F479059

General Info

Members Datasets Scaffolds Average Seq Length
750 402 1500 87

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0160584|Ga0466958_0160584_246_506
Length 86
Sequence MKYRSRTDIVAQILEAANGGGATKTKIMYKAYLSYAQLKEYLTVLLESGLIEYQEGKQEYRTTAKGIQFLSTYGQIGQMIIAPTAE

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
21 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
111 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
112 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
113 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
114 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
115 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
116 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
117 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
118 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
119 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
120 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
121 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
122 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
123 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
124 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
125 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
126 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
127 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
128 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
129 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
130 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
131 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
132 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
133 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
134 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
135 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
136 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
137 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
149 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
225 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
226 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
233 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
242 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
252 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
255 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
258 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
259 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
260 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
261 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
262 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
263 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
264 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
265 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
266 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
270 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
308 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
309 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
310 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
311 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
312 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
313 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
314 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
335 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
336 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
339 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
340 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
341 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
342 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
343 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
344 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
345 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
346 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
347 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
348 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
349 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
350 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
351 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
352 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
353 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
354 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
355 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
356 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
357 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
358 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
359 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
360 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
361 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
362 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
363 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
364 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
365 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
366 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
367 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
368 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
371 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
372 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
373 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
374 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
375 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
376 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
377 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
378 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
379 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
380 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
381 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
382 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
387 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
388 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
399 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
400 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.53
Rhizosphere 97.47
Stem 0
Stem Tuber 0
Unclassified 5.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0160584 3300045836 Archaea 1420
2 2214771050 2209111006 Archaea 796
3 ARSoilYngRDRAFT_c00435 3300000042 Archaea 5225
4 ARSoilYngRDRAFT_c00956 3300000042 Archaea 2089
5 ARSoilYngRDRAFT_c02421 3300000042 Archaea 739
6 ARcpr5yngRDRAFT_c000737 3300000043 Archaea 4015
7 ARcpr5yngRDRAFT_c023474 3300000043 Archaea 526
8 ARSoilOldRDRAFT_c000562 3300000044 Archaea 4090
9 ARSoilOldRDRAFT_c000816 3300000044 Archaea 3136
10 ARCol0oldRDRAFT_c01463 3300000045 Archaea 1523
11 ARCol0yngRDRAFT_1000526 3300000652 Archaea 4415
12 ARCol0yngRDRAFT_1000888 3300000652 Archaea 2694
13 JGI24736J21556_1007396 3300001904 Archaea 1846
14 JGI24746J21847_1010481 3300001977 Archaea 1373
15 JGI24739J22299_10069033 3300001989 Archaea 1102
16 JGI24737J22298_10058163 3300001990 Archaea 1166
17 JGI24745J21846_1048022 3300002073 Archaea 538
18 JGI24738J21930_10076026 3300002075 Archaea 699
19 JGI24738J21930_10094221 3300002075 Bacteria 635
20 JGI24744J21845_10015036 3300002077 Archaea 1549
21 JGI24035J26624_1015950 3300002126 Archaea 772
22 JGI24034J26672_10053830 3300002239 Archaea 696
23 JGI24742J22300_10032598 3300002244 Archaea 914
24 JGI25407J50210_10005565 3300003373 Archaea 3102
25 JGI25407J50210_10158909 3300003373 Archaea 556
26 JGI25405J52794_10011141 3300003911 Archaea 1719
27 Ga0065717_1002314 3300005276 Archaea 2193
28 Ga0065717_1006013 3300005276 Archaea 833
29 Ga0065716_1007484 3300005277 Archaea 752
30 Ga0065715_10001243 3300005293 Archaea 6691
31 Ga0065715_10092229 3300005293 Archaea 5242
32 Ga0070676_10014209 3300005328 Archaea 4374
33 Ga0070683_100030283 3300005329 Bacteria 4910
34 Ga0070690_100099537 3300005330 Archaea 1926
35 Ga0070690_100645457 3300005330 Archaea 808
36 Ga0070670_100669863 3300005331 Archaea 932
37 Ga0070670_100910626 3300005331 Bacteria 797
38 Ga0068869_100984481 3300005334 Archaea 733
39 Ga0070680_100063872 3300005336 Archaea 3017
40 Ga0070680_100092042 3300005336 Archaea 2510
41 Ga0068868_100030287 3300005338 Archaea 4150
42 Ga0068868_100235354 3300005338 Archaea 1537
43 Ga0070660_100470836 3300005339 Archaea 1043
44 Ga0070687_100002651 3300005343 Archaea 6769
45 Ga0070692_10280296 3300005345 Archaea 1010
46 Ga0070692_10408485 3300005345 Archaea 859
47 Ga0070692_10934730 3300005345 Bacteria 602
48 Ga0070668_100293359 3300005347 Archaea 1362
49 Ga0070669_100605064 3300005353 Archaea 918
50 Ga0070675_101155251 3300005354 Archaea 712
51 Ga0070674_100056133 3300005356 Archaea 2730
52 Ga0070673_100969561 3300005364 Archaea 791
53 Ga0070688_100322045 3300005365 Archaea 1124
54 Ga0070659_100143342 3300005366 Archaea 1945
55 Ga0070659_101454678 3300005366 Archaea 610
56 Ga0070667_100008908 3300005367 Archaea 8304
57 Ga0070667_101388422 3300005367 Archaea 659
58 Ga0070709_10065638 3300005434 Archaea 2325
59 Ga0070709_10380903 3300005434 Archaea 1049
60 Ga0070714_100054504 3300005435 Archaea 3415
61 Ga0070713_100031551 3300005436 Archaea 4222
62 Ga0070713_100683826 3300005436 Bacteria 979
63 Ga0070710_10134774 3300005437 Archaea 1509
64 Ga0070701_10028528 3300005438 Archaea 2744
65 Ga0070701_10099091 3300005438 Archaea 1611
66 Ga0070701_10190109 3300005438 Archaea 1207
67 Ga0070711_100010549 3300005439 Archaea 5720
68 Ga0070705_100007698 3300005440 Archaea 5315
69 Ga0070705_100038060 3300005440 Archaea 2718
70 Ga0070705_100049762 3300005440 Archaea 2435
71 Ga0070705_100341122 3300005440 Bacteria 1089
72 Ga0070705_100868852 3300005440 Unclassified 723
73 Ga0070700_100676818 3300005441 Archaea 817
74 Ga0070694_100000471 3300005444 Archaea 22060
75 Ga0070694_100000655 3300005444 Archaea 19146
76 Ga0070694_100004093 3300005444 Archaea 8751
77 Ga0070694_100011755 3300005444 Archaea 5427
78 Ga0070694_100018856 3300005444 Archaea 4383
79 Ga0070694_100057690 3300005444 Archaea 2640
80 Ga0070694_100114377 3300005444 Archaea 1927
81 Ga0070694_101771398 3300005444 Unclassified 526
82 Ga0070708_100007367 3300005445 Archaea 8804
83 Ga0070708_100007967 3300005445 Archaea 8487
84 Ga0070708_100083507 3300005445 Archaea 2896
85 Ga0070708_100105363 3300005445 Archaea 2587
86 Ga0070663_100203643 3300005455 Bacteria 1546
87 Ga0070663_100327506 3300005455 Archaea 1234
88 Ga0070678_100242512 3300005456 Archaea 1508
89 Ga0070662_100126622 3300005457 Archaea 1964
90 Ga0070662_100161937 3300005457 Archaea 1750
91 Ga0070662_101927699 3300005457 Unclassified 510
92 Ga0068867_100022098 3300005459 Archaea 4545
93 Ga0068867_100381883 3300005459 Archaea 1183
94 Ga0070685_10026176 3300005466 Archaea 3213
95 Ga0070706_100671252 3300005467 Archaea 962
96 Ga0070707_100040324 3300005468 Archaea 4468
97 Ga0070707_100092858 3300005468 Unclassified 2922
98 Ga0070707_100128067 3300005468 Archaea 2467
99 Ga0070707_100739428 3300005468 Archaea 947
100 Ga0070707_101163619 3300005468 Unclassified 737
101 Ga0070698_100008571 3300005471 Archaea 11031
102 Ga0070698_100043590 3300005471 Archaea 4599
103 Ga0070698_100432276 3300005471 Archaea 1251
104 Ga0070698_102129336 3300005471 Unclassified 514
105 Ga0070699_100051944 3300005518 Archaea 3549
106 Ga0070699_100161121 3300005518 Archaea 1985
107 Ga0070699_100249960 3300005518 Archaea 1584
108 Ga0070699_100609882 3300005518 Archaea 995
109 Ga0070684_100099505 3300005535 Bacteria 2595
110 Ga0070684_100439887 3300005535 Archaea 1204
111 Ga0070697_100014220 3300005536 Archaea 6252
112 Ga0070697_100021143 3300005536 Archaea 5154
113 Ga0070697_100037323 3300005536 Archaea 3926
114 Ga0070697_100134358 3300005536 Archaea 2077
115 Ga0070697_100215857 3300005536 Archaea 1634
116 Ga0070697_100319424 3300005536 Archaea 1337
117 Ga0070697_100490065 3300005536 Archaea 1074
118 Ga0070697_100535496 3300005536 Archaea 1026
119 Ga0070697_100949302 3300005536 Unclassified 764
120 Ga0068853_101339730 3300005539 Archaea 692
121 Ga0068853_101691948 3300005539 Bacteria 613
122 Ga0070672_100001596 3300005543 Archaea 14062
123 Ga0070672_100636927 3300005543 Archaea 930
124 Ga0070686_100209898 3300005544 Archaea 1401
125 Ga0070686_100726111 3300005544 Archaea 794
126 Ga0070695_100009381 3300005545 Archaea 5822
127 Ga0070695_100074844 3300005545 Archaea 2226
128 Ga0070695_100179755 3300005545 Archaea 1498
129 Ga0070695_100476073 3300005545 Archaea 961
130 Ga0070695_100953278 3300005545 Archaea 696
131 Ga0070696_100012450 3300005546 Archaea 5708
132 Ga0070696_100063974 3300005546 Archaea 2577
133 Ga0070696_100486390 3300005546 Archaea 979
134 Ga0070696_101496609 3300005546 Archaea 578
135 Ga0070693_100005801 3300005547 Archaea 5965
136 Ga0070693_100136944 3300005547 Archaea 1537
137 Ga0070665_102532017 3300005548 Archaea 514
138 Ga0070704_100004459 3300005549 Archaea 8084
139 Ga0070704_100005217 3300005549 Archaea 7560
140 Ga0070704_100007263 3300005549 Archaea 6589
141 Ga0070704_100012797 3300005549 Archaea 5188
142 Ga0070704_100077272 3300005549 Archaea 2438
143 Ga0070704_100104562 3300005549 Archaea 2142
144 Ga0070704_100455640 3300005549 Archaea 1102
145 Ga0070704_101602886 3300005549 Archaea 600
146 Ga0068855_100814870 3300005563 Archaea 991
147 Ga0070664_100217729 3300005564 Archaea 1708
148 Ga0068857_101637748 3300005577 Archaea 629
149 Ga0068854_100377951 3300005578 Archaea 1167
150 Ga0068854_100439893 3300005578 Archaea 1087
151 Ga0068854_101045154 3300005578 Archaea 725
152 Ga0068856_100003464 3300005614 Archaea 15953
153 Ga0070702_100053367 3300005615 Archaea 2322
154 Ga0070702_100141791 3300005615 Archaea 1531
155 Ga0070702_100360321 3300005615 Archaea 1027
156 Ga0068852_100693134 3300005616 Archaea 1028
157 Ga0068852_101875002 3300005616 Archaea 622
158 Ga0068859_100096524 3300005617 Archaea 3008
159 Ga0068864_100295175 3300005618 Bacteria 1516
160 Ga0068864_100652542 3300005618 Archaea 1025
161 Ga0068864_101221694 3300005618 Archaea 751
162 Ga0068866_10385916 3300005718 Archaea 899
163 Ga0068866_10592110 3300005718 Archaea 747
164 Ga0068861_100559156 3300005719 Archaea 1044
165 Ga0068870_10641145 3300005840 Archaea 726
166 Ga0068860_100020428 3300005843 Unclassified 6414
167 Ga0068860_101712132 3300005843 Archaea 651
168 Ga0068862_100003644 3300005844 Archaea 13179
169 Ga0068862_102634282 3300005844 Archaea 515
170 Ga0081538_10000870 3300005981 Archaea 32608
171 Ga0081538_10007060 3300005981 Archaea 9767
172 Ga0081538_10008967 3300005981 Archaea 8405
173 Ga0081538_10021781 3300005981 Archaea 4665
174 Ga0081538_10038955 3300005981 Archaea 3056
175 Ga0070716_100021424 3300006173 Archaea 3407
176 Ga0075427_10058429 3300006194 Archaea 673
177 Ga0097621_100001858 3300006237 Archaea 14478
178 Ga0097621_100073875 3300006237 Archaea 2824
179 Ga0097621_102376768 3300006237 Archaea 507
180 Ga0068871_100058833 3300006358 Archaea 3130
181 Ga0068871_100103181 3300006358 Archaea 2391
182 Ga0075428_100010341 3300006844 Archaea 10356
183 Ga0075428_100018755 3300006844 Archaea 7650
184 Ga0075428_100225417 3300006844 Archaea 2023
185 Ga0075428_100301268 3300006844 Archaea 1723
186 Ga0075428_100430104 3300006844 Bacteria 1414
187 Ga0075430_100000759 3300006846 Archaea 24883
188 Ga0075430_100529077 3300006846 Archaea 972
189 Ga0075431_100253985 3300006847 Archaea 1785
190 Ga0075431_100317555 3300006847 Archaea 1571
191 Ga0075431_100898286 3300006847 Archaea 856
192 Ga0075433_10075245 3300006852 Archaea 2971
193 Ga0075433_10245473 3300006852 Bacteria 1589
194 Ga0075434_100017957 3300006871 Archaea 6825
195 Ga0075429_100042304 3300006880 Archaea 3965
196 Ga0075429_100121246 3300006880 Archaea 2286
197 Ga0075429_100932490 3300006880 Archaea 760
198 Ga0075429_101276357 3300006880 Archaea 641
199 Ga0068865_100657154 3300006881 Archaea 891
200 Ga0068865_100785115 3300006881 Archaea 820
201 Ga0097620_100096524 3300006931 Archaea 3008
202 Ga0075435_100068318 3300007076 Archaea 2895
203 Ga0075435_100584084 3300007076 Archaea 968
204 Ga0105244_10128936 3300009036 Archaea 1221
205 Ga0105244_10239506 3300009036 Archaea 848
206 Ga0105250_10345302 3300009092 Archaea 651
207 Ga0111539_10145859 3300009094 Archaea 2771
208 Ga0111539_10367516 3300009094 Archaea 1674
209 Ga0111539_10414558 3300009094 Archaea 1569
210 Ga0111539_10566638 3300009094 Bacteria 1323
211 Ga0111539_10628856 3300009094 Archaea 1250
212 Ga0105245_10076858 3300009098 Archaea 3042
213 Ga0114129_10009444 3300009147 Archaea 13901
214 Ga0114129_10023465 3300009147 Archaea 8745
215 Ga0114129_10083492 3300009147 Archaea 4437
216 Ga0114129_10172163 3300009147 Archaea 2951
217 Ga0114129_10185328 3300009147 Archaea 2829
218 Ga0114129_10203795 3300009147 Plasmid 2678
219 Ga0114129_10940969 3300009147 Archaea 1092
220 Ga0105243_11429561 3300009148 Archaea 713
221 Ga0105243_11967540 3300009148 Archaea 618
222 Ga0105241_10051819 3300009174 Archaea 3131
223 Ga0105242_10073956 3300009176 Archaea 2834
224 Ga0105242_10514842 3300009176 Archaea 1140
225 Ga0105242_11324030 3300009176 Archaea 745
226 Ga0105237_10041965 3300009545 Archaea 4613
227 Ga0105249_10167116 3300009553 Archaea 2130
228 Ga0105249_11937670 3300009553 Archaea 662
229 Ga0105239_10612057 3300010375 Archaea 1243
230 Ga0105239_10800354 3300010375 Archaea 1080
231 Ga0105239_11668313 3300010375 Bacteria 737
232 Ga0105239_12976449 3300010375 Unclassified 552
233 Ga0105239_12999150 3300010375 Archaea 550
234 Ga0105246_10096921 3300011119 Archaea 2139
235 Ga0105246_10151269 3300011119 Archaea 1757
236 Ga0105246_10926174 3300011119 Bacteria 783
237 Ga0157340_1001377 3300012473 Archaea 1108
238 Ga0157317_1002756 3300012475 Archaea 1057
239 Ga0157344_1009899 3300012476 Archaea 678
240 Ga0157336_1003747 3300012477 Archaea 929
241 Ga0157328_1000558 3300012478 Archaea 1380
242 Ga0157346_1004624 3300012480 Archaea 821
243 Ga0157320_1011343 3300012481 Archaea 701
244 Ga0157318_1007905 3300012482 Archaea 735
245 Ga0157337_1000305 3300012483 Archaea 2259
246 Ga0157337_1000634 3300012483 Archaea 1659
247 Ga0157325_1000636 3300012485 Archaea 1445
248 Ga0157325_1034827 3300012485 Archaea 523
249 Ga0157325_1041317 3300012485 Archaea 502
250 Ga0157321_1000144 3300012487 Archaea 3065
251 Ga0157343_1000444 3300012488 Archaea 1651
252 Ga0157322_1005418 3300012490 Archaea 876
253 Ga0157329_1000289 3300012491 Archaea 1767
254 Ga0157335_1007487 3300012492 Archaea 816
255 Ga0157341_1000177 3300012494 Archaea 2876
256 Ga0157341_1008350 3300012494 Archaea 844
257 Ga0157319_1014621 3300012497 Archaea 691
258 Ga0157345_1001193 3300012498 Archaea 1857
259 Ga0157345_1005255 3300012498 Archaea 996
260 Ga0157314_1000957 3300012500 Archaea 2294
261 Ga0157313_1003634 3300012503 Archaea 1010
262 Ga0157339_1000151 3300012505 Archaea 3238
263 Ga0157324_1004996 3300012506 Archaea 940
264 Ga0157342_1040094 3300012507 Archaea 624
265 Ga0157315_1031675 3300012508 Archaea 624
266 Ga0157316_1001140 3300012510 Archaea 1577
267 Ga0157316_1004615 3300012510 Archaea 1053
268 Ga0157327_1003616 3300012512 Archaea 1151
269 Ga0157327_1004830 3300012512 Archaea 1064
270 Ga0157326_1050802 3300012513 Archaea 609
271 Ga0157338_1008281 3300012515 Archaea 1005
272 Ga0157371_10018852 3300013102 Archaea 5097
273 Ga0157370_10883140 3300013104 Bacteria 812
274 Ga0157374_10001217 3300013296 Archaea 21996
275 Ga0157374_10001323 3300013296 Archaea 21101
276 Ga0157378_10007250 3300013297 Archaea 9680
277 Ga0157378_10023864 3300013297 Bacteria 5380
278 Ga0163162_10566902 3300013306 Archaea 1263
279 Ga0157372_10014247 3300013307 Archaea 8500
280 Ga0157372_10659513 3300013307 Archaea 1218
281 Ga0157372_11830302 3300013307 Archaea 698
282 Ga0157372_11914362 3300013307 Archaea 682
283 Ga0157375_10037241 3300013308 Archaea 4659
284 Ga0182008_10129498 3300014497 Archaea 1258
285 Ga0182008_10223679 3300014497 Archaea 964
286 Ga0182008_10261093 3300014497 Unclassified 896
287 Ga0182008_10774122 3300014497 Unclassified 555
288 Ga0157377_10002187 3300014745 Archaea 8602
289 Ga0157377_10210768 3300014745 Archaea 1239
290 Ga0182006_1175211 3300015261 Archaea 717
291 Ga0182005_1031639 3300015265 Archaea 1441
292 Ga0197907_10236254 3300020069 Bacteria 1345
293 Ga0206352_10056126 3300020078 Archaea 3359
294 Ga0207673_1004601 3300025290 Archaea 1656
295 Ga0207697_10017284 3300025315 Archaea 2965
296 Ga0207692_10132637 3300025898 Archaea 1409
297 Ga0207642_10472699 3300025899 Archaea 763
298 Ga0207642_11072389 3300025899 Archaea 520
299 Ga0207688_10000719 3300025901 Archaea 16407
300 Ga0207688_10134098 3300025901 Archaea 1453
301 Ga0207647_10094525 3300025904 Archaea 1780
302 Ga0207647_10560075 3300025904 Bacteria 633
303 Ga0207699_10088713 3300025906 Archaea 1936
304 Ga0207645_10063458 3300025907 Archaea 2360
305 Ga0207643_10063682 3300025908 Archaea 2109
306 Ga0207705_11031605 3300025909 Bacteria 635
307 Ga0207684_10062544 3300025910 Archaea 3161
308 Ga0207654_10215679 3300025911 Bacteria 1270
309 Ga0207671_10129958 3300025914 Archaea 1933
310 Ga0207693_10435874 3300025915 Bacteria 1024
311 Ga0207660_10014791 3300025917 Archaea 5142
312 Ga0207660_10097011 3300025917 Archaea 2196
313 Ga0207660_10992419 3300025917 Bacteria 685
314 Ga0207662_10034360 3300025918 Archaea 2959
315 Ga0207657_10353911 3300025919 Archaea 1158
316 Ga0207657_10746979 3300025919 Bacteria 758
317 Ga0207652_10846029 3300025921 Bacteria 810
318 Ga0207646_10015036 3300025922 Archaea 7325
319 Ga0207646_10094280 3300025922 Archaea 2681
320 Ga0207646_10111432 3300025922 Archaea 2456
321 Ga0207646_10226055 3300025922 Archaea 1691
322 Ga0207646_10599358 3300025922 Unclassified 989
323 Ga0207646_10935419 3300025922 Unclassified 768
324 Ga0207646_11323161 3300025922 Archaea 629
325 Ga0207681_10053703 3300025923 Archaea 2736
326 Ga0207650_10684580 3300025925 Archaea 866
327 Ga0207650_11804288 3300025925 Bacteria 517
328 Ga0207659_10608716 3300025926 Archaea 932
329 Ga0207659_10731321 3300025926 Archaea 848
330 Ga0207687_10711903 3300025927 Archaea 853
331 Ga0207700_10179451 3300025928 Archaea 1772
332 Ga0207664_10001451 3300025929 Archaea 15573
333 Ga0207690_10188154 3300025932 Archaea 1559
334 Ga0207690_10871071 3300025932 Archaea 746
335 Ga0207690_11103910 3300025932 Bacteria 661
336 Ga0207706_10002934 3300025933 Archaea 16484
337 Ga0207686_10273241 3300025934 Archaea 1244
338 Ga0207670_10997306 3300025936 Archaea 704
339 Ga0207704_10010169 3300025938 Archaea 4575
340 Ga0207704_10035133 3300025938 Archaea 2869
341 Ga0207691_10005575 3300025940 Archaea 12159
342 Ga0207691_10417631 3300025940 Archaea 1143
343 Ga0207661_10356458 3300025944 Archaea 1321
344 Ga0207661_10562485 3300025944 Bacteria 1045
345 Ga0207661_12054221 3300025944 Archaea 517
346 Ga0207679_10220626 3300025945 Bacteria 1595
347 Ga0207679_11041597 3300025945 Archaea 750
348 Ga0207667_10956499 3300025949 Archaea 846
349 Ga0207651_10298455 3300025960 Archaea 1339
350 Ga0207712_10006794 3300025961 Archaea 7215
351 Ga0207712_10689190 3300025961 Archaea 891
352 Ga0207640_10167648 3300025981 Archaea 1633
353 Ga0207640_11043293 3300025981 Archaea 721
354 Ga0207640_11049531 3300025981 Archaea 719
355 Ga0207658_10009469 3300025986 Archaea 6609
356 Ga0207677_10015031 3300026023 Archaea 4539
357 Ga0207677_10163168 3300026023 Bacteria 1734
358 Ga0207703_10257559 3300026035 Archaea 1576
359 Ga0207639_10529446 3300026041 Archaea 1080
360 Ga0207639_10773948 3300026041 Bacteria 893
361 Ga0207678_10861937 3300026067 Bacteria 800
362 Ga0207678_11923197 3300026067 Archaea 516
363 Ga0207708_10005187 3300026075 Archaea 9609
364 Ga0207708_10039715 3300026075 Archaea 3586
365 Ga0207708_10575367 3300026075 Archaea 952
366 Ga0207702_10005299 3300026078 Archaea 11311
367 Ga0207702_12467781 3300026078 Archaea 507
368 Ga0207648_10036483 3300026089 Archaea 4331
369 Ga0207676_10118489 3300026095 Archaea 2228
370 Ga0207676_10139578 3300026095 Bacteria 2073
371 Ga0207676_11286079 3300026095 Archaea 726
372 Ga0207674_10085931 3300026116 Archaea 3140
373 Ga0207674_10276013 3300026116 Archaea 1629
374 Ga0207675_100079582 3300026118 Archaea 3071
375 Ga0207675_100246400 3300026118 Archaea 1728
376 Ga0207683_10187751 3300026121 Archaea 1876
377 Ga0207698_11159429 3300026142 Archaea 786
378 Ga0209974_10073402 3300027876 Archaea 1170
379 Ga0207428_10004953 3300027907 Archaea 12540
380 Ga0207428_10079015 3300027907 Archaea 2573
381 Ga0207428_10231506 3300027907 Archaea 1383
382 Ga0207428_10847683 3300027907 Archaea 647
383 Ga0268266_11410517 3300028379 Archaea 672
384 Ga0268265_10342070 3300028380 Archaea 1363
385 Ga0268265_10804350 3300028380 Archaea 916
386 Ga0268264_10008262 3300028381 Archaea 8645
387 Ga0307408_100005013 3300031548 Archaea 8883
388 Ga0307408_100053912 3300031548 Archaea 2906
389 Ga0307408_100316077 3300031548 Bacteria 1314
390 Ga0307408_100978176 3300031548 Archaea 779
391 Ga0307405_10002386 3300031731 Archaea 8275
392 Ga0307413_10030103 3300031824 Archaea 3045
393 Ga0307413_10648459 3300031824 Archaea 870
394 Ga0307410_10003783 3300031852 Archaea 7679
395 Ga0307410_10060448 3300031852 Archaea 2589
396 Ga0307410_10083992 3300031852 Archaea 2244
397 Ga0307410_10250582 3300031852 Archaea 1376
398 Ga0307410_11794703 3300031852 Archaea 545
399 Ga0307406_10066172 3300031901 Archaea 2351
400 Ga0307406_10092613 3300031901 Archaea 2038
401 Ga0307406_11260843 3300031901 Archaea 644
402 Ga0307406_11831233 3300031901 Archaea 540
403 Ga0307407_10000141 3300031903 Archaea 22165
404 Ga0307407_10058095 3300031903 Archaea 2247
405 Ga0307407_10216190 3300031903 Archaea 1293
406 Ga0307412_10005291 3300031911 Archaea 7243
407 Ga0307412_10139504 3300031911 Archaea 1773
408 Ga0307409_100034034 3300031995 Archaea 3716
409 Ga0307409_100344515 3300031995 Archaea 1404
410 Ga0307416_100034790 3300032002 Archaea 3838
411 Ga0307416_100231088 3300032002 Archaea 1783
412 Ga0307416_100410044 3300032002 Archaea 1395
413 Ga0307416_100445518 3300032002 Archaea 1346
414 Ga0307414_10005902 3300032004 Archaea 6777
415 Ga0307414_10149506 3300032004 Archaea 1840
416 Ga0307414_11820929 3300032004 Archaea 568
417 Ga0307411_10030995 3300032005 Archaea 3284
418 Ga0307411_10037111 3300032005 Archaea 3060
419 Ga0307411_10071129 3300032005 Archaea 2357
420 Ga0307411_11135542 3300032005 Archaea 706
421 Ga0307411_11484686 3300032005 Archaea 622
422 Ga0307415_100049774 3300032126 Archaea 2835
423 Ga0307415_101019146 3300032126 Archaea 770
424 Ga0373930_0107786 3300034816 Archaea 668
425 Ga0373950_0104013 3300034818 Archaea 614
426 Ga0373938_0036682 3300034957 Archaea 1074
427 Ga0373926_0046234 3300035083 Archaea 1562
428 Ga0373929_0083363 3300035085 Archaea 783
429 Ga0373934_0003081 3300035086 Archaea 6087
430 Ga0373940_0023262 3300035088 Archaea 1598
431 Ga0373944_0270283 3300035089 Archaea 632
432 Ga0373949_0022636 3300035090 Archaea 1450
433 Ga0373951_0008067 3300035091 Archaea 2387
434 Ga0373952_0055970 3300035092 Archaea 952
435 Ga0373923_0620965 3300035111 Archaea 533
436 Ga0373932_0108377 3300035112 Archaea 912
437 Ga0373936_0188708 3300035113 Archaea 906
438 Ga0373939_0220794 3300035114 Archaea 725
439 Ga0373941_0126772 3300035115 Archaea 916
440 Ga0373953_0001043 3300035117 Bacteria 7845
441 Ga0373954_0000711 3300035118 Archaea 12804
442 Ga0373956_0003675 3300035119 Bacteria 6191
443 Ga0373957_0000847 3300035120 Bacteria 8011
444 Ga0373960_0003868 3300035121 Archaea 3409
445 Ga0373946_0257268 3300035171 Archaea 853
446 Ga0373955_0000511 3300035172 Archaea 16502
447 Ga0373942_0010078 3300035207 Archaea 2218
448 Ga0373961_0001794 3300035241 Archaea 5911
449 Ga0373962_0162490 3300035242 Archaea 737
450 Ga0373924_0001345 3300035410 Bacteria 7919
451 Ga0373931_0011196 3300035691 Archaea 4329
452 Ga0373935_0596416 3300035692 Archaea 807
453 Ga0373933_0001116 3300035724 Archaea 15986
454 Ga0373947_0120310 3300035725 Archaea 1667
455 Ga0373937_0002289 3300036401 Archaea 15987
456 Ga0373925_0157290 3300037068 Archaea 1788
457 Ga0242420_026949 3300038996 Archaea 1051
458 Ga0439438_019254 3300041405 Archaea 1931
459 Ga0439438_085798 3300041405 Archaea 770
460 Ga0439439_0156100 3300041406 Archaea 649
461 Ga0439461_0039926 3300041410 Archaea 1010
462 Ga0439466_0065053 3300041411 Archaea 1169
463 Ga0439466_0125806 3300041411 Archaea 790
464 Ga0439465_0134425 3300041413 Archaea 875
465 Ga0451798_0119670 3300041458 Archaea 600
466 Ga0439431_0029131 3300041997 Unclassified 1363
467 Ga0439442_122405 3300042002 Unclassified 570
468 Ga0439452_052513 3300042010 Archaea 930
469 Ga0439455_0018234 3300042012 Archaea 1645
470 Ga0439456_041917 3300042013 Archaea 993
471 Ga0439456_085564 3300042013 Archaea 706
472 Ga0450920_005641 3300042122 Archaea 2230
473 Ga0450923_001071 3300042125 Archaea 3452
474 Ga0450923_020504 3300042125 Archaea 1282
475 Ga0450906_000763 3300042145 Archaea 6997
476 Ga0450910_010690 3300042147 Archaea 1311
477 Ga0439446_0001103 3300042156 Archaea 5973
478 Ga0439446_0071205 3300042156 Archaea 1064
479 Ga0439434_0019584 3300042435 Archaea 2029
480 Ga0439434_0033868 3300042435 Archaea 1558
481 Ga0439460_0009104 3300042461 Archaea 2516
482 Ga0450893_0008487 3300042532 Archaea 1671
483 Ga0451577_0241353 3300042876 Archaea 1635
484 Ga0451577_1099942 3300042876 Archaea 711
485 Ga0466964_0373571 3300044706 Archaea 738
486 Ga0453684_0132177 3300044712 Archaea 2993
487 Ga0466957_1043195 3300044842 Archaea 588
488 Ga0466960_0049755 3300044901 Archaea 2019
489 Ga0451576_0016093 3300045051 Archaea 8262
490 Ga0466967_0746142 3300045976 Archaea 971
491 Ga0495592_0008619 3300046454 Bacteria 7652
492 Ga0495603_0435284 3300046455 Archaea 751
493 Ga0495629_1101281 3300046459 Archaea 513
494 Ga0495651_0005537 3300046462 Bacteria 9630
495 Ga0495653_0017429 3300046463 Archaea 5842
496 Ga0495664_0051449 3300046477 Bacteria 2446
497 Ga0495608_0036654 3300046511 Archaea 3301
498 Ga0495628_0071279 3300046516 Bacteria 2709
499 Ga0495652_0003318 3300046529 Archaea 15979
500 Ga0495587_0001360 3300046536 Archaea 16234
501 Ga0495645_0007313 3300046543 Bacteria 7681
502 Ga0495635_0164223 3300046663 Archaea 1511
503 Ga0495657_0016261 3300046675 Bacteria 5423
504 Ga0495599_0007544 3300046678 Bacteria 6598
505 Ga0495646_0022605 3300046680 Bacteria 3965
506 Ga0495658_0398060 3300046683 Archaea 878
507 Ga0495600_0029090 3300046809 Bacteria 3577
508 Ga0495680_0119691 3300047322 Archaea 1945
509 Ga0495675_0003953 3300047444 Bacteria 8985
510 Ga0495684_0129535 3300047471 Archaea 1896
511 Ga0495602_0003576 3300048088 Archaea 16090
512 Ga0496100_0051061 3300048903 Archaea 2683
513 Ga0496100_0056704 3300048903 Archaea 2564
514 Ga0496100_0389091 3300048903 Archaea 1060
515 Ga0496101_0107248 3300048904 Archaea 2098
516 Ga0496101_0280999 3300048904 Bacteria 1301
517 Ga0496102_0014507 3300048905 Archaea 6846
518 Ga0496102_0559687 3300048905 Archaea 1066
519 Ga0496102_0572645 3300048905 Bacteria 1052
520 Ga0496103_0015422 3300048906 Archaea 4547
521 Ga0496106_0024211 3300048909 Archaea 4512
522 Ga0496106_0294580 3300048909 Bacteria 1301
523 Ga0496107_0051934 3300048910 Archaea 2957
524 Ga0496107_0399181 3300048910 Bacteria 1023
525 Ga0496107_0520214 3300048910 Archaea 882
526 Ga0496109_0759593 3300048912 Bacteria 907
527 Ga0496110_0078971 3300048913 Archaea 2930
528 Ga0496110_1892888 3300048913 Archaea 507
529 Ga0496111_0266219 3300048914 Archaea 1271
530 Ga0501290_017107 3300049513 Archaea 970
531 Ga0501290_025852 3300049513 Archaea 823
532 Ga0501290_066278 3300049513 Archaea 591
533 Ga0501291_001794 3300049514 Archaea 2507
534 Ga0501291_048393 3300049514 Archaea 767
535 Ga0501292_004406 3300049515 Archaea 1926
536 Ga0501295_039050 3300049518 Archaea 976
537 Ga0501296_005482 3300049519 Archaea 1418
538 Ga0501298_002723 3300049521 Archaea 2696
539 Ga0501298_005786 3300049521 Archaea 1999
540 Ga0501298_087764 3300049521 Bacteria 693
541 Ga0501323_069018 3300049539 Unclassified 563
542 Ga0501325_038874 3300049541 Unclassified 572
543 Ga0501031_0095611 3300049568 Archaea 1938
544 Ga0501031_0490485 3300049568 Archaea 793
545 Ga0501032_0003458 3300049569 Archaea 12097
546 Ga0501032_0401730 3300049569 Archaea 880
547 Ga0501034_0001592 3300049571 Archaea 29536
548 Ga0501034_1639412 3300049571 Archaea 516
549 Ga0501036_0001751 3300049572 Archaea 16861
550 Ga0501036_0175727 3300049572 Unclassified 1803
551 Ga0501036_0322510 3300049572 Unclassified 1291
552 Ga0501037_0002816 3300049573 Archaea 12607
553 Ga0501037_0075012 3300049573 Archaea 2457
554 Ga0501038_0012305 3300049574 Archaea 7816
555 Ga0501038_0423580 3300049574 Archaea 1027
556 Ga0501039_0000510 3300049575 Archaea 28122
557 Ga0501039_0546365 3300049575 Unclassified 909
558 Ga0501039_0608433 3300049575 Archaea 856
559 Ga0501039_1342104 3300049575 Archaea 551
560 Ga0501040_0003350 3300049576 Archaea 10356
561 Ga0501040_0015856 3300049576 Archaea 4980
562 Ga0501040_0070592 3300049576 Archaea 2411
563 Ga0501040_0219960 3300049576 Archaea 1351
564 Ga0501040_0707840 3300049576 Archaea 728
565 Ga0501040_0741706 3300049576 Archaea 710
566 Ga0501041_0000528 3300049577 Archaea 19755
567 Ga0501041_0081459 3300049577 Archaea 1993
568 Ga0501041_0380071 3300049577 Archaea 894
569 Ga0501041_0597280 3300049577 Archaea 704
570 Ga0501041_0601652 3300049577 Archaea 702
571 Ga0501041_0970378 3300049577 Unclassified 547
572 Ga0501042_0049076 3300049578 Archaea 3011
573 Ga0501042_0051529 3300049578 Archaea 2935
574 Ga0501042_0173269 3300049578 Unclassified 1557
575 Ga0501042_0395481 3300049578 Archaea 1001
576 Ga0501043_0002938 3300049579 Archaea 14216
577 Ga0501046_0009241 3300049580 Archaea 8533
578 Ga0501046_0066984 3300049580 Archaea 2797
579 Ga0501046_0084453 3300049580 Archaea 2449
580 Ga0501046_0299999 3300049580 Archaea 1173
581 Ga0501046_0403442 3300049580 Archaea 987
582 Ga0501046_0767034 3300049580 Archaea 677
583 Ga0501047_0807908 3300049581 Archaea 752
584 Ga0501048_0001005 3300049582 Archaea 21045
585 Ga0501048_0399306 3300049582 Unclassified 983
586 Ga0501048_0941492 3300049582 Archaea 621
587 Ga0501048_1077917 3300049582 Archaea 578
588 Ga0501048_1209338 3300049582 Unclassified 543
589 Ga0501068_0080200 3300049584 Archaea 2002
590 Ga0501069_0358346 3300049585 Archaea 860
591 Ga0501070_1313680 3300049586 Unclassified 552
592 Ga0501071_0000162 3300049587 Archaea 28627
593 Ga0501071_0172640 3300049587 Archaea 1619
594 Ga0501071_0204061 3300049587 Unclassified 1485
595 Ga0501071_0590368 3300049587 Archaea 854
596 Ga0501071_0815625 3300049587 Archaea 719
597 Ga0501071_1052362 3300049587 Unclassified 629
598 Ga0501072_0020420 3300049588 Archaea 5133
599 Ga0501072_0099829 3300049588 Archaea 2307
600 Ga0501072_0471542 3300049588 Unclassified 994
601 Ga0501072_1400550 3300049588 Archaea 541
602 Ga0501074_0285127 3300049590 Unclassified 1174
603 Ga0501074_0855992 3300049590 Archaea 640
604 Ga0501074_1117030 3300049590 Archaea 553
605 Ga0501075_0002524 3300049591 Archaea 12202
606 Ga0501075_0304053 3300049591 Archaea 1215
607 Ga0501075_0320795 3300049591 Archaea 1180
608 Ga0501075_0406745 3300049591 Archaea 1038
609 Ga0501075_1128470 3300049591 Archaea 595
610 Ga0501076_0000437 3300049592 Archaea 26359
611 Ga0501076_0009255 3300049592 Archaea 7267
612 Ga0501076_0114282 3300049592 Archaea 2184
613 Ga0501076_0254527 3300049592 Archaea 1437
614 Ga0501076_0432032 3300049592 Archaea 1084
615 Ga0501076_0562799 3300049592 Archaea 940
616 Ga0501076_1065422 3300049592 Archaea 666
617 Ga0501076_1558101 3300049592 Unclassified 542
618 Ga0501077_0003017 3300049593 Archaea 10092
619 Ga0501077_0119132 3300049593 Archaea 1673
620 Ga0501077_0453141 3300049593 Archaea 821
621 Ga0501077_0648495 3300049593 Archaea 678
622 Ga0501077_0687747 3300049593 Archaea 657
623 Ga0501198_009907 3300049649 Archaea 1403
624 Ga0501199_009767 3300049650 Archaea 1018
625 Ga0501199_029952 3300049650 Unclassified 667
626 Ga0501199_042015 3300049650 Archaea 595
627 Ga0501202_179536 3300049652 Archaea 570
628 Ga0501206_002953 3300049653 Archaea 2152
629 Ga0501209_085022 3300049656 Archaea 915
630 Ga0501209_124499 3300049656 Archaea 766
631 Ga0501214_000982 3300049659 Archaea 2128
632 Ga0501214_001680 3300049659 Unclassified 1761
633 Ga0501217_000894 3300049661 Archaea 5312
634 Ga0501224_001319 3300049664 Archaea 3279
635 Ga0501227_156603 3300049665 Archaea 631
636 Ga0501233_094988 3300049668 Archaea 782
637 Ga0501235_025335 3300049669 Unclassified 1326
638 Ga0501238_060664 3300049671 Archaea 577
639 Ga0501239_019841 3300049672 Archaea 817
640 Ga0501243_008237 3300049675 Archaea 1605
641 Ga0501246_010399 3300049676 Archaea 850
642 Ga0501250_084984 3300049680 Archaea 543
643 Ga0501251_000749 3300049681 Archaea 2939
644 Ga0501253_194809 3300049683 Archaea 532
645 Ga0501255_093728 3300049684 Archaea 517
646 Ga0501256_000083 3300049685 Archaea 4923
647 Ga0501257_028073 3300049686 Archaea 1349
648 Ga0501259_017479 3300049688 Archaea 1243
649 Ga0501259_022831 3300049688 Archaea 1127
650 Ga0501261_005139 3300049690 Archaea 1640
651 Ga0501221_054173 3300049704 Archaea 911
652 Ga0501225_0004053 3300049705 Archaea 4385
653 Ga0501225_0162961 3300049705 Archaea 687
654 Ga0501229_005226 3300049706 Archaea 1590
655 Ga0501245_107738 3300049708 Archaea 572
656 Ga0501079_0000748 3300049741 Archaea 22085
657 Ga0501079_0728601 3300049741 Archaea 780
658 Ga0501079_1258032 3300049741 Archaea 583
659 Ga0501080_0000735 3300049742 Archaea 26482
660 Ga0501080_0350693 3300049742 Archaea 1333
661 Ga0501081_0013492 3300049743 Archaea 5370
662 Ga0501081_0063407 3300049743 Archaea 2565
663 Ga0501081_0119945 3300049743 Archaea 1872
664 Ga0501081_0186617 3300049743 Unclassified 1501
665 Ga0501081_0772380 3300049743 Archaea 722
666 Ga0501081_0792778 3300049743 Archaea 713
667 Ga0501083_1028010 3300049744 Archaea 536
668 Ga0501241_018058 3300049758 Archaea 1291
669 Ga0501263_027439 3300049760 Archaea 792
670 Ga0501265_083202 3300049762 Unclassified 560
671 Ga0501266_008398 3300049763 Archaea 1299
672 Ga0501269_021988 3300049766 Archaea 798
673 Ga0501270_108073 3300049767 Archaea 590
674 Ga0501271_053839 3300049768 Archaea 551
675 Ga0501273_031378 3300049770 Archaea 758
676 Ga0501275_060014 3300049772 Archaea 577
677 Ga0501278_000986 3300049774 Archaea 2061
678 Ga0501279_065060 3300049775 Archaea 604
679 Ga0501282_003195 3300049778 Archaea 1769
680 Ga0501283_092560 3300049779 Archaea 580
681 Ga0501035_0005455 3300049822 Archaea 12028
682 Ga0501035_0315973 3300049822 Archaea 1313
683 Ga0501044_0003851 3300049823 Archaea 16831
684 Ga0501045_0000312 3300049824 Archaea 28334
685 Ga0501045_0174960 3300049824 Archaea 1599
686 Ga0501045_0494639 3300049824 Archaea 908
687 Ga0501204_002687 3300049850 Archaea 1821
688 Ga0501204_033618 3300049850 Archaea 723
689 Ga0501212_001631 3300049851 Archaea 2560
690 Ga0501212_023704 3300049851 Archaea 963
691 Ga0501212_041646 3300049851 Archaea 761
692 Ga0501226_010521 3300049853 Archaea 1026
693 nmdc:mga05p37_152414_c1 3300050507 Archaea 2826
694 nmdc:mga05p37_219534_c1 3300050507 Archaea 2295
695 nmdc:mga05p37_435624_c1 3300050507 Bacteria 1522
696 nmdc:mga05p37_45506_c1 3300050507 Archaea 5397
697 nmdc:mga05p37_781145_c1 3300050507 Archaea 1048
698 nmdc:mga09592_1499383_c1 3300050508 Archaea 549
699 nmdc:mga09592_387249_c1 3300050508 Archaea 1209
700 nmdc:mga09592_49899_c1 3300050508 Archaea 3529
701 nmdc:mga09592_64194_c1 3300050508 Archaea 3108
702 nmdc:mga0qj67_1191460_c1 3300050509 Archaea 593
703 nmdc:mga0qj67_131805_c1 3300050509 Archaea 2025
704 nmdc:mga0qj67_73142_c1 3300050509 Bacteria 2738
705 nmdc:mga06r32_1311571_c1 3300050510 Unclassified 668
706 nmdc:mga06r32_1407857_c1 3300050510 Archaea 639
707 nmdc:mga06r32_402099_c1 3300050510 Archaea 1352
708 nmdc:mga06r32_407717_c1 3300050510 Archaea 1341
709 nmdc:mga06r32_498407_c1 3300050510 Archaea 1195
710 nmdc:mga06r32_92335_c1 3300050510 Archaea 2960
711 nmdc:mga08y16_1189230_c1 3300050511 Archaea 734
712 nmdc:mga08y16_1313213_c1 3300050511 Unclassified 690
713 nmdc:mga08y16_145800_c1 3300050511 Archaea 2461
714 nmdc:mga08y16_162184_c1 3300050511 Archaea 2323
715 nmdc:mga08y16_219673_c1 3300050511 Archaea 1968
716 nmdc:mga08y16_397284_c1 3300050511 Archaea 1411
717 nmdc:mga08y16_537853_c1 3300050511 Archaea 1184
718 nmdc:mga0n895_104569_c1 3300050512 Archaea 2844
719 nmdc:mga0n895_73961_c1 3300050512 Archaea 3384
720 nmdc:mga0n895_7748_c1 3300050512 Archaea 9248
721 nmdc:mga0rr50_110823_c1 3300050513 Archaea 2171
722 nmdc:mga0rr50_3953_c1 3300050513 Archaea 8624
723 nmdc:mga08x19_256303_c1 3300050514 Archaea 1209
724 nmdc:mga08x19_554104_c1 3300050514 Archaea 814
725 nmdc:mga0a205_118936_c1 3300050515 Archaea 2541
726 nmdc:mga0a205_18447_c1 3300050515 Archaea 6562
727 nmdc:mga0a205_191163_c1 3300050515 Archaea 1939
728 Ga0495619_0001301 3300053085 Archaea 16417
729 Ga0501084_0032176 3300054114 Archaea 4387
730 Ga0501084_0047960 3300054114 Archaea 3577
731 Ga0501084_0213313 3300054114 Archaea 1629
732 Ga0501084_0327762 3300054114 Archaea 1293
733 Ga0501084_0618375 3300054114 Unclassified 915
734 Ga0501084_1249617 3300054114 Archaea 623
735 Ga0590077_001501 3300059426 Archaea 5416
736 Ga0590077_021579 3300059426 Archaea 1372
737 Ga0501082_0012331 3300060353 Archaea 7348
738 Ga0501082_0018503 3300060353 Archaea 6002
739 Ga0501082_0025400 3300060353 Archaea 5105
740 Ga0501082_0135924 3300060353 Archaea 2133
741 Ga0501082_0244755 3300060353 Unclassified 1561
742 Ga0501082_0414148 3300060353 Archaea 1176
743 Ga0501082_0947918 3300060353 Archaea 753
744 Ga0501082_1319232 3300060353 Archaea 630
745 Ga0530510_0002010 3300061734 Archaea 13960
746 Ga0530510_0006178 3300061734 Archaea 8325
747 Ga0530510_0204118 3300061734 Archaea 1469
748 Ga0530510_0439268 3300061734 Archaea 986
749 Ga0530510_0654108 3300061734 Archaea 800
750 Ga0530510_1390761 3300061734 Archaea 538
751 Ga0466958_0160584
752 2214771050
753 ARSoilYngRDRAFT_c00435
754 ARSoilYngRDRAFT_c00956
755 ARSoilYngRDRAFT_c02421
756 ARcpr5yngRDRAFT_c000737
757 ARcpr5yngRDRAFT_c023474
758 ARSoilOldRDRAFT_c000562
759 ARSoilOldRDRAFT_c000816
760 ARCol0oldRDRAFT_c01463
761 ARCol0yngRDRAFT_1000526
762 ARCol0yngRDRAFT_1000888
763 JGI24736J21556_1007396
764 JGI24746J21847_1010481
765 JGI24739J22299_10069033
766 JGI24737J22298_10058163
767 JGI24745J21846_1048022
768 JGI24738J21930_10076026
769 JGI24738J21930_10094221
770 JGI24744J21845_10015036
771 JGI24035J26624_1015950
772 JGI24034J26672_10053830
773 JGI24742J22300_10032598
774 JGI25407J50210_10005565
775 JGI25407J50210_10158909
776 JGI25405J52794_10011141
777 Ga0065717_1002314
778 Ga0065717_1006013
779 Ga0065716_1007484
780 Ga0065715_10001243
781 Ga0065715_10092229
782 Ga0070676_10014209
783 Ga0070683_100030283
784 Ga0070690_100099537
785 Ga0070690_100645457
786 Ga0070670_100669863
787 Ga0070670_100910626
788 Ga0068869_100984481
789 Ga0070680_100063872
790 Ga0070680_100092042
791 Ga0068868_100030287
792 Ga0068868_100235354
793 Ga0070660_100470836
794 Ga0070687_100002651
795 Ga0070692_10280296
796 Ga0070692_10408485
797 Ga0070692_10934730
798 Ga0070668_100293359
799 Ga0070669_100605064
800 Ga0070675_101155251
801 Ga0070674_100056133
802 Ga0070673_100969561
803 Ga0070688_100322045
804 Ga0070659_100143342
805 Ga0070659_101454678
806 Ga0070667_100008908
807 Ga0070667_101388422
808 Ga0070709_10065638
809 Ga0070709_10380903
810 Ga0070714_100054504
811 Ga0070713_100031551
812 Ga0070713_100683826
813 Ga0070710_10134774
814 Ga0070701_10028528
815 Ga0070701_10099091
816 Ga0070701_10190109
817 Ga0070711_100010549
818 Ga0070705_100007698
819 Ga0070705_100038060
820 Ga0070705_100049762
821 Ga0070705_100341122
822 Ga0070705_100868852
823 Ga0070700_100676818
824 Ga0070694_100000471
825 Ga0070694_100000655
826 Ga0070694_100004093
827 Ga0070694_100011755
828 Ga0070694_100018856
829 Ga0070694_100057690
830 Ga0070694_100114377
831 Ga0070694_101771398
832 Ga0070708_100007367
833 Ga0070708_100007967
834 Ga0070708_100083507
835 Ga0070708_100105363
836 Ga0070663_100203643
837 Ga0070663_100327506
838 Ga0070678_100242512
839 Ga0070662_100126622
840 Ga0070662_100161937
841 Ga0070662_101927699
842 Ga0068867_100022098
843 Ga0068867_100381883
844 Ga0070685_10026176
845 Ga0070706_100671252
846 Ga0070707_100040324
847 Ga0070707_100092858
848 Ga0070707_100128067
849 Ga0070707_100739428
850 Ga0070707_101163619
851 Ga0070698_100008571
852 Ga0070698_100043590
853 Ga0070698_100432276
854 Ga0070698_102129336
855 Ga0070699_100051944
856 Ga0070699_100161121
857 Ga0070699_100249960
858 Ga0070699_100609882
859 Ga0070684_100099505
860 Ga0070684_100439887
861 Ga0070697_100014220
862 Ga0070697_100021143
863 Ga0070697_100037323
864 Ga0070697_100134358
865 Ga0070697_100215857
866 Ga0070697_100319424
867 Ga0070697_100490065
868 Ga0070697_100535496
869 Ga0070697_100949302
870 Ga0068853_101339730
871 Ga0068853_101691948
872 Ga0070672_100001596
873 Ga0070672_100636927
874 Ga0070686_100209898
875 Ga0070686_100726111
876 Ga0070695_100009381
877 Ga0070695_100074844
878 Ga0070695_100179755
879 Ga0070695_100476073
880 Ga0070695_100953278
881 Ga0070696_100012450
882 Ga0070696_100063974
883 Ga0070696_100486390
884 Ga0070696_101496609
885 Ga0070693_100005801
886 Ga0070693_100136944
887 Ga0070665_102532017
888 Ga0070704_100004459
889 Ga0070704_100005217
890 Ga0070704_100007263
891 Ga0070704_100012797
892 Ga0070704_100077272
893 Ga0070704_100104562
894 Ga0070704_100455640
895 Ga0070704_101602886
896 Ga0068855_100814870
897 Ga0070664_100217729
898 Ga0068857_101637748
899 Ga0068854_100377951
900 Ga0068854_100439893
901 Ga0068854_101045154
902 Ga0068856_100003464
903 Ga0070702_100053367
904 Ga0070702_100141791
905 Ga0070702_100360321
906 Ga0068852_100693134
907 Ga0068852_101875002
908 Ga0068859_100096524
909 Ga0068864_100295175
910 Ga0068864_100652542
911 Ga0068864_101221694
912 Ga0068866_10385916
913 Ga0068866_10592110
914 Ga0068861_100559156
915 Ga0068870_10641145
916 Ga0068860_100020428
917 Ga0068860_101712132
918 Ga0068862_100003644
919 Ga0068862_102634282
920 Ga0081538_10000870
921 Ga0081538_10007060
922 Ga0081538_10008967
923 Ga0081538_10021781
924 Ga0081538_10038955
925 Ga0070716_100021424
926 Ga0075427_10058429
927 Ga0097621_100001858
928 Ga0097621_100073875
929 Ga0097621_102376768
930 Ga0068871_100058833
931 Ga0068871_100103181
932 Ga0075428_100010341
933 Ga0075428_100018755
934 Ga0075428_100225417
935 Ga0075428_100301268
936 Ga0075428_100430104
937 Ga0075430_100000759
938 Ga0075430_100529077
939 Ga0075431_100253985
940 Ga0075431_100317555
941 Ga0075431_100898286
942 Ga0075433_10075245
943 Ga0075433_10245473
944 Ga0075434_100017957
945 Ga0075429_100042304
946 Ga0075429_100121246
947 Ga0075429_100932490
948 Ga0075429_101276357
949 Ga0068865_100657154
950 Ga0068865_100785115
951 Ga0097620_100096524
952 Ga0075435_100068318
953 Ga0075435_100584084
954 Ga0105244_10128936
955 Ga0105244_10239506
956 Ga0105250_10345302
957 Ga0111539_10145859
958 Ga0111539_10367516
959 Ga0111539_10414558
960 Ga0111539_10566638
961 Ga0111539_10628856
962 Ga0105245_10076858
963 Ga0114129_10009444
964 Ga0114129_10023465
965 Ga0114129_10083492
966 Ga0114129_10172163
967 Ga0114129_10185328
968 Ga0114129_10203795
969 Ga0114129_10940969
970 Ga0105243_11429561
971 Ga0105243_11967540
972 Ga0105241_10051819
973 Ga0105242_10073956
974 Ga0105242_10514842
975 Ga0105242_11324030
976 Ga0105237_10041965
977 Ga0105249_10167116
978 Ga0105249_11937670
979 Ga0105239_10612057
980 Ga0105239_10800354
981 Ga0105239_11668313
982 Ga0105239_12976449
983 Ga0105239_12999150
984 Ga0105246_10096921
985 Ga0105246_10151269
986 Ga0105246_10926174
987 Ga0157340_1001377
988 Ga0157317_1002756
989 Ga0157344_1009899
990 Ga0157336_1003747
991 Ga0157328_1000558
992 Ga0157346_1004624
993 Ga0157320_1011343
994 Ga0157318_1007905
995 Ga0157337_1000305
996 Ga0157337_1000634
997 Ga0157325_1000636
998 Ga0157325_1034827
999 Ga0157325_1041317
1000 Ga0157321_1000144
1001 Ga0157343_1000444
1002 Ga0157322_1005418
1003 Ga0157329_1000289
1004 Ga0157335_1007487
1005 Ga0157341_1000177
1006 Ga0157341_1008350
1007 Ga0157319_1014621
1008 Ga0157345_1001193
1009 Ga0157345_1005255
1010 Ga0157314_1000957
1011 Ga0157313_1003634
1012 Ga0157339_1000151
1013 Ga0157324_1004996
1014 Ga0157342_1040094
1015 Ga0157315_1031675
1016 Ga0157316_1001140
1017 Ga0157316_1004615
1018 Ga0157327_1003616
1019 Ga0157327_1004830
1020 Ga0157326_1050802
1021 Ga0157338_1008281
1022 Ga0157371_10018852
1023 Ga0157370_10883140
1024 Ga0157374_10001217
1025 Ga0157374_10001323
1026 Ga0157378_10007250
1027 Ga0157378_10023864
1028 Ga0163162_10566902
1029 Ga0157372_10014247
1030 Ga0157372_10659513
1031 Ga0157372_11830302
1032 Ga0157372_11914362
1033 Ga0157375_10037241
1034 Ga0182008_10129498
1035 Ga0182008_10223679
1036 Ga0182008_10261093
1037 Ga0182008_10774122
1038 Ga0157377_10002187
1039 Ga0157377_10210768
1040 Ga0182006_1175211
1041 Ga0182005_1031639
1042 Ga0197907_10236254
1043 Ga0206352_10056126
1044 Ga0207673_1004601
1045 Ga0207697_10017284
1046 Ga0207692_10132637
1047 Ga0207642_10472699
1048 Ga0207642_11072389
1049 Ga0207688_10000719
1050 Ga0207688_10134098
1051 Ga0207647_10094525
1052 Ga0207647_10560075
1053 Ga0207699_10088713
1054 Ga0207645_10063458
1055 Ga0207643_10063682
1056 Ga0207705_11031605
1057 Ga0207684_10062544
1058 Ga0207654_10215679
1059 Ga0207671_10129958
1060 Ga0207693_10435874
1061 Ga0207660_10014791
1062 Ga0207660_10097011
1063 Ga0207660_10992419
1064 Ga0207662_10034360
1065 Ga0207657_10353911
1066 Ga0207657_10746979
1067 Ga0207652_10846029
1068 Ga0207646_10015036
1069 Ga0207646_10094280
1070 Ga0207646_10111432
1071 Ga0207646_10226055
1072 Ga0207646_10599358
1073 Ga0207646_10935419
1074 Ga0207646_11323161
1075 Ga0207681_10053703
1076 Ga0207650_10684580
1077 Ga0207650_11804288
1078 Ga0207659_10608716
1079 Ga0207659_10731321
1080 Ga0207687_10711903
1081 Ga0207700_10179451
1082 Ga0207664_10001451
1083 Ga0207690_10188154
1084 Ga0207690_10871071
1085 Ga0207690_11103910
1086 Ga0207706_10002934
1087 Ga0207686_10273241
1088 Ga0207670_10997306
1089 Ga0207704_10010169
1090 Ga0207704_10035133
1091 Ga0207691_10005575
1092 Ga0207691_10417631
1093 Ga0207661_10356458
1094 Ga0207661_10562485
1095 Ga0207661_12054221
1096 Ga0207679_10220626
1097 Ga0207679_11041597
1098 Ga0207667_10956499
1099 Ga0207651_10298455
1100 Ga0207712_10006794
1101 Ga0207712_10689190
1102 Ga0207640_10167648
1103 Ga0207640_11043293
1104 Ga0207640_11049531
1105 Ga0207658_10009469
1106 Ga0207677_10015031
1107 Ga0207677_10163168
1108 Ga0207703_10257559
1109 Ga0207639_10529446
1110 Ga0207639_10773948
1111 Ga0207678_10861937
1112 Ga0207678_11923197
1113 Ga0207708_10005187
1114 Ga0207708_10039715
1115 Ga0207708_10575367
1116 Ga0207702_10005299
1117 Ga0207702_12467781
1118 Ga0207648_10036483
1119 Ga0207676_10118489
1120 Ga0207676_10139578
1121 Ga0207676_11286079
1122 Ga0207674_10085931
1123 Ga0207674_10276013
1124 Ga0207675_100079582
1125 Ga0207675_100246400
1126 Ga0207683_10187751
1127 Ga0207698_11159429
1128 Ga0209974_10073402
1129 Ga0207428_10004953
1130 Ga0207428_10079015
1131 Ga0207428_10231506
1132 Ga0207428_10847683
1133 Ga0268266_11410517
1134 Ga0268265_10342070
1135 Ga0268265_10804350
1136 Ga0268264_10008262
1137 Ga0307408_100005013
1138 Ga0307408_100053912
1139 Ga0307408_100316077
1140 Ga0307408_100978176
1141 Ga0307405_10002386
1142 Ga0307413_10030103
1143 Ga0307413_10648459
1144 Ga0307410_10003783
1145 Ga0307410_10060448
1146 Ga0307410_10083992
1147 Ga0307410_10250582
1148 Ga0307410_11794703
1149 Ga0307406_10066172
1150 Ga0307406_10092613
1151 Ga0307406_11260843
1152 Ga0307406_11831233
1153 Ga0307407_10000141
1154 Ga0307407_10058095
1155 Ga0307407_10216190
1156 Ga0307412_10005291
1157 Ga0307412_10139504
1158 Ga0307409_100034034
1159 Ga0307409_100344515
1160 Ga0307416_100034790
1161 Ga0307416_100231088
1162 Ga0307416_100410044
1163 Ga0307416_100445518
1164 Ga0307414_10005902
1165 Ga0307414_10149506
1166 Ga0307414_11820929
1167 Ga0307411_10030995
1168 Ga0307411_10037111
1169 Ga0307411_10071129
1170 Ga0307411_11135542
1171 Ga0307411_11484686
1172 Ga0307415_100049774
1173 Ga0307415_101019146
1174 Ga0373930_0107786
1175 Ga0373950_0104013
1176 Ga0373938_0036682
1177 Ga0373926_0046234
1178 Ga0373929_0083363
1179 Ga0373934_0003081
1180 Ga0373940_0023262
1181 Ga0373944_0270283
1182 Ga0373949_0022636
1183 Ga0373951_0008067
1184 Ga0373952_0055970
1185 Ga0373923_0620965
1186 Ga0373932_0108377
1187 Ga0373936_0188708
1188 Ga0373939_0220794
1189 Ga0373941_0126772
1190 Ga0373953_0001043
1191 Ga0373954_0000711
1192 Ga0373956_0003675
1193 Ga0373957_0000847
1194 Ga0373960_0003868
1195 Ga0373946_0257268
1196 Ga0373955_0000511
1197 Ga0373942_0010078
1198 Ga0373961_0001794
1199 Ga0373962_0162490
1200 Ga0373924_0001345
1201 Ga0373931_0011196
1202 Ga0373935_0596416
1203 Ga0373933_0001116
1204 Ga0373947_0120310
1205 Ga0373937_0002289
1206 Ga0373925_0157290
1207 Ga0242420_026949
1208 Ga0439438_019254
1209 Ga0439438_085798
1210 Ga0439439_0156100
1211 Ga0439461_0039926
1212 Ga0439466_0065053
1213 Ga0439466_0125806
1214 Ga0439465_0134425
1215 Ga0451798_0119670
1216 Ga0439431_0029131
1217 Ga0439442_122405
1218 Ga0439452_052513
1219 Ga0439455_0018234
1220 Ga0439456_041917
1221 Ga0439456_085564
1222 Ga0450920_005641
1223 Ga0450923_001071
1224 Ga0450923_020504
1225 Ga0450906_000763
1226 Ga0450910_010690
1227 Ga0439446_0001103
1228 Ga0439446_0071205
1229 Ga0439434_0019584
1230 Ga0439434_0033868
1231 Ga0439460_0009104
1232 Ga0450893_0008487
1233 Ga0451577_0241353
1234 Ga0451577_1099942
1235 Ga0466964_0373571
1236 Ga0453684_0132177
1237 Ga0466957_1043195
1238 Ga0466960_0049755
1239 Ga0451576_0016093
1240 Ga0466967_0746142
1241 Ga0495592_0008619
1242 Ga0495603_0435284
1243 Ga0495629_1101281
1244 Ga0495651_0005537
1245 Ga0495653_0017429
1246 Ga0495664_0051449
1247 Ga0495608_0036654
1248 Ga0495628_0071279
1249 Ga0495652_0003318
1250 Ga0495587_0001360
1251 Ga0495645_0007313
1252 Ga0495635_0164223
1253 Ga0495657_0016261
1254 Ga0495599_0007544
1255 Ga0495646_0022605
1256 Ga0495658_0398060
1257 Ga0495600_0029090
1258 Ga0495680_0119691
1259 Ga0495675_0003953
1260 Ga0495684_0129535
1261 Ga0495602_0003576
1262 Ga0496100_0051061
1263 Ga0496100_0056704
1264 Ga0496100_0389091
1265 Ga0496101_0107248
1266 Ga0496101_0280999
1267 Ga0496102_0014507
1268 Ga0496102_0559687
1269 Ga0496102_0572645
1270 Ga0496103_0015422
1271 Ga0496106_0024211
1272 Ga0496106_0294580
1273 Ga0496107_0051934
1274 Ga0496107_0399181
1275 Ga0496107_0520214
1276 Ga0496109_0759593
1277 Ga0496110_0078971
1278 Ga0496110_1892888
1279 Ga0496111_0266219
1280 Ga0501290_017107
1281 Ga0501290_025852
1282 Ga0501290_066278
1283 Ga0501291_001794
1284 Ga0501291_048393
1285 Ga0501292_004406
1286 Ga0501295_039050
1287 Ga0501296_005482
1288 Ga0501298_002723
1289 Ga0501298_005786
1290 Ga0501298_087764
1291 Ga0501323_069018
1292 Ga0501325_038874
1293 Ga0501031_0095611
1294 Ga0501031_0490485
1295 Ga0501032_0003458
1296 Ga0501032_0401730
1297 Ga0501034_0001592
1298 Ga0501034_1639412
1299 Ga0501036_0001751
1300 Ga0501036_0175727
1301 Ga0501036_0322510
1302 Ga0501037_0002816
1303 Ga0501037_0075012
1304 Ga0501038_0012305
1305 Ga0501038_0423580
1306 Ga0501039_0000510
1307 Ga0501039_0546365
1308 Ga0501039_0608433
1309 Ga0501039_1342104
1310 Ga0501040_0003350
1311 Ga0501040_0015856
1312 Ga0501040_0070592
1313 Ga0501040_0219960
1314 Ga0501040_0707840
1315 Ga0501040_0741706
1316 Ga0501041_0000528
1317 Ga0501041_0081459
1318 Ga0501041_0380071
1319 Ga0501041_0597280
1320 Ga0501041_0601652
1321 Ga0501041_0970378
1322 Ga0501042_0049076
1323 Ga0501042_0051529
1324 Ga0501042_0173269
1325 Ga0501042_0395481
1326 Ga0501043_0002938
1327 Ga0501046_0009241
1328 Ga0501046_0066984
1329 Ga0501046_0084453
1330 Ga0501046_0299999
1331 Ga0501046_0403442
1332 Ga0501046_0767034
1333 Ga0501047_0807908
1334 Ga0501048_0001005
1335 Ga0501048_0399306
1336 Ga0501048_0941492
1337 Ga0501048_1077917
1338 Ga0501048_1209338
1339 Ga0501068_0080200
1340 Ga0501069_0358346
1341 Ga0501070_1313680
1342 Ga0501071_0000162
1343 Ga0501071_0172640
1344 Ga0501071_0204061
1345 Ga0501071_0590368
1346 Ga0501071_0815625
1347 Ga0501071_1052362
1348 Ga0501072_0020420
1349 Ga0501072_0099829
1350 Ga0501072_0471542
1351 Ga0501072_1400550
1352 Ga0501074_0285127
1353 Ga0501074_0855992
1354 Ga0501074_1117030
1355 Ga0501075_0002524
1356 Ga0501075_0304053
1357 Ga0501075_0320795
1358 Ga0501075_0406745
1359 Ga0501075_1128470
1360 Ga0501076_0000437
1361 Ga0501076_0009255
1362 Ga0501076_0114282
1363 Ga0501076_0254527
1364 Ga0501076_0432032
1365 Ga0501076_0562799
1366 Ga0501076_1065422
1367 Ga0501076_1558101
1368 Ga0501077_0003017
1369 Ga0501077_0119132
1370 Ga0501077_0453141
1371 Ga0501077_0648495
1372 Ga0501077_0687747
1373 Ga0501198_009907
1374 Ga0501199_009767
1375 Ga0501199_029952
1376 Ga0501199_042015
1377 Ga0501202_179536
1378 Ga0501206_002953
1379 Ga0501209_085022
1380 Ga0501209_124499
1381 Ga0501214_000982
1382 Ga0501214_001680
1383 Ga0501217_000894
1384 Ga0501224_001319
1385 Ga0501227_156603
1386 Ga0501233_094988
1387 Ga0501235_025335
1388 Ga0501238_060664
1389 Ga0501239_019841
1390 Ga0501243_008237
1391 Ga0501246_010399
1392 Ga0501250_084984
1393 Ga0501251_000749
1394 Ga0501253_194809
1395 Ga0501255_093728
1396 Ga0501256_000083
1397 Ga0501257_028073
1398 Ga0501259_017479
1399 Ga0501259_022831
1400 Ga0501261_005139
1401 Ga0501221_054173
1402 Ga0501225_0004053
1403 Ga0501225_0162961
1404 Ga0501229_005226
1405 Ga0501245_107738
1406 Ga0501079_0000748
1407 Ga0501079_0728601
1408 Ga0501079_1258032
1409 Ga0501080_0000735
1410 Ga0501080_0350693
1411 Ga0501081_0013492
1412 Ga0501081_0063407
1413 Ga0501081_0119945
1414 Ga0501081_0186617
1415 Ga0501081_0772380
1416 Ga0501081_0792778
1417 Ga0501083_1028010
1418 Ga0501241_018058
1419 Ga0501263_027439
1420 Ga0501265_083202
1421 Ga0501266_008398
1422 Ga0501269_021988
1423 Ga0501270_108073
1424 Ga0501271_053839
1425 Ga0501273_031378
1426 Ga0501275_060014
1427 Ga0501278_000986
1428 Ga0501279_065060
1429 Ga0501282_003195
1430 Ga0501283_092560
1431 Ga0501035_0005455
1432 Ga0501035_0315973
1433 Ga0501044_0003851
1434 Ga0501045_0000312
1435 Ga0501045_0174960
1436 Ga0501045_0494639
1437 Ga0501204_002687
1438 Ga0501204_033618
1439 Ga0501212_001631
1440 Ga0501212_023704
1441 Ga0501212_041646
1442 Ga0501226_010521
1443 nmdc:mga05p37_152414_c1
1444 nmdc:mga05p37_219534_c1
1445 nmdc:mga05p37_435624_c1
1446 nmdc:mga05p37_45506_c1
1447 nmdc:mga05p37_781145_c1
1448 nmdc:mga09592_1499383_c1
1449 nmdc:mga09592_387249_c1
1450 nmdc:mga09592_49899_c1
1451 nmdc:mga09592_64194_c1
1452 nmdc:mga0qj67_1191460_c1
1453 nmdc:mga0qj67_131805_c1
1454 nmdc:mga0qj67_73142_c1
1455 nmdc:mga06r32_1311571_c1
1456 nmdc:mga06r32_1407857_c1
1457 nmdc:mga06r32_402099_c1
1458 nmdc:mga06r32_407717_c1
1459 nmdc:mga06r32_498407_c1
1460 nmdc:mga06r32_92335_c1
1461 nmdc:mga08y16_1189230_c1
1462 nmdc:mga08y16_1313213_c1
1463 nmdc:mga08y16_145800_c1
1464 nmdc:mga08y16_162184_c1
1465 nmdc:mga08y16_219673_c1
1466 nmdc:mga08y16_397284_c1
1467 nmdc:mga08y16_537853_c1
1468 nmdc:mga0n895_104569_c1
1469 nmdc:mga0n895_73961_c1
1470 nmdc:mga0n895_7748_c1
1471 nmdc:mga0rr50_110823_c1
1472 nmdc:mga0rr50_3953_c1
1473 nmdc:mga08x19_256303_c1
1474 nmdc:mga08x19_554104_c1
1475 nmdc:mga0a205_118936_c1
1476 nmdc:mga0a205_18447_c1
1477 nmdc:mga0a205_191163_c1
1478 Ga0495619_0001301
1479 Ga0501084_0032176
1480 Ga0501084_0047960
1481 Ga0501084_0213313
1482 Ga0501084_0327762
1483 Ga0501084_0618375
1484 Ga0501084_1249617
1485 Ga0590077_001501
1486 Ga0590077_021579
1487 Ga0501082_0012331
1488 Ga0501082_0018503
1489 Ga0501082_0025400
1490 Ga0501082_0135924
1491 Ga0501082_0244755
1492 Ga0501082_0414148
1493 Ga0501082_0947918
1494 Ga0501082_1319232
1495 Ga0530510_0002010
1496 Ga0530510_0006178
1497 Ga0530510_0204118
1498 Ga0530510_0439268
1499 Ga0530510_0654108
1500 Ga0530510_1390761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14947

HTH_45

Winged helix-turn-helix

3

80

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r7j-assembly1.cif.gz_A-2 crystal structure of the dna-binding protein sso10a from sulfolobus solfataricus 0.961 4 78
1wsu-assembly1.cif.gz_D c-terminal domain of elongation factor selb complexed with secis rna 0.8966 7 63
5xxu-assembly1.cif.gz_T small subunit of toxoplasma gondii ribosome 0.8829 33 69
7l1i-assembly1.cif.gz_A-2 crystal structure of the marr family transcriptional regulator from acineotobacter baumannii bound to indole 3 acetic acid 0.8823 9 75
3jbo-assembly1.cif.gz_Y cryo-electron microscopy reconstruction of the plasmodium falciparum 80s ribosome bound to p/e-trna 0.8765 33 69
ID Description Score Start End Superfamily
1r7jA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.961 4 78 1.10.10.10
af_Q57738_133_209_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9341 4 80 1.10.10.10
af_Q57738_133_209_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9114 4 80 1.10.10.10
af_Q57735_17_96_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9028 4 81 1.10.10.10
1wsuD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8966 7 63 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A533V772-F1-model_v4 ArnR1-like winged helix-turn-helix domain-containing protein 0.9933 1 62
AF-A0A533WFI5-F1-model_v4 deleted 0.9907 1 72
AF-A0A6A7LLW8-F1-model_v4 ArnR1-like winged helix-turn-helix domain-containing protein 0.9902 2 77
AF-A0A1Q7NRJ3-F1-model_v4 ArnR1-like winged helix-turn-helix domain-containing protein 0.9889 1 70
AF-A0A533VPU3-F1-model_v4 Transcriptional regulator 0.982 4 77

Map