 3300044712 | Bacteria | 54349 |
| 442 | Ga0453684_0002943 | 3300044712 | Bacteria | 39941 |
| 443 | Ga0453684_0006165 | 3300044712 | Bacteria | 23060 |
| 444 | Ga0453684_0007249 | 3300044712 | Bacteria | 20528 |
| 445 | Ga0453684_0013926 | 3300044712 | Bacteria | 12969 |
| 446 | Ga0453684_0024439 | 3300044712 | Bacteria | 8830 |
| 447 | Ga0453684_0043847 | 3300044712 | Bacteria | 6002 |
| 448 | Ga0453684_0375729 | 3300044712 | Bacteria | 1597 |
| 449 | Ga0453684_0425574 | 3300044712 | Bacteria | 1482 |
| 450 | Ga0466968_0094163 | 3300044735 | Bacteria | 1331 |
| 451 | Ga0466959_0038507 | 3300045049 | Bacteria | 3534 |
| 452 | Ga0451576_0000003 | 3300045051 | Bacteria | 1550573 |
| 453 | Ga0451576_0005986 | 3300045051 | Bacteria | 15039 |
| 454 | Ga0451576_0006577 | 3300045051 | Bacteria | 14217 |
| 455 | Ga0451576_0022593 | 3300045051 | Bacteria | 6819 |
| 456 | Ga0451576_0161739 | 3300045051 | Bacteria | 2337 |
| 457 | Ga0451576_0178682 | 3300045051 | Bacteria | 2216 |
| 458 | Ga0451576_0608818 | 3300045051 | Bacteria | 1148 |
| 459 | Ga0466958_0017929 | 3300045836 | Bacteria | 4102 |
| 460 | Ga0495627_098218 | 3300046453 | Bacteria | 838 |
| 461 | Ga0495651_0032684 | 3300046462 | Bacteria | 4057 |
| 462 | Ga0495653_0150461 | 3300046463 | Bacteria | 1627 |
| 463 | Ga0495650_0000594 | 3300046471 | Bacteria | 49931 |
| 464 | Ga0495650_0032661 | 3300046471 | Bacteria | 2326 |
| 465 | Ga0495585_0003458 | 3300046492 | Bacteria | 10667 |
| 466 | Ga0495585_0004171 | 3300046492 | Bacteria | 9440 |
| 467 | Ga0495596_0015612 | 3300046500 | Bacteria | 3174 |
| 468 | Ga0495583_0028887 | 3300046506 | Bacteria | 2720 |
| 469 | Ga0495583_0039788 | 3300046506 | Bacteria | 2212 |
| 470 | Ga0495606_0027164 | 3300046507 | Bacteria | 4064 |
| 471 | Ga0495606_0037734 | 3300046507 | Bacteria | 3278 |
| 472 | Ga0495606_0057780 | 3300046507 | Bacteria | 2497 |
| 473 | Ga0495606_0085902 | 3300046507 | Bacteria | 1945 |
| 474 | Ga0495608_0181797 | 3300046511 | Bacteria | 1330 |
| 475 | Ga0495610_0001861 | 3300046512 | Bacteria | 18285 |
| 476 | Ga0495610_0007560 | 3300046512 | Bacteria | 7198 |
| 477 | Ga0495610_0143679 | 3300046512 | Bacteria | 1024 |
| 478 | Ga0495616_0006133 | 3300046513 | Bacteria | 7319 |
| 479 | Ga0495616_0010222 | 3300046513 | Bacteria | 5443 |
| 480 | Ga0495631_0158212 | 3300046518 | Bacteria | 972 |
| 481 | Ga0495644_0005315 | 3300046523 | Bacteria | 5029 |
| 482 | Ga0495648_0004657 | 3300046524 | Bacteria | 11632 |
| 483 | Ga0495663_0026521 | 3300046525 | Bacteria | 1697 |
| 484 | Ga0495652_0544982 | 3300046529 | Bacteria | 798 |
| 485 | Ga0495609_0005251 | 3300046538 | Bacteria | 6875 |
| 486 | Ga0495622_0026339 | 3300046557 | Bacteria | 2716 |
| 487 | Ga0495633_0000021 | 3300046558 | Bacteria | 227171 |
| 488 | Ga0495668_0000673 | 3300046616 | Bacteria | 41193 |
| 489 | Ga0495668_0110755 | 3300046616 | Bacteria | 1502 |
| 490 | Ga0495625_0000021 | 3300046660 | Bacteria | 282133 |
| 491 | Ga0495625_0033407 | 3300046660 | Bacteria | 3805 |
| 492 | Ga0495625_0047911 | 3300046660 | Bacteria | 3080 |
| 493 | Ga0495625_0094724 | 3300046660 | Bacteria | 2059 |
| 494 | Ga0495635_0384985 | 3300046663 | Bacteria | 933 |
| 495 | Ga0495661_0000739 | 3300046665 | Bacteria | 31861 |
| 496 | Ga0495661_0008232 | 3300046665 | Bacteria | 7223 |
| 497 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 498 | Ga0495649_0023066 | 3300046694 | Bacteria | 3477 |
| 499 | Ga0495660_0005455 | 3300046810 | Bacteria | 7616 |
| 500 | Ga0495683_0091552 | 3300047323 | Bacteria | 1473 |
| 501 | Ga0495687_001340 | 3300047443 | Bacteria | 22938 |
| 502 | Ga0495687_020359 | 3300047443 | Bacteria | 3233 |
| 503 | Ga0495679_026403 | 3300047446 | Bacteria | 1929 |
| 504 | Ga0495685_023166 | 3300047447 | Bacteria | 2137 |
| 505 | Ga0495673_0016437 | 3300047469 | Bacteria | 3783 |
| 506 | Ga0495681_0047893 | 3300047470 | Bacteria | 2031 |
| 507 | Ga0495686_0041791 | 3300047472 | Bacteria | 2918 |
| 508 | Ga0495686_0131215 | 3300047472 | Bacteria | 1485 |
| 509 | Ga0496116_0005208 | 3300048919 | Bacteria | 12179 |
| 510 | Ga0496117_0015077 | 3300048920 | Bacteria | 6618 |
| 511 | Ga0496122_0000625 | 3300048925 | Bacteria | 72309 |
| 512 | Ga0496122_0032264 | 3300048925 | Bacteria | 4335 |
| 513 | Ga0496123_0015827 | 3300048926 | Bacteria | 6161 |
| 514 | Ga0496123_0016547 | 3300048926 | Bacteria | 5980 |
| 515 | Ga0496124_0197845 | 3300048927 | Bacteria | 1531 |
| 516 | Ga0496125_0065617 | 3300048928 | Bacteria | 2874 |
| 517 | Ga0496125_0100691 | 3300048928 | Bacteria | 2129 |
| 518 | Ga0501306_000090 | 3300049127 | Bacteria | 4994 |
| 519 | Ga0501306_001514 | 3300049127 | Bacteria | 2212 |
| 520 | Ga0501306_003219 | 3300049127 | Bacteria | 1743 |
| 521 | Ga0501306_003286 | 3300049127 | Bacteria | 1731 |
| 522 | Ga0501306_006690 | 3300049127 | Bacteria | 1361 |
| 523 | Ga0501308_000241 | 3300049128 | Bacteria | 3184 |
| 524 | Ga0501308_001515 | 3300049128 | Bacteria | 1877 |
| 525 | Ga0501308_003504 | 3300049128 | Bacteria | 1456 |
| 526 | Ga0501308_005994 | 3300049128 | Bacteria | 1231 |
| 527 | Ga0501309_001209 | 3300049129 | Bacteria | 2455 |
| 528 | Ga0501309_005559 | 3300049129 | Bacteria | 1507 |
| 529 | Ga0501309_006960 | 3300049129 | Bacteria | 1391 |
| 530 | Ga0501309_013494 | 3300049129 | Bacteria | 1087 |
| 531 | Ga0501310_000779 | 3300049130 | Bacteria | 2826 |
| 532 | Ga0501310_000916 | 3300049130 | Bacteria | 2624 |
| 533 | Ga0501310_001290 | 3300049130 | Bacteria | 2254 |
| 534 | Ga0501310_004289 | 3300049130 | Bacteria | 1427 |
| 535 | Ga0501310_005932 | 3300049130 | Bacteria | 1266 |
| 536 | Ga0501343_003622 | 3300049132 | Bacteria | 1142 |
| 537 | Ga0501343_004790 | 3300049132 | Bacteria | 1024 |
| 538 | Ga0501345_00892 | 3300049134 | Bacteria | 1081 |
| 539 | Ga0501304_000073 | 3300049160 | Bacteria | 3490 |
| 540 | Ga0501304_003896 | 3300049160 | Bacteria | 1113 |
| 541 | Ga0501304_004832 | 3300049160 | Bacteria | 1035 |
| 542 | Ga0501304_007180 | 3300049160 | Bacteria | 914 |
| 543 | Ga0501305_000527 | 3300049161 | Bacteria | 3182 |
| 544 | Ga0501305_000794 | 3300049161 | Bacteria | 2794 |
| 545 | Ga0501305_001549 | 3300049161 | Bacteria | 2277 |
| 546 | Ga0501305_001909 | 3300049161 | Bacteria | 2150 |
| 547 | Ga0501305_002509 | 3300049161 | Bacteria | 1990 |
| 548 | Ga0501305_002800 | 3300049161 | Bacteria | 1920 |
| 549 | Ga0501305_005953 | 3300049161 | Bacteria | 1499 |
| 550 | Ga0501307_000427 | 3300049162 | Bacteria | 2816 |
| 551 | Ga0501307_000560 | 3300049162 | Bacteria | 2636 |
| 552 | Ga0501307_000602 | 3300049162 | Bacteria | 2573 |
| 553 | Ga0501307_000909 | 3300049162 | Bacteria | 2272 |
| 554 | Ga0501307_002306 | 3300049162 | Bacteria | 1760 |
| 555 | Ga0501307_003893 | 3300049162 | Bacteria | 1493 |
| 556 | Ga0495678_041511 | 3300049459 | Bacteria | 1840 |
| 557 | Ga0501293_005397 | 3300049516 | Bacteria | 1026 |
| 558 | Ga0501311_000833 | 3300049527 | Bacteria | 2405 |
| 559 | Ga0501311_000890 | 3300049527 | Bacteria | 2359 |
| 560 | Ga0501311_001075 | 3300049527 | Bacteria | 2252 |
| 561 | Ga0501311_002484 | 3300049527 | Bacteria | 1772 |
| 562 | Ga0501312_000226 | 3300049528 | Bacteria | 4004 |
| 563 | Ga0501312_000486 | 3300049528 | Bacteria | 3226 |
| 564 | Ga0501312_000493 | 3300049528 | Bacteria | 3219 |
| 565 | Ga0501312_007331 | 3300049528 | Bacteria | 1402 |
| 566 | Ga0501312_007409 | 3300049528 | Bacteria | 1398 |
| 567 | Ga0501312_007957 | 3300049528 | Bacteria | 1364 |
| 568 | Ga0501312_025010 | 3300049528 | Bacteria | 908 |
| 569 | Ga0501312_039133 | 3300049528 | Bacteria | 770 |
| 570 | Ga0501313_000170 | 3300049529 | Bacteria | 3613 |
| 571 | Ga0501313_000829 | 3300049529 | Bacteria | 2374 |
| 572 | Ga0501313_001041 | 3300049529 | Bacteria | 2239 |
| 573 | Ga0501313_004034 | 3300049529 | Bacteria | 1492 |
| 574 | Ga0501313_004733 | 3300049529 | Bacteria | 1411 |
| 575 | Ga0501314_000363 | 3300049530 | Bacteria | 2733 |
| 576 | Ga0501314_000485 | 3300049530 | Bacteria | 2490 |
| 577 | Ga0501314_001176 | 3300049530 | Bacteria | 1845 |
| 578 | Ga0501315_000064 | 3300049531 | Bacteria | 4778 |
| 579 | Ga0501315_000281 | 3300049531 | Bacteria | 3269 |
| 580 | Ga0501315_000629 | 3300049531 | Bacteria | 2561 |
| 581 | Ga0501315_000715 | 3300049531 | Bacteria | 2460 |
| 582 | Ga0501315_001860 | 3300049531 | Bacteria | 1890 |
| 583 | Ga0501315_002700 | 3300049531 | Bacteria | 1702 |
| 584 | Ga0501315_009283 | 3300049531 | Bacteria | 1160 |
| 585 | Ga0501315_019422 | 3300049531 | Bacteria | 904 |
| 586 | Ga0501315_035605 | 3300049531 | Bacteria | 735 |
| 587 | Ga0501316_000593 | 3300049532 | Bacteria | 2609 |
| 588 | Ga0501316_000650 | 3300049532 | Bacteria | 2551 |
| 589 | Ga0501316_005035 | 3300049532 | Bacteria | 1355 |
| 590 | Ga0501316_013778 | 3300049532 | Bacteria | 958 |
| 591 | Ga0501316_017170 | 3300049532 | Bacteria | 886 |
| 592 | Ga0501317_001389 | 3300049533 | Bacteria | 2081 |
| 593 | Ga0501317_003488 | 3300049533 | Bacteria | 1573 |
| 594 | Ga0501317_005631 | 3300049533 | Bacteria | 1350 |
| 595 | Ga0501317_005736 | 3300049533 | Bacteria | 1341 |
| 596 | Ga0501318_000652 | 3300049534 | Bacteria | 2335 |
| 597 | Ga0501318_001035 | 3300049534 | Bacteria | 2047 |
| 598 | Ga0501319_000383 | 3300049535 | Bacteria | 2045 |
| 599 | Ga0501319_000428 | 3300049535 | Bacteria | 1988 |
| 600 | Ga0501319_005309 | 3300049535 | Bacteria | 921 |
| 601 | Ga0501320_000255 | 3300049536 | Bacteria | 2836 |
| 602 | Ga0501320_000921 | 3300049536 | Bacteria | 1949 |
| 603 | Ga0501320_002180 | 3300049536 | Bacteria | 1542 |
| 604 | Ga0501320_002635 | 3300049536 | Bacteria | 1452 |
| 605 | Ga0501320_003081 | 3300049536 | Bacteria | 1387 |
| 606 | Ga0501320_005140 | 3300049536 | Bacteria | 1182 |
| 607 | Ga0501321_000813 | 3300049537 | Bacteria | 2228 |
| 608 | Ga0501321_000939 | 3300049537 | Bacteria | 2130 |
| 609 | Ga0501321_001995 | 3300049537 | Bacteria | 1713 |
| 610 | Ga0501321_012501 | 3300049537 | Bacteria | 962 |
| 611 | Ga0501321_022211 | 3300049537 | Bacteria | 797 |
| 612 | Ga0501323_001783 | 3300049539 | Bacteria | 1983 |
| 613 | Ga0501323_002326 | 3300049539 | Bacteria | 1829 |
| 614 | Ga0501323_004429 | 3300049539 | Bacteria | 1486 |
| 615 | Ga0501323_012675 | 3300049539 | Bacteria | 1032 |
| 616 | Ga0501324_004922 | 3300049540 | Bacteria | 1080 |
| 617 | Ga0501324_011105 | 3300049540 | Bacteria | 829 |
| 618 | Ga0501325_003222 | 3300049541 | Bacteria | 1175 |
| 619 | Ga0501325_014404 | 3300049541 | Bacteria | 769 |
| 620 | Ga0501329_00400 | 3300049545 | Bacteria | 1491 |
| 621 | Ga0501330_003862 | 3300049546 | Bacteria | 912 |
| 622 | Ga0501331_01871 | 3300049547 | Bacteria | 1064 |
| 623 | Ga0501333_000591 | 3300049549 | Bacteria | 1729 |
| 624 | Ga0501335_000798 | 3300049551 | Bacteria | 2199 |
| 625 | Ga0501335_003543 | 3300049551 | Bacteria | 1327 |
| 626 | Ga0501335_005839 | 3300049551 | Bacteria | 1108 |
| 627 | Ga0501335_005857 | 3300049551 | Bacteria | 1106 |
| 628 | Ga0501336_000444 | 3300049552 | Bacteria | 2044 |
| 629 | Ga0501336_000701 | 3300049552 | Bacteria | 1777 |
| 630 | Ga0501031_0071900 | 3300049568 | Bacteria | 2252 |
| 631 | Ga0501222_006970 | 3300049662 | Bacteria | 1514 |
| 632 | Ga0501223_002278 | 3300049663 | Bacteria | 4288 |
| 633 | Ga0501227_022071 | 3300049665 | Bacteria | 1471 |
| 634 | Ga0501240_000074 | 3300049673 | Bacteria | 6037 |
| 635 | Ga0501242_010894 | 3300049674 | Bacteria | 1091 |
| 636 | Ga0501257_002604 | 3300049686 | Bacteria | 3803 |
| 637 | Ga0501257_036651 | 3300049686 | Bacteria | 1195 |
| 638 | Ga0501225_0026515 | 3300049705 | Bacteria | 1593 |
| 639 | Ga0501241_001570 | 3300049758 | Bacteria | 4587 |
| 640 | Ga0501264_010699 | 3300049761 | Bacteria | 885 |
| 641 | nmdc:mga0k408_173043_c1 | 3300050493 | Bacteria | 1287 |
| 642 | nmdc:mga0k408_192815_c1 | 3300050493 | Bacteria | 1216 |
| 643 | nmdc:mga0k408_350_c1 | 3300050493 | Bacteria | 25267 |
| 644 | nmdc:mga0k408_38765_c1 | 3300050493 | Bacteria | 2736 |
| 645 | nmdc:mga0k408_4120_c1 | 3300050493 | Bacteria | 7721 |
| 646 | nmdc:mga07m45_126407_c1 | 3300050496 | Bacteria | 1478 |
| 647 | nmdc:mga07m45_140197_c1 | 3300050496 | Bacteria | 1400 |
| 648 | nmdc:mga07m45_164171_c1 | 3300050496 | Bacteria | 1290 |
| 649 | Ga0500635_0001097 | 3300053080 | Bacteria | 6481 |
| 650 | Ga0500651_0000124 | 3300053093 | Bacteria | 47212 |
| 651 | Ga0500608_006222 | 3300053122 | Bacteria | 4839 |
| 652 | Ga0500614_008477 | 3300053123 | Bacteria | 2180 |
| 653 | Ga0500618_000080 | 3300053125 | Bacteria | 78455 |
| 654 | Ga0500642_0083553 | 3300053130 | Bacteria | 1469 |
| 655 | Ga0500655_027683 | 3300053133 | Bacteria | 1083 |
| 656 | Ga0500573_0033087 | 3300053140 | Bacteria | 2984 |
| 657 | Ga0500573_0225472 | 3300053140 | Bacteria | 980 |
| 658 | Ga0500619_063074 | 3300053154 | Bacteria | 1223 |
| 659 | Ga0500622_0001219 | 3300053156 | Bacteria | 21136 |
| 660 | Ga0500634_0114798 | 3300053161 | Bacteria | 1321 |
| 661 | Ga0587084_002476 | 3300059477 | Bacteria | 1918 |
| 662 | Ga0587093_006246 | 3300059478 | Bacteria | 1291 |
| 663 | Ga0587093_019759 | 3300059478 | Bacteria | 890 |
| 664 | Ga0587066_003653 | 3300059490 | Bacteria | 1827 |
| 665 | Ga0587070_000220 | 3300059491 | Bacteria | 3977 |
| 666 | Ga0587070_015923 | 3300059491 | Bacteria | 1197 |
| 667 | Ga0587073_0052786 | 3300059492 | Bacteria | 927 |
| 668 | Ga0587077_000327 | 3300059493 | Bacteria | 3754 |
| 669 | Ga0587077_003067 | 3300059493 | Bacteria | 2065 |
| 670 | Ga0587077_003693 | 3300059493 | Bacteria | 1948 |
| 671 | Ga0587077_019684 | 3300059493 | Bacteria | 1178 |
| 672 | Ga0587083_0000996 | 3300059505 | Bacteria | 2952 |
| 673 | Ga0587083_0012424 | 3300059505 | Bacteria | 1429 |
| 674 | Ga0587083_0013735 | 3300059505 | Bacteria | 1383 |
| 675 | Ga0587085_003141 | 3300059506 | Bacteria | 1765 |
| 676 | Ga0587086_004801 | 3300059507 | Bacteria | 1432 |
| 677 | Ga0587088_011151 | 3300059508 | Bacteria | 1333 |
| 678 | Ga0587090_000102 | 3300059510 | Bacteria | 5197 |
| 679 | Ga0587090_001380 | 3300059510 | Bacteria | 2450 |
| 680 | Ga0587090_008145 | 3300059510 | Bacteria | 1397 |
| 681 | Ga0587091_001706 | 3300059511 | Bacteria | 2450 |
| 682 | Ga0587092_000379 | 3300059512 | Bacteria | 3407 |
| 683 | Ga0587092_010678 | 3300059512 | Bacteria | 1262 |
| 684 | Ga0587094_016263 | 3300059513 | Bacteria | 1034 |
| 685 | Ga0587125_000722 | 3300059607 | Bacteria | 2115 |
| 686 | Ga0587101_004054 | 3300059623 | Bacteria | 1540 |
| 687 | Ga0587109_002139 | 3300059624 | Bacteria | 2459 |
| 688 | Ga0587117_000256 | 3300059627 | Bacteria | 3264 |
| 689 | Ga0587117_005332 | 3300059627 | Bacteria | 1386 |
| 690 | Ga0587062_000297 | 3300059639 | Bacteria | 3210 |
| 691 | Ga0587062_000616 | 3300059639 | Bacteria | 2623 |
| 692 | Ga0587062_001829 | 3300059639 | Bacteria | 1925 |
| 693 | Ga0587067_000818 | 3300059640 | Bacteria | 3043 |
| 694 | Ga0587068_000740 | 3300059641 | Bacteria | 3246 |
| 695 | Ga0587068_009729 | 3300059641 | Bacteria | 1421 |
| 696 | Ga0587069_016609 | 3300059642 | Bacteria | 1054 |
| 697 | Ga0587069_024431 | 3300059642 | Bacteria | 932 |
| 698 | Ga0587072_005484 | 3300059643 | Bacteria | 1895 |
| 699 | Ga0587076_000772 | 3300059645 | Bacteria | 2886 |
| 700 | Ga0587076_001127 | 3300059645 | Bacteria | 2613 |
| 701 | Ga0587076_003836 | 3300059645 | Bacteria | 1827 |
| 702 | Ga0587076_042404 | 3300059645 | Bacteria | 855 |
| 703 | Ga0587079_005766 | 3300059647 | Bacteria | 1769 |
| 704 | Ga0587108_000400 | 3300059653 | Bacteria | 2170 |
| 705 | Ga0587111_0000072 | 3300060346 | Bacteria | 6196 |
| 706 | Ga0587111_0006838 | 3300060346 | Bacteria | 1826 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049129 | Ga0501309_013494 | Ga0501309_013494_20_646 | 208 |
| 2 | 3300049162 | Ga0501307_000909 | Ga0501307_000909_1623_2249 | 208 |
| 3 | 3300049160 | Ga0501304_004832 | Ga0501304_004832_388_1020 | 210 |
| 4 | 3300049161 | Ga0501305_002509 | Ga0501305_002509_1344_1976 | 210 |
| 5 | 3300033541 | Ga0316596_1008124 | Ga0316596_10081242 | 213 |
| 6 | 3300005289 | Ga0065704_10000757 | Ga0065704_100007576 | 216 |
| 7 | 3300009148 | Ga0105243_10000018 | Ga0105243_10000018193 | 216 |
| 8 | 3300025935 | Ga0207709_10000021 | Ga0207709_100000215 | 216 |
| 9 | 3300032004 | Ga0307414_10507110 | Ga0307414_105071102 | 216 |
| 10 | 3300041444 | Ga0451790_02189 | Ga0451790_02189_597_1295 | 216 |
| 11 | 3300048919 | Ga0496116_0005208 | Ga0496116_0005208_9966_10664 | 216 |
| 12 | 3300048920 | Ga0496117_0015077 | Ga0496117_0015077_497_1195 | 216 |
| 13 | 3300048925 | Ga0496122_0032264 | Ga0496122_0032264_906_1604 | 216 |
| 14 | 3300048926 | Ga0496123_0016547 | Ga0496123_0016547_4902_5600 | 216 |
| 15 | 3300048927 | Ga0496124_0197845 | Ga0496124_0197845_277_975 | 216 |
| 16 | 3300048928 | Ga0496125_0065617 | Ga0496125_0065617_1639_2337 | 216 |
| 17 | 3300046471 | Ga0495650_0032661 | Ga0495650_0032661_1195_1893 | 217 |
| 18 | 3300046506 | Ga0495583_0039788 | Ga0495583_0039788_51_749 | 217 |
| 19 | 3300028653 | Ga0265323_10000038 | Ga0265323_1000003829 | 219 |
| 20 | 3300031344 | Ga0265316_10000481 | Ga0265316_1000048130 | 219 |
| 21 | 3300031712 | Ga0265342_10065670 | Ga0265342_100656701 | 219 |
| 22 | 3300009093 | Ga0105240_10429871 | Ga0105240_104298712 | 220 |
| 23 | 3300042876 | Ga0451577_0091907 | Ga0451577_0091907_1152_1847 | 220 |
| 24 | 3300044712 | Ga0453684_0001891 | Ga0453684_0001891_32898_33593 | 220 |
| 25 | 3300031727 | Ga0316576_10050475 | Ga0316576_100504754 | 221 |
| 26 | 3300036712 | Ga0316584_0036531 | Ga0316584_0036531_307_999 | 221 |
| 27 | 3300059627 | Ga0587117_005332 | Ga0587117_005332_47_808 | 221 |
| 28 | 3300031911 | Ga0307412_10336902 | Ga0307412_103369022 | 222 |
| 29 | 3300002067 | JGI24735J21928_10000009 | JGI24735J21928_10000009208 | 223 |
| 30 | 3300002737 | JGI25162J39368_1001524 | JGI25162J39368_10015244 | 223 |
| 31 | 3300002772 | JGI25164J39214_1000824 | JGI25164J39214_100082415 | 223 |
| 32 | 3300003214 | JGI25165J46597_1000923 | JGI25165J46597_100092314 | 223 |
| 33 | 3300005614 | Ga0068856_100003360 | Ga0068856_1000033607 | 223 |
| 34 | 3300006195 | Ga0075366_10068860 | Ga0075366_100688602 | 223 |
| 35 | 3300020077 | Ga0206351_10078727 | Ga0206351_100787272 | 223 |
| 36 | 3300020077 | Ga0206351_10106046 | Ga0206351_101060468 | 223 |
| 37 | 3300020080 | Ga0206350_10297200 | Ga0206350_102972005 | 223 |
| 38 | 3300020080 | Ga0206350_10622310 | Ga0206350_106223104 | 223 |
| 39 | 3300020610 | Ga0154015_1073617 | Ga0154015_10736173 | 223 |
| 40 | 3300020610 | Ga0154015_1153066 | Ga0154015_11530667 | 223 |
| 41 | 3300022467 | Ga0224712_10000859 | Ga0224712_100008599 | 223 |
| 42 | 3300025231 | Ga0207427_100236 | Ga0207427_10023616 | 223 |
| 43 | 3300025233 | Ga0209437_100034 | Ga0209437_10003414 | 223 |
| 44 | 3300025261 | Ga0209233_1000038 | Ga0209233_100003814 | 223 |
| 45 | 3300025904 | Ga0207647_10007050 | Ga0207647_100070504 | 223 |
| 46 | 3300026067 | Ga0207678_10032515 | Ga0207678_100325154 | 223 |
| 47 | 3300026078 | Ga0207702_10034672 | Ga0207702_100346724 | 223 |
| 48 | 3300044673 | Ga0453683_0245770 | Ga0453683_0245770_151_843 | 224 |
| 49 | 3300046523 | Ga0495644_0005315 | Ga0495644_0005315_1294_1992 | 224 |
| 50 | 3300047447 | Ga0495685_023166 | Ga0495685_023166_348_1046 | 224 |
| 51 | 3300059513 | Ga0587094_016263 | Ga0587094_016263_212_910 | 224 |
| 52 | 3300020080 | Ga0206350_10111961 | Ga0206350_101119614 | 225 |
| 53 | 3300045051 | Ga0451576_0000003 | Ga0451576_0000003_869325_870026 | 225 |
| 54 | 3300049528 | Ga0501312_039133 | Ga0501312_039133_35_730 | 225 |
| 55 | 3300044735 | Ga0466968_0094163 | Ga0466968_0094163_348_1067 | 226 |
| 56 | iso_pu_bacteria | 2839989709 | 2839990137 | 226 |
| 57 | 3300003781 | Ga0055536_1000001 | Ga0055536_1000001433 | 227 |
| 58 | 3300003791 | Ga0055530_10008207 | Ga0055530_100082074 | 227 |
| 59 | 3300009036 | Ga0105244_10020501 | Ga0105244_100205012 | 227 |
| 60 | 3300013100 | Ga0157373_10225466 | Ga0157373_102254662 | 227 |
| 61 | 3300013105 | Ga0157369_10000478 | Ga0157369_1000047844 | 227 |
| 62 | 3300013306 | Ga0163162_10038959 | Ga0163162_100389596 | 227 |
| 63 | 3300014497 | Ga0182008_10006054 | Ga0182008_100060544 | 227 |
| 64 | 3300015261 | Ga0182006_1070067 | Ga0182006_10700671 | 227 |
| 65 | 3300015262 | Ga0182007_10000003 | Ga0182007_10000003434 | 227 |
| 66 | 3300015682 | Ga0183373_1001 | Ga0183373_1001541 | 227 |
| 67 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008428 | 227 |
| 68 | 3300025298 | Ga0209050_1000045 | Ga0209050_1000045357 | 227 |
| 69 | 3300025949 | Ga0207667_10236032 | Ga0207667_102360323 | 227 |
| 70 | 3300032002 | Ga0307416_100504653 | Ga0307416_1005046532 | 227 |
| 71 | 3300041510 | Ga0451854_21462 | Ga0451854_21462_539_1237 | 227 |
| 72 | 3300046512 | Ga0495610_0143679 | Ga0495610_0143679_234_932 | 227 |
| 73 | iso_pu_bacteria | 2739367866 | 2740031516 | 227 |
| 74 | 3300005356 | Ga0070674_100626513 | Ga0070674_1006265131 | 228 |
| 75 | 3300009176 | Ga0105242_10505299 | Ga0105242_105052991 | 228 |
| 76 | 3300026075 | Ga0207708_10377458 | Ga0207708_103774581 | 228 |
| 77 | 3300049568 | Ga0501031_0071900 | Ga0501031_0071900_338_1045 | 228 |
| 78 | iso_pu_bacteria | 2522125168 | 2522552601 | 228 |
| 79 | iso_pu_bacteria | 2585427687 | 2586210452 | 228 |
| 80 | iso_pu_bacteria | 2599185184 | 2599479162 | 228 |
| 81 | iso_pu_bacteria | 2721755487 | 2722726631 | 228 |
| 82 | iso_pu_bacteria | 2738541283 | 2738755463 | 228 |
| 83 | iso_pu_bacteria | 2738541302 | 2738851931 | 228 |
| 84 | iso_pu_bacteria | 2738543023 | 2739303600 | 228 |
| 85 | iso_pu_bacteria | 2739367651 | 2739590821 | 228 |
| 86 | iso_pu_bacteria | 2739367656 | 2739617018 | 228 |
| 87 | iso_pu_bacteria | 2739367663 | 2739647324 | 228 |
| 88 | iso_pu_bacteria | 2775506987 | 2776615087 | 228 |
| 89 | iso_pu_bacteria | 2818991437 | 2819546476 | 228 |
| 90 | iso_pu_bacteria | 2842722452 | 2842725172 | 228 |
| 91 | iso_pu_bacteria | 2842903701 | 2842905876 | 228 |
| 92 | iso_pu_bacteria | 2842909656 | 2842912447 | 228 |
| 93 | iso_pu_bacteria | 2849281842 | 2849286039 | 228 |
| 94 | iso_pu_bacteria | 2852623160 | 2852625292 | 228 |
| 95 | iso_pu_bacteria | 2857627736 | 2857629755 | 228 |
| 96 | iso_pu_bacteria | 2884634485 | 2884637393 | 228 |
| 97 | iso_pu_bacteria | 2884933994 | 2884934305 | 228 |
| 98 | iso_pu_bacteria | 2890737413 | 2890738050 | 228 |
| 99 | iso_pu_bacteria | 2896317667 | 2896321222 | 228 |
| 100 | iso_pu_bacteria | 2896344016 | 2896345745 | 228 |
| 101 | iso_pu_bacteria | 2898713307 | 2898713531 | 228 |
| 102 | iso_pu_bacteria | 2902048731 | 2902052508 | 228 |
| 103 | iso_pu_bacteria | 2904445276 | 2904446636 | 228 |
| 104 | iso_pu_bacteria | 2904780799 | 2904785861 | 228 |
| 105 | iso_pu_bacteria | 2910245624 | 2910249772 | 228 |
| 106 | iso_pu_bacteria | 2919177583 | 2919182477 | 228 |
| 107 | iso_pu_bacteria | 2919186247 | 2919190322 | 228 |
| 108 | iso_pu_bacteria | 2919437846 | 2919438213 | 228 |
| 109 | iso_pu_bacteria | 2919692658 | 2919697442 | 228 |
| 110 | iso_pu_bacteria | 2928078545 | 2928082523 | 228 |
| 111 | iso_pu_bacteria | 2928147474 | 2928148889 | 228 |
| 112 | iso_pu_bacteria | 2932082852 | 2932086313 | 228 |
| 113 | iso_pu_bacteria | 2939664404 | 2939668603 | 228 |
| 114 | iso_pu_bacteria | 2945997725 | 2946002099 | 228 |
| 115 | iso_pu_bacteria | 2954016120 | 2954018997 | 228 |
| 116 | iso_pu_bacteria | 2977232053 | 2977233775 | 228 |
| 117 | iso_pu_bacteria | 3003233435 | 3003235166 | 228 |
| 118 | iso_pu_bacteria | 8055588893 | 8055590022 | 228 |
| 119 | 3300031548 | Ga0307408_100605987 | Ga0307408_1006059872 | 229 |
| 120 | 3300031731 | Ga0307405_10308938 | Ga0307405_103089382 | 229 |
| 121 | 3300031911 | Ga0307412_10539410 | Ga0307412_105394101 | 229 |
| 122 | 3300033541 | Ga0316596_1016243 | Ga0316596_10162433 | 229 |
| 123 | 3300042010 | Ga0439452_019002 | Ga0439452_019002_947_1657 | 229 |
| 124 | 3300046518 | Ga0495631_0158212 | Ga0495631_0158212_130_819 | 229 |
| 125 | 3300049128 | Ga0501308_003504 | Ga0501308_003504_639_1328 | 229 |
| 126 | 3300049132 | Ga0501343_003622 | Ga0501343_003622_155_844 | 229 |
| 127 | 3300049527 | Ga0501311_000833 | Ga0501311_000833_992_1681 | 229 |
| 128 | 3300049528 | Ga0501312_007409 | Ga0501312_007409_217_906 | 229 |
| 129 | 3300049531 | Ga0501315_035605 | Ga0501315_035605_23_712 | 229 |
| 130 | 3300049532 | Ga0501316_017170 | Ga0501316_017170_96_785 | 229 |
| 131 | 3300049535 | Ga0501319_005309 | Ga0501319_005309_37_726 | 229 |
| 132 | 3300049536 | Ga0501320_002635 | Ga0501320_002635_43_732 | 229 |
| 133 | 3300049537 | Ga0501321_000939 | Ga0501321_000939_975_1664 | 229 |
| 134 | 3300049539 | Ga0501323_004429 | Ga0501323_004429_775_1464 | 229 |
| 135 | 3300049539 | Ga0501323_012675 | Ga0501323_012675_310_999 | 229 |
| 136 | 3300049540 | Ga0501324_004922 | Ga0501324_004922_347_1036 | 229 |
| 137 | 3300049541 | Ga0501325_003222 | Ga0501325_003222_397_1086 | 229 |
| 138 | 3300003322 | rootL2_10051773 | rootL2_100517735 | 230 |
| 139 | 3300005290 | Ga0065712_10251685 | Ga0065712_102516852 | 230 |
| 140 | 3300005435 | Ga0070714_100173670 | Ga0070714_1001736702 | 230 |
| 141 | 3300005614 | Ga0068856_100223306 | Ga0068856_1002233062 | 230 |
| 142 | 3300005614 | Ga0068856_100360582 | Ga0068856_1003605822 | 230 |
| 143 | 3300013308 | Ga0157375_10076034 | Ga0157375_100760344 | 230 |
| 144 | 3300014325 | Ga0163163_10060719 | Ga0163163_100607194 | 230 |
| 145 | 3300025939 | Ga0207665_10334263 | Ga0207665_103342631 | 230 |
| 146 | 3300026078 | Ga0207702_10314486 | Ga0207702_103144862 | 230 |
| 147 | 3300026078 | Ga0207702_10425580 | Ga0207702_104255802 | 230 |
| 148 | 3300028573 | Ga0265334_10036858 | Ga0265334_100368583 | 230 |
| 149 | 3300029957 | Ga0265324_10031804 | Ga0265324_100318043 | 230 |
| 150 | 3300031251 | Ga0265327_10017918 | Ga0265327_100179184 | 230 |
| 151 | 3300031251 | Ga0265327_10101179 | Ga0265327_101011792 | 230 |
| 152 | 3300032004 | Ga0307414_10691375 | Ga0307414_106913752 | 230 |
| 153 | 3300037312 | Ga0395899_0000061 | Ga0395899_0000061_206850_207542 | 230 |
| 154 | 3300038443 | Ga0395901_0000976 | Ga0395901_0000976_1727_2419 | 230 |
| 155 | 3300039110 | Ga0400487_14420 | Ga0400487_14420_253_945 | 230 |
| 156 | 3300041907 | Ga0452268_22974 | Ga0452268_22974_214_906 | 230 |
| 157 | 3300049127 | Ga0501306_003286 | Ga0501306_003286_470_1162 | 230 |
| 158 | 3300049161 | Ga0501305_000794 | Ga0501305_000794_483_1175 | 230 |
| 159 | 3300049528 | Ga0501312_025010 | Ga0501312_025010_93_833 | 230 |
| 160 | 3300049529 | Ga0501313_000829 | Ga0501313_000829_1212_1904 | 230 |
| 161 | 3300049531 | Ga0501315_009283 | Ga0501315_009283_10_702 | 230 |
| 162 | 3300049549 | Ga0501333_000591 | Ga0501333_000591_460_1152 | 230 |
| 163 | 3300059478 | Ga0587093_019759 | Ga0587093_019759_32_724 | 230 |
| 164 | 3300059491 | Ga0587070_000220 | Ga0587070_000220_2783_3475 | 230 |
| 165 | 3300059493 | Ga0587077_000327 | Ga0587077_000327_2184_2876 | 230 |
| 166 | 3300059493 | Ga0587077_019684 | Ga0587077_019684_245_937 | 230 |
| 167 | 3300059505 | Ga0587083_0000996 | Ga0587083_0000996_71_763 | 230 |
| 168 | 3300059505 | Ga0587083_0013735 | Ga0587083_0013735_65_757 | 230 |
| 169 | 3300059512 | Ga0587092_000379 | Ga0587092_000379_2202_2894 | 230 |
| 170 | 3300059627 | Ga0587117_000256 | Ga0587117_000256_1710_2402 | 230 |
| 171 | 3300059639 | Ga0587062_000297 | Ga0587062_000297_333_1025 | 230 |
| 172 | 3300059641 | Ga0587068_000740 | Ga0587068_000740_374_1066 | 230 |
| 173 | 3300059642 | Ga0587069_016609 | Ga0587069_016609_304_996 | 230 |
| 174 | 3300004801 | Ga0058860_12228446 | Ga0058860_122284461 | 231 |
| 175 | 3300005288 | Ga0065714_10087528 | Ga0065714_100875284 | 231 |
| 176 | 3300005614 | Ga0068856_101055924 | Ga0068856_1010559241 | 231 |
| 177 | 3300005841 | Ga0068863_100205953 | Ga0068863_1002059533 | 231 |
| 178 | 3300009093 | Ga0105240_10332980 | Ga0105240_103329803 | 231 |
| 179 | 3300013296 | Ga0157374_10772124 | Ga0157374_107721242 | 231 |
| 180 | 3300013307 | Ga0157372_10001280 | Ga0157372_1000128013 | 231 |
| 181 | 3300013307 | Ga0157372_10504382 | Ga0157372_105043822 | 231 |
| 182 | 3300014326 | Ga0157380_10000015 | Ga0157380_1000001532 | 231 |
| 183 | 3300020070 | Ga0206356_11849337 | Ga0206356_118493372 | 231 |
| 184 | 3300026088 | Ga0207641_10535181 | Ga0207641_105351812 | 231 |
| 185 | 3300028653 | Ga0265323_10015327 | Ga0265323_100153273 | 231 |
| 186 | 3300028654 | Ga0265322_10007311 | Ga0265322_100073114 | 231 |
| 187 | 3300028654 | Ga0265322_10091967 | Ga0265322_100919672 | 231 |
| 188 | 3300031235 | Ga0265330_10172809 | Ga0265330_101728092 | 231 |
| 189 | 3300031344 | Ga0265316_10002116 | Ga0265316_1000211611 | 231 |
| 190 | 3300031344 | Ga0265316_10151822 | Ga0265316_101518222 | 231 |
| 191 | 3300031507 | Ga0307509_10007266 | Ga0307509_100072665 | 231 |
| 192 | 3300031727 | Ga0316576_10017290 | Ga0316576_100172904 | 231 |
| 193 | 3300031727 | Ga0316576_10096258 | Ga0316576_100962582 | 231 |
| 194 | 3300031728 | Ga0316578_10084147 | Ga0316578_100841473 | 231 |
| 195 | 3300031733 | Ga0316577_10003141 | Ga0316577_100031414 | 231 |
| 196 | 3300032168 | Ga0316593_10000093 | Ga0316593_100000935 | 231 |
| 197 | 3300032168 | Ga0316593_10000991 | Ga0316593_100009912 | 231 |
| 198 | 3300032168 | Ga0316593_10005401 | Ga0316593_100054014 | 231 |
| 199 | 3300032168 | Ga0316593_10009431 | Ga0316593_100094313 | 231 |
| 200 | 3300032168 | Ga0316593_10017950 | Ga0316593_100179504 | 231 |
| 201 | 3300032168 | Ga0316593_10020305 | Ga0316593_100203052 | 231 |
| 202 | 3300032168 | Ga0316593_10023475 | Ga0316593_100234752 | 231 |
| 203 | 3300032168 | Ga0316593_10053466 | Ga0316593_100534662 | 231 |
| 204 | 3300032168 | Ga0316593_10061455 | Ga0316593_100614551 | 231 |
| 205 | 3300033524 | Ga0316592_1003224 | Ga0316592_10032242 | 231 |
| 206 | 3300033524 | Ga0316592_1003832 | Ga0316592_10038321 | 231 |
| 207 | 3300033524 | Ga0316592_1008924 | Ga0316592_10089243 | 231 |
| 208 | 3300033524 | Ga0316592_1018891 | Ga0316592_10188912 | 231 |
| 209 | 3300033524 | Ga0316592_1019564 | Ga0316592_10195641 | 231 |
| 210 | 3300033528 | Ga0316588_1042483 | Ga0316588_10424832 | 231 |
| 211 | 3300033541 | Ga0316596_1000366 | Ga0316596_10003664 | 231 |
| 212 | 3300033541 | Ga0316596_1002234 | Ga0316596_10022344 | 231 |
| 213 | 3300033541 | Ga0316596_1007933 | Ga0316596_10079334 | 231 |
| 214 | 3300033541 | Ga0316596_1013705 | Ga0316596_10137053 | 231 |
| 215 | 3300033541 | Ga0316596_1015998 | Ga0316596_10159982 | 231 |
| 216 | 3300033541 | Ga0316596_1022724 | Ga0316596_10227242 | 231 |
| 217 | 3300033541 | Ga0316596_1027440 | Ga0316596_10274401 | 231 |
| 218 | 3300033541 | Ga0316596_1033701 | Ga0316596_10337012 | 231 |
| 219 | 3300033541 | Ga0316596_1037265 | Ga0316596_10372652 | 231 |
| 220 | 3300033541 | Ga0316596_1046705 | Ga0316596_10467052 | 231 |
| 221 | 3300033541 | Ga0316596_1072077 | Ga0316596_10720772 | 231 |
| 222 | 3300035398 | Ga0316574_0014181 | Ga0316574_0014181_1978_2673 | 231 |
| 223 | 3300035398 | Ga0316574_0125607 | Ga0316574_0125607_519_1214 | 231 |
| 224 | 3300035695 | Ga0373927_0150435 | Ga0373927_0150435_746_1441 | 231 |
| 225 | 3300036647 | Ga0316582_0035511 | Ga0316582_0035511_1677_2372 | 231 |
| 226 | 3300036712 | Ga0316584_0000096 | Ga0316584_0000096_8385_9080 | 231 |
| 227 | 3300037418 | Ga0395900_0716555 | Ga0395900_0716555_26_721 | 231 |
| 228 | 3300037471 | Ga0395905_0000011 | Ga0395905_0000011_322504_323199 | 231 |
| 229 | 3300037471 | Ga0395905_0003630 | Ga0395905_0003630_4015_4710 | 231 |
| 230 | 3300038443 | Ga0395901_0213352 | Ga0395901_0213352_604_1299 | 231 |
| 231 | 3300039093 | Ga0400489_23224 | Ga0400489_23224_317_1012 | 231 |
| 232 | 3300042876 | Ga0451577_0022661 | Ga0451577_0022661_2340_3035 | 231 |
| 233 | 3300044712 | Ga0453684_0002943 | Ga0453684_0002943_19766_20461 | 231 |
| 234 | 3300044712 | Ga0453684_0013926 | Ga0453684_0013926_5986_6681 | 231 |
| 235 | 3300044712 | Ga0453684_0024439 | Ga0453684_0024439_2393_3088 | 231 |
| 236 | 3300044712 | Ga0453684_0043847 | Ga0453684_0043847_4828_5523 | 231 |
| 237 | 3300044712 | Ga0453684_0425574 | Ga0453684_0425574_102_797 | 231 |
| 238 | 3300045051 | Ga0451576_0006577 | Ga0451576_0006577_12381_13076 | 231 |
| 239 | 3300045051 | Ga0451576_0022593 | Ga0451576_0022593_3564_4259 | 231 |
| 240 | 3300049129 | Ga0501309_006960 | Ga0501309_006960_674_1369 | 231 |
| 241 | 3300049130 | Ga0501310_005932 | Ga0501310_005932_401_1096 | 231 |
| 242 | 3300049532 | Ga0501316_013778 | Ga0501316_013778_161_856 | 231 |
| 243 | 3300049537 | Ga0501321_001995 | Ga0501321_001995_888_1583 | 231 |
| 244 | 3300049539 | Ga0501323_002326 | Ga0501323_002326_471_1166 | 231 |
| 245 | 3300049541 | Ga0501325_014404 | Ga0501325_014404_20_715 | 231 |
| 246 | 3300049546 | Ga0501330_003862 | Ga0501330_003862_161_856 | 231 |
| 247 | 3300049551 | Ga0501335_005857 | Ga0501335_005857_161_856 | 231 |
| 248 | 3300049552 | Ga0501336_000444 | Ga0501336_000444_607_1302 | 231 |
| 249 | 3300053133 | Ga0500655_027683 | Ga0500655_027683_255_950 | 231 |
| 250 | 3300059493 | Ga0587077_003693 | Ga0587077_003693_1233_1928 | 231 |
| 251 | 3300059510 | Ga0587090_008145 | Ga0587090_008145_367_1062 | 231 |
| 252 | 3300059512 | Ga0587092_010678 | Ga0587092_010678_502_1197 | 231 |
| 253 | 3300059641 | Ga0587068_009729 | Ga0587068_009729_271_966 | 231 |
| 254 | 3300059642 | Ga0587069_024431 | Ga0587069_024431_50_745 | 231 |
| 255 | 3300059645 | Ga0587076_003836 | Ga0587076_003836_427_1122 | 231 |
| 256 | 2124908027 | MRS2a_Contig_9405 | MRS2a_00295820 | 232 |
| 257 | 2162886012 | MBSR1b_contig_6515855 | MBSR1b_0162.00000050 | 232 |
| 258 | 3300001979 | JGI24740J21852_10015326 | JGI24740J21852_100153263 | 232 |
| 259 | 3300001989 | JGI24739J22299_10047850 | JGI24739J22299_100478502 | 232 |
| 260 | 3300001990 | JGI24737J22298_10000614 | JGI24737J22298_1000061413 | 232 |
| 261 | 3300001990 | JGI24737J22298_10001905 | JGI24737J22298_100019058 | 232 |
| 262 | 3300001990 | JGI24737J22298_10003582 | JGI24737J22298_100035824 | 232 |
| 263 | 3300001990 | JGI24737J22298_10005403 | JGI24737J22298_100054032 | 232 |
| 264 | 3300001991 | JGI24743J22301_10020627 | JGI24743J22301_100206272 | 232 |
| 265 | 3300002067 | JGI24735J21928_10021163 | JGI24735J21928_100211632 | 232 |
| 266 | 3300002737 | JGI25162J39368_1000120 | JGI25162J39368_100012045 | 232 |
| 267 | 3300002741 | JGI25157J39369_1002820 | JGI25157J39369_10028205 | 232 |
| 268 | 3300002741 | JGI25157J39369_1004397 | JGI25157J39369_10043972 | 232 |
| 269 | 3300002773 | JGI25152J39213_1000022 | JGI25152J39213_100002226 | 232 |
| 270 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001342 | 232 |
| 271 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001458 | 232 |
| 272 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001347 | 232 |
| 273 | 3300003316 | rootH1_10025186 | rootH1_100251865 | 232 |
| 274 | 3300003320 | rootH2_10094915 | rootH2_100949152 | 232 |
| 275 | 3300003320 | rootH2_10133361 | rootH2_101333612 | 232 |
| 276 | 3300003322 | rootL2_10024334 | rootL2_100243342 | 232 |
| 277 | 3300003323 | rootH1_10003520 | rootH1_100035204 | 232 |
| 278 | 3300003323 | rootH1_10035174 | rootH1_100351742 | 232 |
| 279 | 3300003323 | rootH1_10067560 | rootH1_100675605 | 232 |
| 280 | 3300003323 | rootH1_10081742 | rootH1_100817422 | 232 |
| 281 | 3300003323 | rootH1_10107846 | rootH1_101078462 | 232 |
| 282 | 3300003323 | rootH1_10144272 | rootH1_101442722 | 232 |
| 283 | 3300003693 | Ga0032354_1069350 | Ga0032354_10693502 | 232 |
| 284 | 3300003781 | Ga0055536_1013448 | Ga0055536_10134482 | 232 |
| 285 | 3300004799 | Ga0058863_10005116 | Ga0058863_1000511610 | 232 |
| 286 | 3300004800 | Ga0058861_10088285 | Ga0058861_100882853 | 232 |
| 287 | 3300004803 | Ga0058862_10247728 | Ga0058862_102477285 | 232 |
| 288 | 3300005262 | Ga0065165_1002853 | Ga0065165_10028537 | 232 |
| 289 | 3300005262 | Ga0065165_1007781 | Ga0065165_10077813 | 232 |
| 290 | 3300005288 | Ga0065714_10005413 | Ga0065714_100054134 | 232 |
| 291 | 3300005288 | Ga0065714_10007805 | Ga0065714_100078053 | 232 |
| 292 | 3300005288 | Ga0065714_10009921 | Ga0065714_100099213 | 232 |
| 293 | 3300005288 | Ga0065714_10083664 | Ga0065714_100836643 | 232 |
| 294 | 3300005288 | Ga0065714_10118201 | Ga0065714_101182012 | 232 |
| 295 | 3300005293 | Ga0065715_10001084 | Ga0065715_100010844 | 232 |
| 296 | 3300005327 | Ga0070658_10000014 | Ga0070658_10000014109 | 232 |
| 297 | 3300005327 | Ga0070658_10129449 | Ga0070658_101294492 | 232 |
| 298 | 3300005328 | Ga0070676_10004106 | Ga0070676_100041063 | 232 |
| 299 | 3300005329 | Ga0070683_100016707 | Ga0070683_1000167075 | 232 |
| 300 | 3300005334 | Ga0068869_100171345 | Ga0068869_1001713452 | 232 |
| 301 | 3300005337 | Ga0070682_100461467 | Ga0070682_1004614671 | 232 |
| 302 | 3300005338 | Ga0068868_100235346 | Ga0068868_1002353462 | 232 |
| 303 | 3300005355 | Ga0070671_100005487 | Ga0070671_1000054876 | 232 |
| 304 | 3300005364 | Ga0070673_100015276 | Ga0070673_1000152763 | 232 |
| 305 | 3300005366 | Ga0070659_100000402 | Ga0070659_10000040216 | 232 |
| 306 | 3300005366 | Ga0070659_100016784 | Ga0070659_1000167844 | 232 |
| 307 | 3300005366 | Ga0070659_100061430 | Ga0070659_1000614304 | 232 |
| 308 | 3300005456 | Ga0070678_100001822 | Ga0070678_1000018224 | 232 |
| 309 | 3300005457 | Ga0070662_100059100 | Ga0070662_1000591002 | 232 |
| 310 | 3300005458 | Ga0070681_10008372 | Ga0070681_1000837218 | 232 |
| 311 | 3300005459 | Ga0068867_100001197 | Ga0068867_1000011976 | 232 |
| 312 | 3300005530 | Ga0070679_100014038 | Ga0070679_10001403810 | 232 |
| 313 | 3300005530 | Ga0070679_100252125 | Ga0070679_1002521252 | 232 |
| 314 | 3300005548 | Ga0070665_100000032 | Ga0070665_100000032117 | 232 |
| 315 | 3300005563 | Ga0068855_100000026 | Ga0068855_1000000264 | 232 |
| 316 | 3300005563 | Ga0068855_100042965 | Ga0068855_1000429656 | 232 |
| 317 | 3300005563 | Ga0068855_100079811 | Ga0068855_1000798113 | 232 |
| 318 | 3300005563 | Ga0068855_100088358 | Ga0068855_1000883584 | 232 |
| 319 | 3300005577 | Ga0068857_100505495 | Ga0068857_1005054952 | 232 |
| 320 | 3300005578 | Ga0068854_100049164 | Ga0068854_1000491646 | 232 |
| 321 | 3300005578 | Ga0068854_100185625 | Ga0068854_1001856252 | 232 |
| 322 | 3300005614 | Ga0068856_100000014 | Ga0068856_1000000145 | 232 |
| 323 | 3300005614 | Ga0068856_100039856 | Ga0068856_1000398566 | 232 |
| 324 | 3300005614 | Ga0068856_100083237 | Ga0068856_1000832372 | 232 |
| 325 | 3300005616 | Ga0068852_100001456 | Ga0068852_1000014567 | 232 |
| 326 | 3300005616 | Ga0068852_100501427 | Ga0068852_1005014272 | 232 |
| 327 | 3300005718 | Ga0068866_10152491 | Ga0068866_101524912 | 232 |
| 328 | 3300006195 | Ga0075366_10105465 | Ga0075366_101054652 | 232 |
| 329 | 3300006195 | Ga0075366_10186058 | Ga0075366_101860582 | 232 |
| 330 | 3300006237 | Ga0097621_100000057 | Ga0097621_10000005739 | 232 |
| 331 | 3300006237 | Ga0097621_100431254 | Ga0097621_1004312542 | 232 |
| 332 | 3300006353 | Ga0075370_10099499 | Ga0075370_100994992 | 232 |
| 333 | 3300006358 | Ga0068871_100000094 | Ga0068871_10000009440 | 232 |
| 334 | 3300006881 | Ga0068865_100000200 | Ga0068865_10000020017 | 232 |
| 335 | 3300009093 | Ga0105240_10067718 | Ga0105240_100677184 | 232 |
| 336 | 3300009093 | Ga0105240_10111763 | Ga0105240_101117632 | 232 |
| 337 | 3300009093 | Ga0105240_10129348 | Ga0105240_101293483 | 232 |
| 338 | 3300009093 | Ga0105240_10616692 | Ga0105240_106166922 | 232 |
| 339 | 3300009094 | Ga0111539_10159065 | Ga0111539_101590656 | 232 |
| 340 | 3300009148 | Ga0105243_10380221 | Ga0105243_103802212 | 232 |
| 341 | 3300009174 | Ga0105241_10019243 | Ga0105241_100192436 | 232 |
| 342 | 3300009176 | Ga0105242_10040711 | Ga0105242_100407114 | 232 |
| 343 | 3300009176 | Ga0105242_10595052 | Ga0105242_105950522 | 232 |
| 344 | 3300009545 | Ga0105237_10001287 | Ga0105237_1000128731 | 232 |
| 345 | 3300009545 | Ga0105237_10001321 | Ga0105237_1000132119 | 232 |
| 346 | 3300009545 | Ga0105237_10012788 | Ga0105237_100127883 | 232 |
| 347 | 3300009545 | Ga0105237_10060769 | Ga0105237_100607693 | 232 |
| 348 | 3300009551 | Ga0105238_10003742 | Ga0105238_100037425 | 232 |
| 349 | 3300009551 | Ga0105238_10097306 | Ga0105238_100973062 | 232 |
| 350 | 3300009551 | Ga0105238_10781559 | Ga0105238_107815591 | 232 |
| 351 | 3300010375 | Ga0105239_10000001 | Ga0105239_10000001379 | 232 |
| 352 | 3300010375 | Ga0105239_10001363 | Ga0105239_1000136345 | 232 |
| 353 | 3300010375 | Ga0105239_10005053 | Ga0105239_1000505324 | 232 |
| 354 | 3300010375 | Ga0105239_10364930 | Ga0105239_103649302 | 232 |
| 355 | 3300013100 | Ga0157373_10000448 | Ga0157373_1000044826 | 232 |
| 356 | 3300013100 | Ga0157373_10016881 | Ga0157373_100168816 | 232 |
| 357 | 3300013102 | Ga0157371_10002095 | Ga0157371_1000209521 | 232 |
| 358 | 3300013102 | Ga0157371_10019347 | Ga0157371_100193476 | 232 |
| 359 | 3300013102 | Ga0157371_10132755 | Ga0157371_101327553 | 232 |
| 360 | 3300013102 | Ga0157371_10178349 | Ga0157371_101783492 | 232 |
| 361 | 3300013102 | Ga0157371_10262802 | Ga0157371_102628022 | 232 |
| 362 | 3300013104 | Ga0157370_10044584 | Ga0157370_100445846 | 232 |
| 363 | 3300013104 | Ga0157370_10209085 | Ga0157370_102090852 | 232 |
| 364 | 3300013104 | Ga0157370_10281686 | Ga0157370_102816862 | 232 |
| 365 | 3300013104 | Ga0157370_10563883 | Ga0157370_105638831 | 232 |
| 366 | 3300013105 | Ga0157369_10001799 | Ga0157369_100017997 | 232 |
| 367 | 3300013105 | Ga0157369_10058386 | Ga0157369_100583865 | 232 |
| 368 | 3300013105 | Ga0157369_10064414 | Ga0157369_100644143 | 232 |
| 369 | 3300013105 | Ga0157369_10241115 | Ga0157369_102411152 | 232 |
| 370 | 3300013105 | Ga0157369_10358700 | Ga0157369_103587002 | 232 |
| 371 | 3300013297 | Ga0157378_10022748 | Ga0157378_100227486 | 232 |
| 372 | 3300013297 | Ga0157378_10041902 | Ga0157378_100419025 | 232 |
| 373 | 3300013306 | Ga0163162_10000052 | Ga0163162_1000005252 | 232 |
| 374 | 3300013307 | Ga0157372_10000020 | Ga0157372_100000207 | 232 |
| 375 | 3300013307 | Ga0157372_10000254 | Ga0157372_1000025434 | 232 |
| 376 | 3300013307 | Ga0157372_10042429 | Ga0157372_100424292 | 232 |
| 377 | 3300013307 | Ga0157372_10087139 | Ga0157372_100871394 | 232 |
| 378 | 3300013307 | Ga0157372_10122899 | Ga0157372_101228996 | 232 |
| 379 | 3300013308 | Ga0157375_10044048 | Ga0157375_100440483 | 232 |
| 380 | 3300013308 | Ga0157375_10106910 | Ga0157375_101069101 | 232 |
| 381 | 3300013308 | Ga0157375_10244028 | Ga0157375_102440283 | 232 |
| 382 | 3300014497 | Ga0182008_10021142 | Ga0182008_100211423 | 232 |
| 383 | 3300014968 | Ga0157379_10268826 | Ga0157379_102688262 | 232 |
| 384 | 3300014969 | Ga0157376_10279806 | Ga0157376_102798062 | 232 |
| 385 | 3300015261 | Ga0182006_1002415 | Ga0182006_10024153 | 232 |
| 386 | 3300015262 | Ga0182007_10049861 | Ga0182007_100498612 | 232 |
| 387 | 3300017792 | Ga0163161_10000641 | Ga0163161_100006413 | 232 |
| 388 | 3300017792 | Ga0163161_10040013 | Ga0163161_100400132 | 232 |
| 389 | 3300017792 | Ga0163161_10041013 | Ga0163161_100410136 | 232 |
| 390 | 3300017792 | Ga0163161_10701163 | Ga0163161_107011631 | 232 |
| 391 | 3300020069 | Ga0197907_10160647 | Ga0197907_101606472 | 232 |
| 392 | 3300020069 | Ga0197907_10706642 | Ga0197907_107066423 | 232 |
| 393 | 3300020069 | Ga0197907_10819694 | Ga0197907_108196944 | 232 |
| 394 | 3300020069 | Ga0197907_10908526 | Ga0197907_109085262 | 232 |
| 395 | 3300020070 | Ga0206356_10124111 | Ga0206356_101241114 | 232 |
| 396 | 3300020070 | Ga0206356_11795532 | Ga0206356_117955323 | 232 |
| 397 | 3300020075 | Ga0206349_1110078 | Ga0206349_11100782 | 232 |
| 398 | 3300020075 | Ga0206349_1596541 | Ga0206349_15965412 | 232 |
| 399 | 3300020076 | Ga0206355_1018008 | Ga0206355_10180082 | 232 |
| 400 | 3300020077 | Ga0206351_10462283 | Ga0206351_104622834 | 232 |
| 401 | 3300020077 | Ga0206351_10586730 | Ga0206351_105867302 | 232 |
| 402 | 3300020078 | Ga0206352_10727185 | Ga0206352_107271851 | 232 |
| 403 | 3300020078 | Ga0206352_11107574 | Ga0206352_111075742 | 232 |
| 404 | 3300020081 | Ga0206354_10771971 | Ga0206354_107719712 | 232 |
| 405 | 3300020081 | Ga0206354_10858690 | Ga0206354_108586902 | 232 |
| 406 | 3300020081 | Ga0206354_11003734 | Ga0206354_110037342 | 232 |
| 407 | 3300020081 | Ga0206354_11089144 | Ga0206354_110891443 | 232 |
| 408 | 3300020081 | Ga0206354_11204833 | Ga0206354_112048332 | 232 |
| 409 | 3300020082 | Ga0206353_10132441 | Ga0206353_101324411 | 232 |
| 410 | 3300020082 | Ga0206353_10698887 | Ga0206353_106988874 | 232 |
| 411 | 3300020082 | Ga0206353_10800764 | Ga0206353_108007642 | 232 |
| 412 | 3300020082 | Ga0206353_11125333 | Ga0206353_111253333 | 232 |
| 413 | 3300020082 | Ga0206353_11187972 | Ga0206353_111879722 | 232 |
| 414 | 3300020610 | Ga0154015_1236635 | Ga0154015_12366352 | 232 |
| 415 | 3300021361 | Ga0213872_10048147 | Ga0213872_100481472 | 232 |
| 416 | 3300022467 | Ga0224712_10005983 | Ga0224712_100059832 | 232 |
| 417 | 3300022467 | Ga0224712_10006283 | Ga0224712_100062833 | 232 |
| 418 | 3300022467 | Ga0224712_10014258 | Ga0224712_100142582 | 232 |
| 419 | 3300025233 | Ga0209437_100143 | Ga0209437_10014334 | 232 |
| 420 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002826 | 232 |
| 421 | 3300025250 | Ga0209026_1000463 | Ga0209026_100046321 | 232 |
| 422 | 3300025250 | Ga0209026_1002304 | Ga0209026_10023047 | 232 |
| 423 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002826 | 232 |
| 424 | 3300025258 | Ga0209129_1013234 | Ga0209129_10132342 | 232 |
| 425 | 3300025272 | Ga0209455_1001279 | Ga0209455_10012793 | 232 |
| 426 | 3300025272 | Ga0209455_1007272 | Ga0209455_10072723 | 232 |
| 427 | 3300025292 | Ga0209676_1000294 | Ga0209676_10002945 | 232 |
| 428 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004364 | 232 |
| 429 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006364 | 232 |
| 430 | 3300025302 | Ga0207426_1055039 | Ga0207426_10550392 | 232 |
| 431 | 3300025321 | Ga0207656_10057491 | Ga0207656_100574912 | 232 |
| 432 | 3300025904 | Ga0207647_10003884 | Ga0207647_100038846 | 232 |
| 433 | 3300025907 | Ga0207645_10002281 | Ga0207645_1000228119 | 232 |
| 434 | 3300025909 | Ga0207705_10000043 | Ga0207705_10000043151 | 232 |
| 435 | 3300025911 | Ga0207654_10005184 | Ga0207654_100051844 | 232 |
| 436 | 3300025913 | Ga0207695_10000053 | Ga0207695_10000053158 | 232 |
| 437 | 3300025913 | Ga0207695_10029659 | Ga0207695_1002965914 | 232 |
| 438 | 3300025913 | Ga0207695_10034034 | Ga0207695_100340344 | 232 |
| 439 | 3300025913 | Ga0207695_10044139 | Ga0207695_100441392 | 232 |
| 440 | 3300025913 | Ga0207695_10196503 | Ga0207695_101965032 | 232 |
| 441 | 3300025914 | Ga0207671_10002869 | Ga0207671_100028697 | 232 |
| 442 | 3300025914 | Ga0207671_10003103 | Ga0207671_1000310311 | 232 |
| 443 | 3300025914 | Ga0207671_10007516 | Ga0207671_100075165 | 232 |
| 444 | 3300025914 | Ga0207671_10012211 | Ga0207671_100122119 | 232 |
| 445 | 3300025914 | Ga0207671_10032530 | Ga0207671_100325302 | 232 |
| 446 | 3300025914 | Ga0207671_10037359 | Ga0207671_100373596 | 232 |
| 447 | 3300025914 | Ga0207671_10069032 | Ga0207671_100690322 | 232 |
| 448 | 3300025919 | Ga0207657_10091410 | Ga0207657_100914102 | 232 |
| 449 | 3300025921 | Ga0207652_10027983 | Ga0207652_100279834 | 232 |
| 450 | 3300025924 | Ga0207694_10022814 | Ga0207694_100228143 | 232 |
| 451 | 3300025932 | Ga0207690_10000365 | Ga0207690_1000036514 | 232 |
| 452 | 3300025932 | Ga0207690_10037427 | Ga0207690_100374274 | 232 |
| 453 | 3300025933 | Ga0207706_10000057 | Ga0207706_1000005713 | 232 |
| 454 | 3300025933 | Ga0207706_10169742 | Ga0207706_101697422 | 232 |
| 455 | 3300025934 | Ga0207686_10007982 | Ga0207686_100079824 | 232 |
| 456 | 3300025937 | Ga0207669_10136118 | Ga0207669_101361182 | 232 |
| 457 | 3300025938 | Ga0207704_10000052 | Ga0207704_1000005248 | 232 |
| 458 | 3300025939 | Ga0207665_10301290 | Ga0207665_103012902 | 232 |
| 459 | 3300025942 | Ga0207689_10080823 | Ga0207689_100808233 | 232 |
| 460 | 3300025944 | Ga0207661_10010757 | Ga0207661_100107572 | 232 |
| 461 | 3300025949 | Ga0207667_10000022 | Ga0207667_10000022168 | 232 |
| 462 | 3300025949 | Ga0207667_10001325 | Ga0207667_1000132542 | 232 |
| 463 | 3300025949 | Ga0207667_10012833 | Ga0207667_100128335 | 232 |
| 464 | 3300025949 | Ga0207667_10073046 | Ga0207667_100730465 | 232 |
| 465 | 3300025960 | Ga0207651_10027165 | Ga0207651_100271653 | 232 |
| 466 | 3300025981 | Ga0207640_10033694 | Ga0207640_100336942 | 232 |
| 467 | 3300025986 | Ga0207658_10500098 | Ga0207658_105000982 | 232 |
| 468 | 3300026023 | Ga0207677_10091392 | Ga0207677_100913923 | 232 |
| 469 | 3300026035 | Ga0207703_10031399 | Ga0207703_100313996 | 232 |
| 470 | 3300026041 | Ga0207639_10140200 | Ga0207639_101402003 | 232 |
| 471 | 3300026078 | Ga0207702_10000036 | Ga0207702_10000036129 | 232 |
| 472 | 3300026078 | Ga0207702_10063299 | Ga0207702_100632992 | 232 |
| 473 | 3300026078 | Ga0207702_10098980 | Ga0207702_100989801 | 232 |
| 474 | 3300026089 | Ga0207648_10002788 | Ga0207648_100027886 | 232 |
| 475 | 3300026095 | Ga0207676_10409747 | Ga0207676_104097472 | 232 |
| 476 | 3300026121 | Ga0207683_10010796 | Ga0207683_100107964 | 232 |
| 477 | 3300026142 | Ga0207698_10005473 | Ga0207698_100054736 | 232 |
| 478 | 3300026142 | Ga0207698_10732621 | Ga0207698_107326212 | 232 |
| 479 | 3300027907 | Ga0207428_10571149 | Ga0207428_105711491 | 232 |
| 480 | 3300028379 | Ga0268266_10000030 | Ga0268266_10000030212 | 232 |
| 481 | 3300028381 | Ga0268264_10467476 | Ga0268264_104674762 | 232 |
| 482 | 3300028786 | Ga0307517_10006168 | Ga0307517_100061686 | 232 |
| 483 | 3300028794 | Ga0307515_10049612 | Ga0307515_100496124 | 232 |
| 484 | 3300028794 | Ga0307515_10244807 | Ga0307515_102448072 | 232 |
| 485 | 3300028800 | Ga0265338_10049114 | Ga0265338_100491143 | 232 |
| 486 | 3300028800 | Ga0265338_10071330 | Ga0265338_100713304 | 232 |
| 487 | 3300030731 | Ga0316177_1003967 | Ga0316177_100396712 | 232 |
| 488 | 3300030732 | Ga0316176_1151771 | Ga0316176_11517715 | 232 |
| 489 | 3300030733 | Ga0314311_1080887 | Ga0314311_10808872 | 232 |
| 490 | 3300030742 | Ga0316183_1095896 | Ga0316183_109589677 | 232 |
| 491 | 3300030744 | Ga0316181_1088295 | Ga0316181_10882956 | 232 |
| 492 | 3300030744 | Ga0316181_1201818 | Ga0316181_12018182 | 232 |
| 493 | 3300030744 | Ga0316181_1282363 | Ga0316181_12823633 | 232 |
| 494 | 3300030745 | Ga0316182_1171482 | Ga0316182_11714828 | 232 |
| 495 | 3300031507 | Ga0307509_10101371 | Ga0307509_101013715 | 232 |
| 496 | 3300031507 | Ga0307509_10101439 | Ga0307509_101014392 | 232 |
| 497 | 3300031548 | Ga0307408_100000321 | Ga0307408_10000032136 | 232 |
| 498 | 3300031548 | Ga0307408_100037589 | Ga0307408_1000375894 | 232 |
| 499 | 3300031548 | Ga0307408_100070397 | Ga0307408_1000703975 | 232 |
| 500 | 3300031727 | Ga0316576_10176452 | Ga0316576_101764522 | 232 |
| 501 | 3300031731 | Ga0307405_10000003 | Ga0307405_10000003214 | 232 |
| 502 | 3300031731 | Ga0307405_10001399 | Ga0307405_1000139913 | 232 |
| 503 | 3300031731 | Ga0307405_10036088 | Ga0307405_100360886 | 232 |
| 504 | 3300031824 | Ga0307413_10173165 | Ga0307413_101731651 | 232 |
| 505 | 3300031901 | Ga0307406_10395533 | Ga0307406_103955332 | 232 |
| 506 | 3300031903 | Ga0307407_10000030 | Ga0307407_1000003035 | 232 |
| 507 | 3300031911 | Ga0307412_10000065 | Ga0307412_1000006528 | 232 |
| 508 | 3300031911 | Ga0307412_10000925 | Ga0307412_1000092521 | 232 |
| 509 | 3300031911 | Ga0307412_10466574 | Ga0307412_104665742 | 232 |
| 510 | 3300031995 | Ga0307409_100266165 | Ga0307409_1002661653 | 232 |
| 511 | 3300032002 | Ga0307416_100000014 | Ga0307416_10000001428 | 232 |
| 512 | 3300032002 | Ga0307416_100000800 | Ga0307416_10000080014 | 232 |
| 513 | 3300032004 | Ga0307414_10000069 | Ga0307414_100000699 | 232 |
| 514 | 3300032004 | Ga0307414_10007780 | Ga0307414_100077804 | 232 |
| 515 | 3300032004 | Ga0307414_10010548 | Ga0307414_100105484 | 232 |
| 516 | 3300032004 | Ga0307414_10167193 | Ga0307414_101671932 | 232 |
| 517 | 3300032004 | Ga0307414_10348866 | Ga0307414_103488662 | 232 |
| 518 | 3300032004 | Ga0307414_10481940 | Ga0307414_104819402 | 232 |
| 519 | 3300032004 | Ga0307414_10514247 | Ga0307414_105142471 | 232 |
| 520 | 3300032004 | Ga0307414_10849893 | Ga0307414_108498931 | 232 |
| 521 | 3300032005 | Ga0307411_10271759 | Ga0307411_102717592 | 232 |
| 522 | 3300032168 | Ga0316593_10019182 | Ga0316593_100191825 | 232 |
| 523 | 3300032168 | Ga0316593_10045675 | Ga0316593_100456752 | 232 |
| 524 | 3300033179 | Ga0307507_10000032 | Ga0307507_1000003243 | 232 |
| 525 | 3300033524 | Ga0316592_1068743 | Ga0316592_10687431 | 232 |
| 526 | 3300033528 | Ga0316588_1035028 | Ga0316588_10350282 | 232 |
| 527 | 3300033528 | Ga0316588_1043695 | Ga0316588_10436952 | 232 |
| 528 | 3300033541 | Ga0316596_1003917 | Ga0316596_10039175 | 232 |
| 529 | 3300033541 | Ga0316596_1008922 | Ga0316596_10089225 | 232 |
| 530 | 3300033541 | Ga0316596_1014553 | Ga0316596_10145533 | 232 |
| 531 | 3300033541 | Ga0316596_1016474 | Ga0316596_10164743 | 232 |
| 532 | 3300036457 | Ga0265778_001249 | Ga0265778_001249_622_1320 | 232 |
| 533 | 3300036712 | Ga0316584_0028358 | Ga0316584_0028358_984_1682 | 232 |
| 534 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_11991_12689 | 232 |
| 535 | 3300037312 | Ga0395899_0000459 | Ga0395899_0000459_35451_36149 | 232 |
| 536 | 3300037312 | Ga0395899_0012421 | Ga0395899_0012421_5169_5867 | 232 |
| 537 | 3300037312 | Ga0395899_0046276 | Ga0395899_0046276_2016_2714 | 232 |
| 538 | 3300037418 | Ga0395900_0000143 | Ga0395900_0000143_100967_101665 | 232 |
| 539 | 3300037418 | Ga0395900_0000284 | Ga0395900_0000284_72679_73377 | 232 |
| 540 | 3300037466 | Ga0395898_0049674 | Ga0395898_0049674_2320_3018 | 232 |
| 541 | 3300037466 | Ga0395898_0059816 | Ga0395898_0059816_1070_1768 | 232 |
| 542 | 3300037471 | Ga0395905_0000045 | Ga0395905_0000045_169247_169945 | 232 |
| 543 | 3300037471 | Ga0395905_0001507 | Ga0395905_0001507_24467_25165 | 232 |
| 544 | 3300038443 | Ga0395901_0003957 | Ga0395901_0003957_3104_3802 | 232 |
| 545 | 3300038443 | Ga0395901_0056763 | Ga0395901_0056763_71_769 | 232 |
| 546 | 3300038443 | Ga0395901_0237197 | Ga0395901_0237197_470_1168 | 232 |
| 547 | 3300039447 | Ga0436361_0285047 | Ga0436361_0285047_4908_5606 | 232 |
| 548 | 3300041444 | Ga0451790_30578 | Ga0451790_30578_64_762 | 232 |
| 549 | 3300041446 | Ga0451794_27951 | Ga0451794_27951_130_828 | 232 |
| 550 | 3300041486 | Ga0451807_1843265 | Ga0451807_1843265_257_955 | 232 |
| 551 | 3300041494 | Ga0451837_1311701 | Ga0451837_1311701_91_789 | 232 |
| 552 | 3300041512 | Ga0451853_3267999 | Ga0451853_3267999_134_832 | 232 |
| 553 | 3300042005 | Ga0439448_0007567 | Ga0439448_0007567_299_997 | 232 |
| 554 | 3300042007 | Ga0439449_0050505 | Ga0439449_0050505_190_888 | 232 |
| 555 | 3300042014 | Ga0439457_009023 | Ga0439457_009023_1443_2141 | 232 |
| 556 | 3300042876 | Ga0451577_0001856 | Ga0451577_0001856_14899_15597 | 232 |
| 557 | 3300044684 | Ga0466966_0003065 | Ga0466966_0003065_2399_3097 | 232 |
| 558 | 3300044693 | Ga0466961_0031179 | Ga0466961_0031179_867_1565 | 232 |
| 559 | 3300044712 | Ga0453684_0000413 | Ga0453684_0000413_100548_101246 | 232 |
| 560 | 3300044712 | Ga0453684_0006165 | Ga0453684_0006165_18286_18987 | 232 |
| 561 | 3300044712 | Ga0453684_0007249 | Ga0453684_0007249_2521_3219 | 232 |
| 562 | 3300044712 | Ga0453684_0375729 | Ga0453684_0375729_345_1046 | 232 |
| 563 | 3300045049 | Ga0466959_0038507 | Ga0466959_0038507_2594_3292 | 232 |
| 564 | 3300045051 | Ga0451576_0005986 | Ga0451576_0005986_10428_11126 | 232 |
| 565 | 3300045051 | Ga0451576_0161739 | Ga0451576_0161739_925_1626 | 232 |
| 566 | 3300045051 | Ga0451576_0178682 | Ga0451576_0178682_308_1006 | 232 |
| 567 | 3300045051 | Ga0451576_0608818 | Ga0451576_0608818_108_806 | 232 |
| 568 | 3300045836 | Ga0466958_0017929 | Ga0466958_0017929_1791_2489 | 232 |
| 569 | 3300046453 | Ga0495627_098218 | Ga0495627_098218_119_817 | 232 |
| 570 | 3300046462 | Ga0495651_0032684 | Ga0495651_0032684_698_1396 | 232 |
| 571 | 3300046463 | Ga0495653_0150461 | Ga0495653_0150461_18_716 | 232 |
| 572 | 3300046471 | Ga0495650_0000594 | Ga0495650_0000594_48538_49236 | 232 |
| 573 | 3300046492 | Ga0495585_0003458 | Ga0495585_0003458_3555_4253 | 232 |
| 574 | 3300046492 | Ga0495585_0004171 | Ga0495585_0004171_6392_7090 | 232 |
| 575 | 3300046500 | Ga0495596_0015612 | Ga0495596_0015612_2260_2958 | 232 |
| 576 | 3300046506 | Ga0495583_0028887 | Ga0495583_0028887_1183_1881 | 232 |
| 577 | 3300046507 | Ga0495606_0027164 | Ga0495606_0027164_595_1293 | 232 |
| 578 | 3300046507 | Ga0495606_0037734 | Ga0495606_0037734_1720_2418 | 232 |
| 579 | 3300046507 | Ga0495606_0057780 | Ga0495606_0057780_548_1246 | 232 |
| 580 | 3300046507 | Ga0495606_0085902 | Ga0495606_0085902_696_1394 | 232 |
| 581 | 3300046511 | Ga0495608_0181797 | Ga0495608_0181797_502_1200 | 232 |
| 582 | 3300046512 | Ga0495610_0001861 | Ga0495610_0001861_9013_9711 | 232 |
| 583 | 3300046512 | Ga0495610_0007560 | Ga0495610_0007560_5978_6676 | 232 |
| 584 | 3300046513 | Ga0495616_0006133 | Ga0495616_0006133_5842_6540 | 232 |
| 585 | 3300046513 | Ga0495616_0010222 | Ga0495616_0010222_3871_4569 | 232 |
| 586 | 3300046524 | Ga0495648_0004657 | Ga0495648_0004657_6800_7498 | 232 |
| 587 | 3300046525 | Ga0495663_0026521 | Ga0495663_0026521_297_995 | 232 |
| 588 | 3300046529 | Ga0495652_0544982 | Ga0495652_0544982_27_725 | 232 |
| 589 | 3300046538 | Ga0495609_0005251 | Ga0495609_0005251_5348_6046 | 232 |
| 590 | 3300046557 | Ga0495622_0026339 | Ga0495622_0026339_1384_2082 | 232 |
| 591 | 3300046558 | Ga0495633_0000021 | Ga0495633_0000021_80607_81305 | 232 |
| 592 | 3300046616 | Ga0495668_0000673 | Ga0495668_0000673_34440_35138 | 232 |
| 593 | 3300046616 | Ga0495668_0110755 | Ga0495668_0110755_64_762 | 232 |
| 594 | 3300046660 | Ga0495625_0000021 | Ga0495625_0000021_275184_275882 | 232 |
| 595 | 3300046660 | Ga0495625_0033407 | Ga0495625_0033407_2356_3054 | 232 |
| 596 | 3300046660 | Ga0495625_0047911 | Ga0495625_0047911_650_1348 | 232 |
| 597 | 3300046660 | Ga0495625_0094724 | Ga0495625_0094724_46_744 | 232 |
| 598 | 3300046663 | Ga0495635_0384985 | Ga0495635_0384985_77_775 | 232 |
| 599 | 3300046665 | Ga0495661_0000739 | Ga0495661_0000739_24868_25566 | 232 |
| 600 | 3300046665 | Ga0495661_0008232 | Ga0495661_0008232_1765_2463 | 232 |
| 601 | 3300046694 | Ga0495649_0000009 | Ga0495649_0000009_183644_184342 | 232 |
| 602 | 3300046694 | Ga0495649_0023066 | Ga0495649_0023066_1775_2473 | 232 |
| 603 | 3300046810 | Ga0495660_0005455 | Ga0495660_0005455_5003_5701 | 232 |
| 604 | 3300047323 | Ga0495683_0091552 | Ga0495683_0091552_312_1010 | 232 |
| 605 | 3300047443 | Ga0495687_001340 | Ga0495687_001340_493_1191 | 232 |
| 606 | 3300047443 | Ga0495687_020359 | Ga0495687_020359_485_1183 | 232 |
| 607 | 3300047446 | Ga0495679_026403 | Ga0495679_026403_204_902 | 232 |
| 608 | 3300047469 | Ga0495673_0016437 | Ga0495673_0016437_1922_2620 | 232 |
| 609 | 3300047470 | Ga0495681_0047893 | Ga0495681_0047893_941_1639 | 232 |
| 610 | 3300047472 | Ga0495686_0041791 | Ga0495686_0041791_119_817 | 232 |
| 611 | 3300047472 | Ga0495686_0131215 | Ga0495686_0131215_240_938 | 232 |
| 612 | 3300048925 | Ga0496122_0000625 | Ga0496122_0000625_23500_24198 | 232 |
| 613 | 3300048926 | Ga0496123_0015827 | Ga0496123_0015827_2397_3095 | 232 |
| 614 | 3300048928 | Ga0496125_0100691 | Ga0496125_0100691_1116_1814 | 232 |
| 615 | 3300049127 | Ga0501306_000090 | Ga0501306_000090_2826_3524 | 232 |
| 616 | 3300049127 | Ga0501306_001514 | Ga0501306_001514_94_792 | 232 |
| 617 | 3300049127 | Ga0501306_003219 | Ga0501306_003219_128_826 | 232 |
| 618 | 3300049127 | Ga0501306_006690 | Ga0501306_006690_613_1311 | 232 |
| 619 | 3300049128 | Ga0501308_000241 | Ga0501308_000241_500_1198 | 232 |
| 620 | 3300049128 | Ga0501308_001515 | Ga0501308_001515_515_1213 | 232 |
| 621 | 3300049128 | Ga0501308_005994 | Ga0501308_005994_296_994 | 232 |
| 622 | 3300049129 | Ga0501309_001209 | Ga0501309_001209_1077_1775 | 232 |
| 623 | 3300049129 | Ga0501309_005559 | Ga0501309_005559_117_818 | 232 |
| 624 | 3300049130 | Ga0501310_000779 | Ga0501310_000779_1603_2301 | 232 |
| 625 | 3300049130 | Ga0501310_000916 | Ga0501310_000916_967_1665 | 232 |
| 626 | 3300049130 | Ga0501310_001290 | Ga0501310_001290_1140_1838 | 232 |
| 627 | 3300049130 | Ga0501310_004289 | Ga0501310_004289_364_1062 | 232 |
| 628 | 3300049132 | Ga0501343_004790 | Ga0501343_004790_93_791 | 232 |
| 629 | 3300049134 | Ga0501345_00892 | Ga0501345_00892_212_910 | 232 |
| 630 | 3300049160 | Ga0501304_000073 | Ga0501304_000073_1237_1935 | 232 |
| 631 | 3300049160 | Ga0501304_003896 | Ga0501304_003896_49_747 | 232 |
| 632 | 3300049160 | Ga0501304_007180 | Ga0501304_007180_73_771 | 232 |
| 633 | 3300049161 | Ga0501305_000527 | Ga0501305_000527_496_1194 | 232 |
| 634 | 3300049161 | Ga0501305_001549 | Ga0501305_001549_930_1628 | 232 |
| 635 | 3300049161 | Ga0501305_001909 | Ga0501305_001909_406_1104 | 232 |
| 636 | 3300049161 | Ga0501305_002800 | Ga0501305_002800_596_1294 | 232 |
| 637 | 3300049161 | Ga0501305_005953 | Ga0501305_005953_567_1265 | 232 |
| 638 | 3300049162 | Ga0501307_000427 | Ga0501307_000427_570_1268 | 232 |
| 639 | 3300049162 | Ga0501307_000560 | Ga0501307_000560_828_1526 | 232 |
| 640 | 3300049162 | Ga0501307_000602 | Ga0501307_000602_856_1554 | 232 |
| 641 | 3300049162 | Ga0501307_002306 | Ga0501307_002306_449_1147 | 232 |
| 642 | 3300049162 | Ga0501307_003893 | Ga0501307_003893_139_837 | 232 |
| 643 | 3300049459 | Ga0495678_041511 | Ga0495678_041511_89_787 | 232 |
| 644 | 3300049516 | Ga0501293_005397 | Ga0501293_005397_142_840 | 232 |
| 645 | 3300049527 | Ga0501311_000890 | Ga0501311_000890_485_1183 | 232 |
| 646 | 3300049527 | Ga0501311_001075 | Ga0501311_001075_1130_1828 | 232 |
| 647 | 3300049527 | Ga0501311_002484 | Ga0501311_002484_428_1126 | 232 |
| 648 | 3300049528 | Ga0501312_000226 | Ga0501312_000226_2786_3484 | 232 |
| 649 | 3300049528 | Ga0501312_000486 | Ga0501312_000486_1824_2522 | 232 |
| 650 | 3300049528 | Ga0501312_000493 | Ga0501312_000493_571_1269 | 232 |
| 651 | 3300049528 | Ga0501312_007331 | Ga0501312_007331_688_1386 | 232 |
| 652 | 3300049528 | Ga0501312_007957 | Ga0501312_007957_107_805 | 232 |
| 653 | 3300049529 | Ga0501313_000170 | Ga0501313_000170_1592_2290 | 232 |
| 654 | 3300049529 | Ga0501313_001041 | Ga0501313_001041_406_1104 | 232 |
| 655 | 3300049529 | Ga0501313_004034 | Ga0501313_004034_136_834 | 232 |
| 656 | 3300049529 | Ga0501313_004733 | Ga0501313_004733_475_1173 | 232 |
| 657 | 3300049530 | Ga0501314_000363 | Ga0501314_000363_1559_2257 | 232 |
| 658 | 3300049530 | Ga0501314_000485 | Ga0501314_000485_1112_1810 | 232 |
| 659 | 3300049530 | Ga0501314_001176 | Ga0501314_001176_653_1351 | 232 |
| 660 | 3300049531 | Ga0501315_000064 | Ga0501315_000064_1086_1784 | 232 |
| 661 | 3300049531 | Ga0501315_000281 | Ga0501315_000281_585_1283 | 232 |
| 662 | 3300049531 | Ga0501315_000629 | Ga0501315_000629_406_1104 | 232 |
| 663 | 3300049531 | Ga0501315_000715 | Ga0501315_000715_1705_2403 | 232 |
| 664 | 3300049531 | Ga0501315_001860 | Ga0501315_001860_688_1386 | 232 |
| 665 | 3300049531 | Ga0501315_002700 | Ga0501315_002700_554_1252 | 232 |
| 666 | 3300049531 | Ga0501315_019422 | Ga0501315_019422_153_851 | 232 |
| 667 | 3300049532 | Ga0501316_000593 | Ga0501316_000593_1368_2066 | 232 |
| 668 | 3300049532 | Ga0501316_000650 | Ga0501316_000650_406_1104 | 232 |
| 669 | 3300049532 | Ga0501316_005035 | Ga0501316_005035_515_1213 | 232 |
| 670 | 3300049533 | Ga0501317_001389 | Ga0501317_001389_678_1376 | 232 |
| 671 | 3300049533 | Ga0501317_003488 | Ga0501317_003488_473_1171 | 232 |
| 672 | 3300049533 | Ga0501317_005631 | Ga0501317_005631_510_1208 | 232 |
| 673 | 3300049533 | Ga0501317_005736 | Ga0501317_005736_465_1163 | 232 |
| 674 | 3300049534 | Ga0501318_000652 | Ga0501318_000652_984_1682 | 232 |
| 675 | 3300049534 | Ga0501318_001035 | Ga0501318_001035_933_1631 | 232 |
| 676 | 3300049535 | Ga0501319_000383 | Ga0501319_000383_651_1349 | 232 |
| 677 | 3300049535 | Ga0501319_000428 | Ga0501319_000428_593_1291 | 232 |
| 678 | 3300049536 | Ga0501320_000255 | Ga0501320_000255_603_1301 | 232 |
| 679 | 3300049536 | Ga0501320_000921 | Ga0501320_000921_863_1561 | 232 |
| 680 | 3300049536 | Ga0501320_002180 | Ga0501320_002180_201_899 | 232 |
| 681 | 3300049536 | Ga0501320_003081 | Ga0501320_003081_123_857 | 232 |
| 682 | 3300049536 | Ga0501320_005140 | Ga0501320_005140_342_1040 | 232 |
| 683 | 3300049537 | Ga0501321_000813 | Ga0501321_000813_1142_1840 | 232 |
| 684 | 3300049537 | Ga0501321_012501 | Ga0501321_012501_191_889 | 232 |
| 685 | 3300049537 | Ga0501321_022211 | Ga0501321_022211_33_731 | 232 |
| 686 | 3300049539 | Ga0501323_001783 | Ga0501323_001783_579_1277 | 232 |
| 687 | 3300049540 | Ga0501324_011105 | Ga0501324_011105_85_783 | 232 |
| 688 | 3300049545 | Ga0501329_00400 | Ga0501329_00400_431_1129 | 232 |
| 689 | 3300049547 | Ga0501331_01871 | Ga0501331_01871_128_826 | 232 |
| 690 | 3300049551 | Ga0501335_000798 | Ga0501335_000798_642_1340 | 232 |
| 691 | 3300049551 | Ga0501335_003543 | Ga0501335_003543_606_1304 | 232 |
| 692 | 3300049551 | Ga0501335_005839 | Ga0501335_005839_172_870 | 232 |
| 693 | 3300049552 | Ga0501336_000701 | Ga0501336_000701_764_1462 | 232 |
| 694 | 3300049662 | Ga0501222_006970 | Ga0501222_006970_644_1342 | 232 |
| 695 | 3300049663 | Ga0501223_002278 | Ga0501223_002278_3118_3816 | 232 |
| 696 | 3300049665 | Ga0501227_022071 | Ga0501227_022071_337_1035 | 232 |
| 697 | 3300049673 | Ga0501240_000074 | Ga0501240_000074_962_1660 | 232 |
| 698 | 3300049674 | Ga0501242_010894 | Ga0501242_010894_227_925 | 232 |
| 699 | 3300049686 | Ga0501257_002604 | Ga0501257_002604_2153_2851 | 232 |
| 700 | 3300049686 | Ga0501257_036651 | Ga0501257_036651_297_995 | 232 |
| 701 | 3300049705 | Ga0501225_0026515 | Ga0501225_0026515_684_1382 | 232 |
| 702 | 3300049758 | Ga0501241_001570 | Ga0501241_001570_3217_3915 | 232 |
| 703 | 3300049761 | Ga0501264_010699 | Ga0501264_010699_163_861 | 232 |
| 704 | 3300050493 | nmdc:mga0k408_173043_c1 | nmdc:mga0k408_173043_c1_19_717 | 232 |
| 705 | 3300050493 | nmdc:mga0k408_192815_c1 | nmdc:mga0k408_192815_c1_127_825 | 232 |
| 706 | 3300050493 | nmdc:mga0k408_350_c1 | nmdc:mga0k408_350_c1_9976_10674 | 232 |
| 707 | 3300050493 | nmdc:mga0k408_38765_c1 | nmdc:mga0k408_38765_c1_1480_2178 | 232 |
| 708 | 3300050493 | nmdc:mga0k408_4120_c1 | nmdc:mga0k408_4120_c1_5487_6185 | 232 |
| 709 | 3300050496 | nmdc:mga07m45_126407_c1 | nmdc:mga07m45_126407_c1_435_1133 | 232 |
| 710 | 3300050496 | nmdc:mga07m45_140197_c1 | nmdc:mga07m45_140197_c1_362_1060 | 232 |
| 711 | 3300050496 | nmdc:mga07m45_164171_c1 | nmdc:mga07m45_164171_c1_58_756 | 232 |
| 712 | 3300053080 | Ga0500635_0001097 | Ga0500635_0001097_1628_2326 | 232 |
| 713 | 3300053093 | Ga0500651_0000124 | Ga0500651_0000124_16317_17015 | 232 |
| 714 | 3300053122 | Ga0500608_006222 | Ga0500608_006222_2576_3274 | 232 |
| 715 | 3300053123 | Ga0500614_008477 | Ga0500614_008477_537_1235 | 232 |
| 716 | 3300053125 | Ga0500618_000080 | Ga0500618_000080_34785_35483 | 232 |
| 717 | 3300053130 | Ga0500642_0083553 | Ga0500642_0083553_682_1380 | 232 |
| 718 | 3300053140 | Ga0500573_0033087 | Ga0500573_0033087_1511_2209 | 232 |
| 719 | 3300053140 | Ga0500573_0225472 | Ga0500573_0225472_235_936 | 232 |
| 720 | 3300053154 | Ga0500619_063074 | Ga0500619_063074_482_1180 | 232 |
| 721 | 3300053156 | Ga0500622_0001219 | Ga0500622_0001219_13817_14515 | 232 |
| 722 | 3300053161 | Ga0500634_0114798 | Ga0500634_0114798_349_1047 | 232 |
| 723 | 3300059477 | Ga0587084_002476 | Ga0587084_002476_510_1208 | 232 |
| 724 | 3300059478 | Ga0587093_006246 | Ga0587093_006246_141_839 | 232 |
| 725 | 3300059490 | Ga0587066_003653 | Ga0587066_003653_711_1409 | 232 |
| 726 | 3300059491 | Ga0587070_015923 | Ga0587070_015923_443_1141 | 232 |
| 727 | 3300059492 | Ga0587073_0052786 | Ga0587073_0052786_110_808 | 232 |
| 728 | 3300059493 | Ga0587077_003067 | Ga0587077_003067_538_1236 | 232 |
| 729 | 3300059505 | Ga0587083_0012424 | Ga0587083_0012424_105_803 | 232 |
| 730 | 3300059506 | Ga0587085_003141 | Ga0587085_003141_757_1455 | 232 |
| 731 | 3300059507 | Ga0587086_004801 | Ga0587086_004801_711_1409 | 232 |
| 732 | 3300059508 | Ga0587088_011151 | Ga0587088_011151_128_826 | 232 |
| 733 | 3300059510 | Ga0587090_000102 | Ga0587090_000102_2987_3685 | 232 |
| 734 | 3300059510 | Ga0587090_001380 | Ga0587090_001380_711_1409 | 232 |
| 735 | 3300059511 | Ga0587091_001706 | Ga0587091_001706_1040_1738 | 232 |
| 736 | 3300059607 | Ga0587125_000722 | Ga0587125_000722_1169_1867 | 232 |
| 737 | 3300059623 | Ga0587101_004054 | Ga0587101_004054_404_1102 | 232 |
| 738 | 3300059624 | Ga0587109_002139 | Ga0587109_002139_718_1416 | 232 |
| 739 | 3300059639 | Ga0587062_000616 | Ga0587062_000616_1034_1732 | 232 |
| 740 | 3300059639 | Ga0587062_001829 | Ga0587062_001829_510_1208 | 232 |
| 741 | 3300059640 | Ga0587067_000818 | Ga0587067_000818_293_991 | 232 |
| 742 | 3300059643 | Ga0587072_005484 | Ga0587072_005484_445_1143 | 232 |
| 743 | 3300059645 | Ga0587076_000772 | Ga0587076_000772_1574_2272 | 232 |
| 744 | 3300059645 | Ga0587076_001127 | Ga0587076_001127_544_1242 | 232 |
| 745 | 3300059645 | Ga0587076_042404 | Ga0587076_042404_69_767 | 232 |
| 746 | 3300059647 | Ga0587079_005766 | Ga0587079_005766_481_1179 | 232 |
| 747 | 3300059653 | Ga0587108_000400 | Ga0587108_000400_762_1460 | 232 |
| 748 | 3300060346 | Ga0587111_0000072 | Ga0587111_0000072_3502_4200 | 232 |
| 749 | 3300060346 | Ga0587111_0006838 | Ga0587111_0006838_412_1110 | 232 |
| 750 | iso_pu_bacteria | 2738541284 | 2738763475 | 232 |
| 751 | iso_pu_bacteria | 2852627209 | 2852629339 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vpl-assembly1.cif.gz_A | the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii | 0.976 | 3 | 225 |
| 2hw8-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9719 | 6 | 225 |
| 4wpo-assembly1.cif.gz_AC | crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state | 0.9675 | 6 | 225 |
| 5npm-assembly1.cif.gz_A | crystal structure of mutant ribosomal protein tthl1 lacking 8 n-terminal residues in complex with 80nt 23s rna from thermus thermophilus | 0.9673 | 19 | 227 |
| 4v9h-assembly1.cif.gz_BC | crystal structure of the ribosome bound to elongation factor g in the guanosine triphosphatase state | 0.9673 | 3 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.984 | 73 | 159 | 3.40.50.790 |
| af_P9WHC7_16_229_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9805 | 16 | 225 | 3.30.190.20 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9749 | 19 | 232 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.973 | 73 | 159 | 3.40.50.790 |
| 2wrrC01 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9727 | 16 | 225 | 3.30.190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3PGT9-F1-model_v4 | deleted | 0.9916 | 1 | 230 |
|
| AF-A0A3D0FNT0-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9916 | 1 | 229 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A699PAG0-F1-model_v4 | deleted | 0.9906 | 7 | 226 |
|
| AF-A0A2E6BUT7-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9898 | 3 | 228 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A6A5LA17-F1-model_v4 | deleted | 0.9896 | 1 | 232 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar