F479028

General Info

Members Datasets Scaffolds Average Seq Length
750 418 709 254

Family's Representative Sequence

Representative Sequence 3300003790|Ga0055528_1000377|Ga0055528_10003778
Length 304
Sequence VRRKPPFGLTAEDERASHRRVKPRMDEPRIRLIEPKEKCMNTAVAATPAAHHAVVSKDRWLAQRKALLAREKELTHLRDQIARERRALPWTRVEKDYVFDTPEGARALADLFEGRRQLLVQHFMLGPDWEQGCPSCSYMSDHLDGMKVHLENRDLSLLVVSRAPLDQIERFRRRMGWQFKWVSSHGSDFNYXXXVSFEPRQWAEGKGEVYYNYSVRPFPAQEAPGISVFYRDDAGEVFHTYSTYERGVEAMMGTYNLLDLTPKGRDEPNPVHAMDWVRHHDRYEPAAPAAKPAGGSGSCCHGPD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221559 Lysobacter sp. Root559 Isolate Unclassified
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2643221585 Pelomonas sp. Root662 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
9 2643221593 Lysobacter sp. Root690 Isolate Unclassified
10 2643221609 Acidovorax sp. Root217 Isolate Unclassified
11 2643221611 Acidovorax sp. Root219 Isolate Unclassified
12 2643221612 Lysobacter sp. Root76 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221645 Massilia sp. Root351 Isolate Unclassified
16 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221664 Massilia sp. Root418 Isolate Unclassified
19 2643221683 Variovorax sp. Root473 Isolate Unclassified
20 2643221727 Lysobacter sp. Root96 Isolate Unclassified
21 2643221728 Lysobacter sp. Root983 Isolate Unclassified
22 2738541277 Variovorax sp. GV051 Isolate Unclassified
23 2738541280 Massilia sp. GV090 Isolate Unclassified
24 2738541300 Massilia sp. GV016 Isolate Unclassified
25 2738541307 Variovorax sp. GV008 Isolate Unclassified
26 2738543012 Acidovorax sp. CF301 Isolate Unclassified
27 2738543018 Massilia sp. GV045 Isolate Unclassified
28 2738543019 Variovorax sp. GV040 Isolate Unclassified
29 2738543030 Massilia sp. GV097 Isolate Unclassified
30 2816332133 Acidovorax radicis 2721A Isolate Unclassified
31 2842677519 Variovorax sp. R-72495 Isolate Unclassified
32 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
33 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
34 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
35 2904456579 Variovorax sp. 2002 Isolate Unclassified
36 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
37 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
38 2929520902 Variovorax beijingensis 502 Isolate Unclassified
39 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
40 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
41 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
42 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
43 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
50 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
51 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
52 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
74 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
75 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
76 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
77 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
78 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
79 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
80 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
81 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
82 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
85 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
86 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
87 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
93 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
94 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
121 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
122 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
123 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
124 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
125 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
126 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
127 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
128 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
139 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
152 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
156 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
157 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
158 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
166 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
167 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
238 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
244 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
245 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
246 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
247 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
248 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
249 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
250 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
251 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
252 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
253 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
258 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
273 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
274 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
275 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
276 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
280 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
281 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
282 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
283 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
284 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
289 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
290 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
291 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
292 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
293 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
294 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
295 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
296 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
297 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
298 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
299 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
300 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
301 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
302 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
318 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
319 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
324 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
325 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
328 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
329 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
350 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
351 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
352 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
353 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
354 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
355 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
369 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
374 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
377 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
378 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
381 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
397 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
398 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
399 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
400 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
401 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
402 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
403 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
404 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
405 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
406 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
407 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
408 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
409 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
410 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
411 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
412 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.4
Metatranscriptomes 0.13
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.8
Nodule 0.4
Rhizoplane 3.33
Rhizosphere 67.2
Stem 0
Stem Tuber 0
Unclassified 10.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2058914 2162886007 Bacteria 4642
2 JGI25156J39149_1000016 3300002705 Bacteria 178691
3 JGI25156J39149_1000061 3300002705 Bacteria 84583
4 JGI25157J39369_1000035 3300002741 Bacteria 136011
5 JGI25157J39369_1000180 3300002741 Bacteria 53594
6 JGI25151J46595_10001011 3300003187 Bacteria 21245
7 rootH1_10001573 3300003316 Bacteria 2984
8 rootL2_10049763 3300003322 Bacteria 2860
9 rootL2_10055265 3300003322 Bacteria 4735
10 rootH1_10154922 3300003323 Bacteria 1405
11 Ga0006562J51391_1111735 3300003578 Bacteria 2630
12 Ga0055539_1000124 3300003752 Bacteria 82223
13 Ga0055539_1008631 3300003752 Bacteria 1273
14 Ga0055533_1000024 3300003756 Bacteria 338067
15 Ga0055525_1001151 3300003759 Bacteria 6253
16 Ga0055535_1000183 3300003761 Bacteria 66520
17 Ga0055535_1000393 3300003761 Bacteria 41335
18 Ga0055535_1006549 3300003761 Bacteria 2339
19 Ga0055529_1000064 3300003763 Bacteria 178831
20 Ga0055529_1002064 3300003763 Bacteria 4342
21 Ga0055526_1032910 3300003771 Bacteria 1451
22 Ga0055537_1000010 3300003773 Bacteria 138059
23 Ga0055524_1002702 3300003775 Bacteria 8965
24 Ga0055524_1002878 3300003775 Bacteria 8615
25 Ga0055536_1002555 3300003781 Bacteria 10174
26 Ga0055536_1007581 3300003781 Bacteria 4824
27 Ga0055536_1011792 3300003781 Bacteria 3304
28 Ga0055534_1000015 3300003784 Bacteria 148531
29 Ga0055534_1003939 3300003784 Bacteria 4477
30 Ga0055534_1024889 3300003784 Bacteria 966
31 Ga0055528_1000377 3300003790 Bacteria 36291
32 Ga0055528_1027352 3300003790 Bacteria 1608
33 Ga0055530_10005109 3300003791 Bacteria 6420
34 Ga0055540_1000015 3300003792 Bacteria 232986
35 Ga0055540_1000625 3300003792 Bacteria 25161
36 Ga0055540_1001156 3300003792 Bacteria 16424
37 Ga0055531_10009441 3300003794 Bacteria 4983
38 Ga0055531_10031543 3300003794 Bacteria 1752
39 Ga0065165_1003590 3300005262 Bacteria 10695
40 Ga0065714_10012400 3300005288 Bacteria 2045
41 Ga0065714_10098198 3300005288 Bacteria 1717
42 Ga0065714_10135375 3300005288 Bacteria 1214
43 Ga0065704_10071167 3300005289 Bacteria 12711
44 Ga0065704_10190037 3300005289 Bacteria 1194
45 Ga0070658_10006378 3300005327 Bacteria 9559
46 Ga0070658_10393348 3300005327 Bacteria 1190
47 Ga0070676_10042449 3300005328 Bacteria 2641
48 Ga0070676_10059644 3300005328 Bacteria 2264
49 Ga0070683_100007807 3300005329 Bacteria 9060
50 Ga0070690_100069279 3300005330 Bacteria 2289
51 Ga0070690_100279968 3300005330 Bacteria 1189
52 Ga0070670_100015017 3300005331 Bacteria 6645
53 Ga0070670_100052538 3300005331 Bacteria 3499
54 Ga0070677_10001118 3300005333 Bacteria 8610
55 Ga0070677_10097407 3300005333 Bacteria 1290
56 Ga0070677_10159219 3300005333 Bacteria 1058
57 Ga0070666_10246187 3300005335 Bacteria 1265
58 Ga0070682_100461931 3300005337 Bacteria 975
59 Ga0068868_100184829 3300005338 Bacteria 1731
60 Ga0068868_100342648 3300005338 Unclassified 1278
61 Ga0070660_100115501 3300005339 Bacteria 2139
62 Ga0070660_100374063 3300005339 Bacteria 1176
63 Ga0070661_100001406 3300005344 Bacteria 16794
64 Ga0070661_100039349 3300005344 Bacteria 3445
65 Ga0070661_100292933 3300005344 Bacteria 1265
66 Ga0070668_100211738 3300005347 Bacteria 1595
67 Ga0070669_100001153 3300005353 Bacteria 19303
68 Ga0070669_100219498 3300005353 Bacteria 1503
69 Ga0070669_100238623 3300005353 Bacteria 1443
70 Ga0070669_100306889 3300005353 Bacteria 1278
71 Ga0070675_100000219 3300005354 Bacteria 36584
72 Ga0070675_100073009 3300005354 Bacteria 2848
73 Ga0070675_100266688 3300005354 Bacteria 1502
74 Ga0070675_100321492 3300005354 Bacteria 1367
75 Ga0070671_100014483 3300005355 Bacteria 6373
76 Ga0070671_100073955 3300005355 Bacteria 2846
77 Ga0070674_100008397 3300005356 Bacteria 6150
78 Ga0070674_100030134 3300005356 Bacteria 3582
79 Ga0070674_100171135 3300005356 Bacteria 1656
80 Ga0070673_100016775 3300005364 Bacteria 5190
81 Ga0070673_100236884 3300005364 Bacteria 1585
82 Ga0070673_100524112 3300005364 Bacteria 1074
83 Ga0070667_100130790 3300005367 Bacteria 2190
84 Ga0070667_100423243 3300005367 Bacteria 1214
85 Ga0070714_100675924 3300005435 Bacteria 995
86 Ga0070713_100173092 3300005436 Unclassified 1935
87 Ga0070713_100230015 3300005436 Bacteria 1685
88 Ga0070713_100437197 3300005436 Bacteria 1227
89 Ga0070711_100490847 3300005439 Bacteria 1011
90 Ga0070663_100307632 3300005455 Bacteria 1271
91 Ga0070678_100082305 3300005456 Bacteria 2443
92 Ga0070678_100104732 3300005456 Bacteria 2201
93 Ga0070678_100321072 3300005456 Bacteria 1322
94 Ga0070662_100007583 3300005457 Bacteria 7041
95 Ga0070662_100303250 3300005457 Bacteria 1298
96 Ga0068867_100000257 3300005459 Bacteria 34998
97 Ga0068867_100000287 3300005459 Bacteria 33183
98 Ga0068867_100549100 3300005459 Bacteria 1000
99 Ga0068867_100587446 3300005459 Bacteria 969
100 Ga0070706_100046962 3300005467 Bacteria 3984
101 Ga0070706_100147422 3300005467 Bacteria 2197
102 Ga0070707_100311578 3300005468 Bacteria 1530
103 Ga0070698_100131748 3300005471 Bacteria 2455
104 Ga0070699_100123539 3300005518 Bacteria 2278
105 Ga0070697_100118575 3300005536 Bacteria 2212
106 Ga0068853_100059813 3300005539 Bacteria 3292
107 Ga0070672_100024889 3300005543 Bacteria 4432
108 Ga0070672_100116189 3300005543 Bacteria 2186
109 Ga0070672_100128982 3300005543 Bacteria 2077
110 Ga0070672_100164859 3300005543 Bacteria 1840
111 Ga0070686_100468523 3300005544 Bacteria 972
112 Ga0070665_100005593 3300005548 Bacteria 12922
113 Ga0070665_100027314 3300005548 Bacteria 5749
114 Ga0070665_100749225 3300005548 Bacteria 990
115 Ga0068855_100032438 3300005563 Bacteria 6237
116 Ga0068855_100040092 3300005563 Bacteria 5559
117 Ga0068855_100055019 3300005563 Bacteria 4675
118 Ga0068855_100202244 3300005563 Bacteria 2236
119 Ga0068855_100655682 3300005563 Bacteria 1127
120 Ga0070664_100005979 3300005564 Bacteria 9837
121 Ga0070664_100006836 3300005564 Bacteria 9200
122 Ga0068857_100155059 3300005577 Bacteria 2076
123 Ga0068857_100413942 3300005577 Bacteria 1256
124 Ga0068854_100018452 3300005578 Bacteria 4683
125 Ga0068856_100005465 3300005614 Bacteria 12519
126 Ga0068856_100135356 3300005614 Bacteria 2469
127 Ga0068852_100036176 3300005616 Bacteria 4128
128 Ga0068852_100077532 3300005616 Bacteria 2938
129 Ga0068859_100288940 3300005617 Bacteria 1732
130 Ga0068859_100637578 3300005617 Bacteria 1158
131 Ga0068864_100031303 3300005618 Bacteria 4514
132 Ga0068864_100083709 3300005618 Bacteria 2802
133 Ga0068864_100471248 3300005618 Bacteria 1204
134 Ga0068866_10001764 3300005718 Bacteria 9099
135 Ga0068861_100022190 3300005719 Bacteria 4570
136 Ga0068861_100821686 3300005719 Bacteria 874
137 Ga0068851_10215542 3300005834 Bacteria 1077
138 Ga0068851_10256556 3300005834 Bacteria 993
139 Ga0068870_10041850 3300005840 Bacteria 2383
140 Ga0068870_10119732 3300005840 Bacteria 1515
141 Ga0068870_10303013 3300005840 Bacteria 1009
142 Ga0068863_100093710 3300005841 Bacteria 2850
143 Ga0068863_100120711 3300005841 Bacteria 2499
144 Ga0068858_100033996 3300005842 Bacteria 4729
145 Ga0068860_100000444 3300005843 Bacteria 52273
146 Ga0068860_100181705 3300005843 Bacteria 2033
147 Ga0068862_100005619 3300005844 Bacteria 10481
148 Ga0068862_100007521 3300005844 Bacteria 9026
149 Ga0068862_100087278 3300005844 Bacteria 2714
150 Ga0081455_10000211 3300005937 Bacteria 74488
151 Ga0081455_10023053 3300005937 Bacteria 5802
152 Ga0081455_10033603 3300005937 Bacteria 4607
153 Ga0081455_10221551 3300005937 Bacteria 1401
154 Ga0081539_10012312 3300005985 Bacteria 6614
155 Ga0081539_10029495 3300005985 Bacteria 3425
156 Ga0070717_10072109 3300006028 Bacteria 2883
157 Ga0070717_10441651 3300006028 Unclassified 1172
158 Ga0075365_10048421 3300006038 Bacteria 2798
159 Ga0075365_10059553 3300006038 Bacteria 2545
160 Ga0075365_10131459 3300006038 Bacteria 1732
161 Ga0075368_10067240 3300006042 Bacteria 1442
162 Ga0075363_100072347 3300006048 Bacteria 1874
163 Ga0075364_10034721 3300006051 Bacteria 3256
164 Ga0075364_10057960 3300006051 Bacteria 2538
165 Ga0075364_10099648 3300006051 Bacteria 1934
166 Ga0075432_10017697 3300006058 Bacteria 2429
167 Ga0070712_100569735 3300006175 Bacteria 956
168 Ga0075362_10075928 3300006177 Bacteria 1542
169 Ga0075367_10071757 3300006178 Bacteria 2084
170 Ga0075369_10014386 3300006186 Bacteria 3160
171 Ga0075369_10142855 3300006186 Bacteria 1092
172 Ga0075366_10014177 3300006195 Bacteria 4550
173 Ga0075366_10022500 3300006195 Bacteria 3667
174 Ga0097621_100010684 3300006237 Bacteria 6727
175 Ga0097621_100022185 3300006237 Bacteria 4925
176 Ga0097621_100284698 3300006237 Bacteria 1456
177 Ga0097621_100439109 3300006237 Bacteria 1174
178 Ga0097621_100504782 3300006237 Bacteria 1096
179 Ga0075370_10029763 3300006353 Bacteria 3043
180 Ga0075370_10049998 3300006353 Bacteria 2371
181 Ga0068871_100017429 3300006358 Bacteria 5436
182 Ga0068871_100026498 3300006358 Bacteria 4524
183 Ga0075428_100084707 3300006844 Bacteria 3458
184 Ga0075431_100005078 3300006847 Bacteria 12949
185 Ga0075429_100002970 3300006880 Bacteria 14385
186 Ga0075429_100006854 3300006880 Bacteria 9886
187 Ga0075429_100396202 3300006880 Bacteria 1209
188 Ga0068865_100072113 3300006881 Bacteria 2452
189 Ga0068865_100177807 3300006881 Bacteria 1637
190 Ga0068865_100537199 3300006881 Bacteria 980
191 Ga0097620_100104708 3300006931 Bacteria 2889
192 Ga0097620_100288967 3300006931 Bacteria 1732
193 Ga0097620_100637647 3300006931 Bacteria 1158
194 Ga0099826_10062906 3300006948 Bacteria 2402
195 Ga0075435_100110885 3300007076 Bacteria 2282
196 Ga0105240_10003444 3300009093 Bacteria 24555
197 Ga0105240_10039722 3300009093 Bacteria 6024
198 Ga0105240_10048411 3300009093 Bacteria 5373
199 Ga0105240_10331375 3300009093 Bacteria 1732
200 Ga0111539_10015684 3300009094 Bacteria 9418
201 Ga0105245_10504539 3300009098 Bacteria 1226
202 Ga0114129_10007699 3300009147 Bacteria 15329
203 Ga0114129_10171771 3300009147 Bacteria 2955
204 Ga0105243_10001557 3300009148 Bacteria 20059
205 Ga0105243_10001974 3300009148 Bacteria 17474
206 Ga0105243_10036123 3300009148 Bacteria 3833
207 Ga0105241_10092724 3300009174 Bacteria 2385
208 Ga0105242_10004095 3300009176 Bacteria 11335
209 Ga0105242_10006406 3300009176 Bacteria 9065
210 Ga0105242_10631983 3300009176 Bacteria 1039
211 Ga0105248_10001750 3300009177 Bacteria 24170
212 Ga0105248_10209272 3300009177 Bacteria 2197
213 Ga0105238_10009551 3300009551 Bacteria 9705
214 Ga0105238_10059850 3300009551 Bacteria 3815
215 Ga0105249_10554275 3300009553 Bacteria 1200
216 Ga0105249_10652291 3300009553 Bacteria 1110
217 Ga0105239_10047798 3300010375 Bacteria 4690
218 Ga0105239_10113071 3300010375 Bacteria 3011
219 Ga0105246_10048831 3300011119 Bacteria 2895
220 Ga0105246_10278320 3300011119 Bacteria 1341
221 Ga0157373_10036351 3300013100 Bacteria 3535
222 Ga0157373_10268384 3300013100 Bacteria 1208
223 Ga0157370_10001585 3300013104 Bacteria 28149
224 Ga0157370_10121753 3300013104 Bacteria 2436
225 Ga0157370_10469454 3300013104 Bacteria 1156
226 Ga0157369_10070182 3300013105 Bacteria 3764
227 Ga0157378_10047413 3300013297 Bacteria 3821
228 Ga0163162_10005859 3300013306 Bacteria 11891
229 Ga0163162_10075011 3300013306 Bacteria 3442
230 Ga0163162_10181586 3300013306 Bacteria 2230
231 Ga0163162_10244309 3300013306 Bacteria 1926
232 Ga0157372_10008371 3300013307 Bacteria 10996
233 Ga0157372_10099893 3300013307 Bacteria 3311
234 Ga0157372_10477128 3300013307 Bacteria 1454
235 Ga0157375_10042937 3300013308 Bacteria 4381
236 Ga0157375_10144787 3300013308 Bacteria 2506
237 Ga0157375_10303401 3300013308 Bacteria 1760
238 Ga0157375_10724851 3300013308 Bacteria 1147
239 Ga0157380_10195170 3300014326 Bacteria 1791
240 Ga0157380_10294006 3300014326 Bacteria 1493
241 Ga0182008_10000711 3300014497 Bacteria 23842
242 Ga0182008_10021087 3300014497 Bacteria 3350
243 Ga0182008_10100425 3300014497 Bacteria 1430
244 Ga0157379_10243909 3300014968 Bacteria 1630
245 Ga0157376_10000023 3300014969 Bacteria 223978
246 Ga0182006_1000964 3300015261 Bacteria 19073
247 Ga0182006_1092354 3300015261 Bacteria 1087
248 Ga0182007_10003164 3300015262 Bacteria 7886
249 Ga0182007_10045136 3300015262 Bacteria 1461
250 Ga0163161_10000127 3300017792 Bacteria 71051
251 Ga0163161_10065478 3300017792 Bacteria 2652
252 Ga0213872_10030461 3300021361 Bacteria 2473
253 Ga0209674_100007 3300025226 Bacteria 1077082
254 Ga0209672_103582 3300025228 Bacteria 3150
255 Ga0209563_100060 3300025230 Bacteria 284876
256 Ga0209258_100124 3300025242 Bacteria 178883
257 Ga0209258_100415 3300025242 Bacteria 51014
258 Ga0207425_1008473 3300025245 Bacteria 2627
259 Ga0207425_1034144 3300025245 Bacteria 999
260 Ga0209646_1000056 3300025246 Bacteria 269860
261 Ga0209026_1000009 3300025250 Bacteria 531812
262 Ga0209677_100108 3300025253 Bacteria 89018
263 Ga0209677_100198 3300025253 Bacteria 48090
264 Ga0209759_1000035 3300025256 Bacteria 264254
265 Ga0209759_1001942 3300025256 Bacteria 10052
266 Ga0209129_1003835 3300025258 Bacteria 6275
267 Ga0209565_1000025 3300025263 Bacteria 377969
268 Ga0209565_1010809 3300025263 Bacteria 2251
269 Ga0209565_1013694 3300025263 Bacteria 1891
270 Ga0209455_1000114 3300025272 Bacteria 178883
271 Ga0209455_1000337 3300025272 Bacteria 44758
272 Ga0209673_1000077 3300025273 Bacteria 229470
273 Ga0209673_1001615 3300025273 Bacteria 19674
274 Ga0209673_1006170 3300025273 Bacteria 5864
275 Ga0209130_1016584 3300025284 Bacteria 1778
276 Ga0209675_1000017 3300025291 Bacteria 378002
277 Ga0209675_1001897 3300025291 Bacteria 11275
278 Ga0209675_1027953 3300025291 Bacteria 1378
279 Ga0209676_1000034 3300025292 Bacteria 460125
280 Ga0209676_1000785 3300025292 Bacteria 42175
281 Ga0209676_1003468 3300025292 Bacteria 9682
282 Ga0209676_1020288 3300025292 Bacteria 2262
283 Ga0209025_1000005 3300025294 Bacteria 1272149
284 Ga0209025_1001450 3300025294 Bacteria 31111
285 Ga0209025_1002222 3300025294 Bacteria 21391
286 Ga0209025_1035923 3300025294 Bacteria 2229
287 Ga0209564_1004349 3300025295 Bacteria 8723
288 Ga0209564_1039105 3300025295 Bacteria 1309
289 Ga0209758_1024888 3300025297 Bacteria 2649
290 Ga0209050_1000170 3300025298 Bacteria 151162
291 Ga0209050_1000528 3300025298 Bacteria 63464
292 Ga0209050_1000529 3300025298 Bacteria 63410
293 Ga0209256_1000120 3300025299 Bacteria 167691
294 Ga0209256_1000980 3300025299 Bacteria 34284
295 Ga0209051_1000020 3300025303 Bacteria 508628
296 Ga0209051_1000271 3300025303 Bacteria 86541
297 Ga0209051_1000398 3300025303 Bacteria 60408
298 Ga0209051_1016226 3300025303 Bacteria 3384
299 Ga0209051_1020044 3300025303 Bacteria 2897
300 Ga0209257_1000189 3300025304 Bacteria 153917
301 Ga0209257_1000727 3300025304 Bacteria 50163
302 Ga0209257_1004132 3300025304 Bacteria 11573
303 Ga0209257_1007879 3300025304 Bacteria 6270
304 Ga0209257_1009161 3300025304 Bacteria 5388
305 Ga0207697_10155989 3300025315 Bacteria 994
306 Ga0207655_1003754 3300025728 Bacteria 11132
307 Ga0207655_1047804 3300025728 Bacteria 1762
308 Ga0207682_10000318 3300025893 Bacteria 21940
309 Ga0207642_10003806 3300025899 Bacteria 4809
310 Ga0207680_10115550 3300025903 Bacteria 1748
311 Ga0207645_10053165 3300025907 Bacteria 2588
312 Ga0207643_10223059 3300025908 Bacteria 1154
313 Ga0207643_10290194 3300025908 Bacteria 1016
314 Ga0207705_10232650 3300025909 Bacteria 1402
315 Ga0207684_10091817 3300025910 Bacteria 2588
316 Ga0207684_10099326 3300025910 Bacteria 2486
317 Ga0207684_10221853 3300025910 Bacteria 1631
318 Ga0207695_10001146 3300025913 Bacteria 45967
319 Ga0207695_10125579 3300025913 Bacteria 2528
320 Ga0207662_10036678 3300025918 Bacteria 2867
321 Ga0207657_10174036 3300025919 Bacteria 1743
322 Ga0207649_10023829 3300025920 Bacteria 3549
323 Ga0207646_10151450 3300025922 Bacteria 2092
324 Ga0207646_10624795 3300025922 Bacteria 966
325 Ga0207681_10001999 3300025923 Bacteria 13101
326 Ga0207681_10334874 3300025923 Bacteria 1207
327 Ga0207694_10014155 3300025924 Bacteria 6014
328 Ga0207694_10070372 3300025924 Bacteria 2733
329 Ga0207694_10181914 3300025924 Bacteria 1705
330 Ga0207650_10000435 3300025925 Bacteria 36300
331 Ga0207650_10027784 3300025925 Bacteria 4052
332 Ga0207650_10490009 3300025925 Bacteria 1026
333 Ga0207659_10000301 3300025926 Bacteria 29933
334 Ga0207659_10327028 3300025926 Bacteria 1266
335 Ga0207700_10097431 3300025928 Bacteria 2337
336 Ga0207700_10135300 3300025928 Bacteria 2018
337 Ga0207664_10461960 3300025929 Bacteria 1134
338 Ga0207664_10691548 3300025929 Bacteria 917
339 Ga0207644_10031872 3300025931 Bacteria 3676
340 Ga0207644_10037348 3300025931 Bacteria 3416
341 Ga0207690_10095180 3300025932 Bacteria 2115
342 Ga0207709_10000295 3300025935 Bacteria 55888
343 Ga0207709_10006321 3300025935 Bacteria 6649
344 Ga0207709_10031111 3300025935 Bacteria 3113
345 Ga0207709_10054605 3300025935 Bacteria 2464
346 Ga0207669_10000291 3300025937 Bacteria 22986
347 Ga0207669_10030757 3300025937 Bacteria 2988
348 Ga0207669_10072473 3300025937 Bacteria 2169
349 Ga0207704_10004798 3300025938 Bacteria 6207
350 Ga0207704_10428917 3300025938 Bacteria 1050
351 Ga0207691_10000148 3300025940 Bacteria 64859
352 Ga0207691_10010991 3300025940 Bacteria 8686
353 Ga0207691_10020929 3300025940 Bacteria 6182
354 Ga0207691_10077217 3300025940 Bacteria 3001
355 Ga0207691_10113200 3300025940 Bacteria 2411
356 Ga0207711_10218808 3300025941 Bacteria 1741
357 Ga0207689_10220933 3300025942 Bacteria 1565
358 Ga0207661_10007104 3300025944 Bacteria 7956
359 Ga0207661_10349605 3300025944 Bacteria 1334
360 Ga0207679_10000088 3300025945 Bacteria 79836
361 Ga0207679_10000265 3300025945 Bacteria 39990
362 Ga0207667_10024754 3300025949 Bacteria 6583
363 Ga0207667_10059920 3300025949 Bacteria 3985
364 Ga0207667_10119750 3300025949 Bacteria 2713
365 Ga0207667_10523706 3300025949 Bacteria 1201
366 Ga0207651_10007310 3300025960 Bacteria 5872
367 Ga0207651_10093246 3300025960 Bacteria 2210
368 Ga0207712_10342035 3300025961 Bacteria 1241
369 Ga0207668_10138875 3300025972 Bacteria 1866
370 Ga0207658_10104335 3300025986 Bacteria 2227
371 Ga0207658_10211584 3300025986 Bacteria 1625
372 Ga0207658_10447202 3300025986 Bacteria 1143
373 Ga0207677_10396024 3300026023 Unclassified 1170
374 Ga0207703_10010771 3300026035 Bacteria 7134
375 Ga0207703_10052243 3300026035 Bacteria 3317
376 Ga0207639_10016455 3300026041 Bacteria 5233
377 Ga0207639_10353577 3300026041 Bacteria 1313
378 Ga0207708_10000659 3300026075 Bacteria 26455
379 Ga0207708_10071198 3300026075 Bacteria 2663
380 Ga0207702_10007291 3300026078 Bacteria 9454
381 Ga0207702_10016789 3300026078 Bacteria 6059
382 Ga0207641_10078072 3300026088 Bacteria 2867
383 Ga0207641_10108254 3300026088 Bacteria 2460
384 Ga0207641_10644410 3300026088 Bacteria 1040
385 Ga0207648_10000283 3300026089 Bacteria 55253
386 Ga0207648_10000741 3300026089 Bacteria 36624
387 Ga0207648_10001569 3300026089 Bacteria 25081
388 Ga0207648_10144894 3300026089 Bacteria 2095
389 Ga0207648_10169073 3300026089 Bacteria 1932
390 Ga0207648_10185179 3300026089 Bacteria 1844
391 Ga0207648_10237217 3300026089 Bacteria 1623
392 Ga0207676_10005361 3300026095 Bacteria 9081
393 Ga0207676_10703245 3300026095 Bacteria 979
394 Ga0207674_10004183 3300026116 Bacteria 17430
395 Ga0207674_10067265 3300026116 Bacteria 3607
396 Ga0207674_10356524 3300026116 Bacteria 1414
397 Ga0207675_100000946 3300026118 Bacteria 29002
398 Ga0207675_100119096 3300026118 Bacteria 2497
399 Ga0207675_100848070 3300026118 Bacteria 928
400 Ga0207675_101037710 3300026118 Bacteria 839
401 Ga0207683_10027159 3300026121 Bacteria 4946
402 Ga0207683_10076230 3300026121 Bacteria 2969
403 Ga0207698_10004401 3300026142 Bacteria 8580
404 Ga0209282_1000229 3300027666 Bacteria 29075
405 Ga0209813_10070936 3300027866 Bacteria 1132
406 Ga0207428_10010548 3300027907 Bacteria 8247
407 Ga0268266_10000276 3300028379 Bacteria 84981
408 Ga0268265_10017636 3300028380 Bacteria 4933
409 Ga0268265_10051884 3300028380 Bacteria 3098
410 Ga0268265_10583115 3300028380 Bacteria 1066
411 Ga0268264_10008357 3300028381 Bacteria 8604
412 Ga0268264_10641211 3300028381 Bacteria 1050
413 Ga0265336_10000022 3300028666 Bacteria 192716
414 Ga0307517_10100690 3300028786 Bacteria 2280
415 Ga0307515_10000212 3300028794 Bacteria 143024
416 Ga0307515_10001343 3300028794 Bacteria 55676
417 Ga0307515_10002672 3300028794 Bacteria 38207
418 Ga0307515_10003631 3300028794 Bacteria 32412
419 Ga0307515_10006216 3300028794 Bacteria 23987
420 Ga0307515_10110109 3300028794 Bacteria 3227
421 Ga0307511_10138468 3300030521 Bacteria 1440
422 Ga0316177_1121344 3300030731 Bacteria 5730
423 Ga0314311_1150282 3300030733 Bacteria 3746
424 Ga0314311_1170870 3300030733 Bacteria 1327
425 Ga0316179_1019061 3300030734 Bacteria 2452
426 Ga0316183_1128149 3300030742 Bacteria 1966
427 Ga0316181_1134026 3300030744 Bacteria 7152
428 Ga0316182_1365804 3300030745 Bacteria 1342
429 Ga0265327_10000841 3300031251 Bacteria 45822
430 Ga0265327_10008749 3300031251 Bacteria 7480
431 Ga0265327_10117302 3300031251 Bacteria 1265
432 Ga0307509_10023870 3300031507 Bacteria 6855
433 Ga0307509_10109053 3300031507 Bacteria 2780
434 Ga0307408_100029462 3300031548 Bacteria 3804
435 Ga0307408_100044597 3300031548 Bacteria 3161
436 Ga0307408_100086803 3300031548 Bacteria 2352
437 Ga0307408_100087023 3300031548 Bacteria 2349
438 Ga0307408_100119983 3300031548 Bacteria 2035
439 Ga0307408_100252878 3300031548 Bacteria 1454
440 Ga0307508_10000549 3300031616 Bacteria 44475
441 Ga0307508_10060284 3300031616 Bacteria 3355
442 Ga0307508_10200014 3300031616 Bacteria 1599
443 Ga0307514_10003783 3300031649 Bacteria 14253
444 Ga0307514_10230827 3300031649 Bacteria 1122
445 Ga0316575_10164074 3300031665 Bacteria 919
446 Ga0307516_10000926 3300031730 Bacteria 40364
447 Ga0307516_10001203 3300031730 Bacteria 36097
448 Ga0307516_10005479 3300031730 Bacteria 15154
449 Ga0307516_10009294 3300031730 Bacteria 10985
450 Ga0307405_10023689 3300031731 Bacteria 3493
451 Ga0307405_10033160 3300031731 Bacteria 3060
452 Ga0307405_10059202 3300031731 Bacteria 2413
453 Ga0307405_10254474 3300031731 Bacteria 1308
454 Ga0307413_10202749 3300031824 Bacteria 1434
455 Ga0307406_10000356 3300031901 Bacteria 26772
456 Ga0307406_10000418 3300031901 Bacteria 24737
457 Ga0307406_10036690 3300031901 Bacteria 3022
458 Ga0307406_10288612 3300031901 Bacteria 1255
459 Ga0307412_10005923 3300031911 Bacteria 6890
460 Ga0307412_10022514 3300031911 Bacteria 3864
461 Ga0307412_10060115 3300031911 Bacteria 2549
462 Ga0307412_10143127 3300031911 Bacteria 1754
463 Ga0307412_10413423 3300031911 Bacteria 1102
464 Ga0307409_100000680 3300031995 Bacteria 15083
465 Ga0307416_100001182 3300032002 Bacteria 14007
466 Ga0307416_100618044 3300032002 Bacteria 1165
467 Ga0307416_101141087 3300032002 Bacteria 884
468 Ga0307414_10069798 3300032004 Bacteria 2527
469 Ga0307411_10151779 3300032005 Bacteria 1722
470 Ga0307411_10293811 3300032005 Bacteria 1300
471 Ga0307415_100003784 3300032126 Bacteria 7753
472 Ga0316583_10015793 3300032133 Bacteria 2719
473 Ga0373937_0821452 3300036401 Bacteria 878
474 Ga0373925_0070054 3300037068 Bacteria 2650
475 Ga0395899_0047170 3300037312 Bacteria 3208
476 Ga0395899_0250249 3300037312 Bacteria 1216
477 Ga0395900_0066916 3300037418 Bacteria 3692
478 Ga0395898_0024937 3300037466 Bacteria 6029
479 Ga0395905_0001288 3300037471 Bacteria 30819
480 Ga0395905_0086403 3300037471 Bacteria 2939
481 Ga0395905_0114921 3300037471 Bacteria 2529
482 Ga0395905_0269989 3300037471 Bacteria 1587
483 Ga0395905_0405666 3300037471 Bacteria 1258
484 Ga0395901_0010155 3300038443 Bacteria 9540
485 Ga0395901_0013644 3300038443 Bacteria 8261
486 Ga0395901_0070453 3300038443 Bacteria 3643
487 Ga0395901_0248551 3300038443 Bacteria 1853
488 Ga0436360_0378379 3300039438 Bacteria 3603
489 Ga0436361_0201117 3300039447 Bacteria 5845
490 Ga0436361_0759821 3300039447 Bacteria 1501
491 Ga0436361_1117914 3300039447 Bacteria 4441
492 Ga0436361_1173055 3300039447 Bacteria 3143
493 Ga0439447_000529 3300041407 Bacteria 14138
494 Ga0439461_0021134 3300041410 Bacteria 1295
495 Ga0439465_0000084 3300041413 Bacteria 20771
496 Ga0439465_0040571 3300041413 Bacteria 1505
497 Ga0451793_1414310 3300041452 Bacteria 1389
498 Ga0451833_1255216 3300041491 Bacteria 954
499 Ga0451845_0393817 3300041501 Bacteria 931
500 Ga0451853_0547373 3300041512 Bacteria 1576
501 Ga0451853_1218881 3300041512 Bacteria 859
502 Ga0439445_0056153 3300042004 Bacteria 1070
503 Ga0439448_0074588 3300042005 Bacteria 1133
504 Ga0439432_074696 3300042006 Bacteria 1031
505 Ga0439449_0000268 3300042007 Bacteria 18787
506 Ga0439449_0008418 3300042007 Bacteria 3920
507 Ga0439452_062604 3300042010 Bacteria 831
508 Ga0450917_000970 3300042120 Bacteria 2113
509 Ga0450888_000401 3300042126 Bacteria 4104
510 Ga0450898_010536 3300042134 Bacteria 1499
511 Ga0450903_016201 3300042138 Bacteria 1170
512 Ga0450889_001420 3300042144 Bacteria 2468
513 Ga0450906_023736 3300042145 Bacteria 1091
514 Ga0450910_013718 3300042147 Bacteria 1181
515 Ga0439446_0002028 3300042156 Bacteria 4794
516 Ga0450908_006003 3300042184 Bacteria 2318
517 Ga0439434_0026513 3300042435 Bacteria 1750
518 Ga0439434_0075677 3300042435 Bacteria 1064
519 Ga0450918_000414 3300042531 Bacteria 9267
520 Ga0450918_006895 3300042531 Bacteria 2018
521 Ga0466972_0001578 3300044658 Bacteria 11124
522 Ga0466965_0086719 3300044683 Bacteria 1588
523 Ga0466971_0234295 3300044719 Bacteria 872
524 Ga0466970_0075878 3300044765 Bacteria 1811
525 Ga0466957_0074081 3300044842 Bacteria 2111
526 Ga0451576_0147436 3300045051 Bacteria 2454
527 Ga0495627_006828 3300046453 Bacteria 4439
528 Ga0495627_027845 3300046453 Bacteria 1809
529 Ga0495650_0067401 3300046471 Bacteria 1414
530 Ga0495639_0002546 3300046475 Bacteria 7952
531 Ga0495584_0003469 3300046491 Bacteria 8673
532 Ga0495585_0053252 3300046492 Bacteria 2240
533 Ga0495583_0000793 3300046506 Bacteria 39114
534 Ga0495606_0005138 3300046507 Bacteria 12695
535 Ga0495606_0007042 3300046507 Bacteria 10192
536 Ga0495606_0155394 3300046507 Bacteria 1339
537 Ga0495620_0137700 3300046515 Bacteria 955
538 Ga0495630_0000030 3300046517 Bacteria 139077
539 Ga0495637_0000370 3300046520 Bacteria 33899
540 Ga0495637_0001189 3300046520 Bacteria 15841
541 Ga0495663_0044485 3300046525 Bacteria 1359
542 Ga0495654_0062108 3300046530 Bacteria 1792
543 Ga0495654_0077578 3300046530 Bacteria 1563
544 Ga0495586_0022024 3300046535 Bacteria 3401
545 Ga0495621_0036563 3300046539 Bacteria 1705
546 Ga0495621_0037761 3300046539 Bacteria 1681
547 Ga0495597_0003400 3300046542 Bacteria 9320
548 Ga0495645_0343906 3300046543 Bacteria 963
549 Ga0495656_0001230 3300046615 Bacteria 8327
550 Ga0495656_0013520 3300046615 Bacteria 3039
551 Ga0495668_0000681 3300046616 Bacteria 40916
552 Ga0495625_0000638 3300046660 Bacteria 50402
553 Ga0495625_0018461 3300046660 Bacteria 5445
554 Ga0495625_0024281 3300046660 Bacteria 4615
555 Ga0495625_0114367 3300046660 Bacteria 1842
556 Ga0495625_0193880 3300046660 Bacteria 1344
557 Ga0495659_0000557 3300046664 Bacteria 13692
558 Ga0495588_0043306 3300046674 Bacteria 2303
559 Ga0495670_0027741 3300046691 Bacteria 2807
560 Ga0495671_0000086 3300046692 Bacteria 87499
561 Ga0495649_0004901 3300046694 Bacteria 8635
562 Ga0495589_0008420 3300046794 Bacteria 5391
563 Ga0495636_0011051 3300047318 Bacteria 3573
564 Ga0495672_0000458 3300047320 Bacteria 48213
565 Ga0495673_0088134 3300047469 Bacteria 1272
566 Ga0495686_0006678 3300047472 Bacteria 8780
567 Ga0496101_0006811 3300048904 Bacteria 7371
568 Ga0496103_0028850 3300048906 Bacteria 3370
569 Ga0496104_0025417 3300048907 Bacteria 5459
570 Ga0496104_0027094 3300048907 Bacteria 5300
571 Ga0496105_0002846 3300048908 Bacteria 12657
572 Ga0496106_0058106 3300048909 Bacteria 2927
573 Ga0496106_0321985 3300048909 Bacteria 1241
574 Ga0496107_0029116 3300048910 Bacteria 3927
575 Ga0496108_0056426 3300048911 Bacteria 3300
576 Ga0496108_0068954 3300048911 Bacteria 2984
577 Ga0496108_0224766 3300048911 Bacteria 1631
578 Ga0496109_0061608 3300048912 Bacteria 3430
579 Ga0496109_0121333 3300048912 Bacteria 2435
580 Ga0496109_0245079 3300048912 Bacteria 1687
581 Ga0496110_0052425 3300048913 Bacteria 3584
582 Ga0496110_0123111 3300048913 Bacteria 2338
583 Ga0496111_0116415 3300048914 Bacteria 1971
584 Ga0496111_0278171 3300048914 Bacteria 1241
585 Ga0496114_0006538 3300048917 Bacteria 9186
586 Ga0496114_0043794 3300048917 Bacteria 3711
587 Ga0496114_0097975 3300048917 Bacteria 2499
588 Ga0496114_0128320 3300048917 Bacteria 2188
589 Ga0496114_0158950 3300048917 Bacteria 1964
590 Ga0496114_0518415 3300048917 Bacteria 1054
591 Ga0496117_0004897 3300048920 Bacteria 14423
592 Ga0496121_0006346 3300048924 Bacteria 14735
593 Ga0496121_0008905 3300048924 Bacteria 11654
594 Ga0496121_0049489 3300048924 Bacteria 3563
595 Ga0496122_0034206 3300048925 Bacteria 4163
596 Ga0496122_0199841 3300048925 Bacteria 1170
597 Ga0496123_0004412 3300048926 Bacteria 14811
598 Ga0496124_0001194 3300048927 Bacteria 40486
599 Ga0496125_0121450 3300048928 Bacteria 1863
600 Ga0496126_0044652 3300048929 Bacteria 4079
601 Ga0495678_000302 3300049459 Bacteria 53782
602 Ga0501033_0053494 3300049570 Bacteria 2990
603 Ga0501034_0000222 3300049571 Bacteria 108857
604 Ga0501034_0000898 3300049571 Bacteria 43341
605 Ga0501036_0189614 3300049572 Bacteria 1730
606 Ga0501036_0433907 3300049572 Bacteria 1095
607 Ga0501038_0141493 3300049574 Bacteria 1968
608 Ga0501039_0010790 3300049575 Bacteria 6958
609 Ga0501039_0015187 3300049575 Bacteria 5893
610 Ga0501040_0028612 3300049576 Bacteria 3758
611 Ga0501041_0002404 3300049577 Bacteria 10600
612 Ga0501041_0006696 3300049577 Bacteria 6752
613 Ga0501041_0357588 3300049577 Bacteria 923
614 Ga0501042_0366992 3300049578 Bacteria 1042
615 Ga0501043_0000101 3300049579 Bacteria 78983
616 Ga0501043_0012695 3300049579 Bacteria 6588
617 Ga0501043_0139603 3300049579 Bacteria 1898
618 Ga0501043_0169394 3300049579 Bacteria 1704
619 Ga0501043_0254805 3300049579 Bacteria 1351
620 Ga0501046_0000135 3300049580 Bacteria 79084
621 Ga0501046_0246501 3300049580 Bacteria 1316
622 Ga0501047_0000173 3300049581 Bacteria 79071
623 Ga0501048_0000452 3300049582 Bacteria 28741
624 Ga0501048_0189279 3300049582 Bacteria 1458
625 Ga0501071_0011488 3300049587 Bacteria 5969
626 Ga0501071_0014912 3300049587 Bacteria 5325
627 Ga0501072_0037193 3300049588 Bacteria 3817
628 Ga0501072_0200199 3300049588 Bacteria 1592
629 Ga0501075_0058953 3300049591 Bacteria 2891
630 Ga0501075_0344075 3300049591 Bacteria 1136
631 Ga0501076_0006136 3300049592 Bacteria 8698
632 Ga0501076_0011408 3300049592 Bacteria 6617
633 Ga0501077_0029861 3300049593 Bacteria 3467
634 Ga0501223_021719 3300049663 Bacteria 1255
635 Ga0501225_0035994 3300049705 Bacteria 1364
636 Ga0501079_0425576 3300049741 Bacteria 1042
637 Ga0501081_0015619 3300049743 Bacteria 5012
638 Ga0501081_0312261 3300049743 Bacteria 1154
639 Ga0501262_000176 3300049759 Bacteria 8070
640 Ga0501269_000229 3300049766 Bacteria 16443
641 Ga0501035_0020829 3300049822 Bacteria 6025
642 Ga0501035_0155201 3300049822 Bacteria 1984
643 Ga0501045_0002898 3300049824 Bacteria 11719
644 Ga0501045_0007526 3300049824 Bacteria 7568
645 Ga0501045_0062480 3300049824 Bacteria 2733
646 nmdc:mga03683_100965_c1 3300050489 Bacteria 1268
647 nmdc:mga03683_126965_c1 3300050489 Bacteria 1138
648 nmdc:mga03683_31153_c1 3300050489 Bacteria 2138
649 nmdc:mga03683_43024_c1 3300050489 Bacteria 1861
650 nmdc:mga03683_54099_c1 3300050489 Bacteria 1682
651 nmdc:mga03683_6403_c1 3300050489 Bacteria 4028
652 nmdc:mga03683_6512_c1 3300050489 Bacteria 4002
653 nmdc:mga03683_7996_c1 3300050489 Bacteria 3698
654 nmdc:mga03683_8539_c1 3300050489 Bacteria 3605
655 nmdc:mga03n38_7168_c1 3300050490 Bacteria 3927
656 nmdc:mga00v17_180286_c1 3300050491 Bacteria 1363
657 nmdc:mga00v17_36229_c1 3300050491 Bacteria 2940
658 nmdc:mga0yw44_13764_c1 3300050492 Bacteria 4272
659 nmdc:mga0yw44_147998_c1 3300050492 Bacteria 1530
660 nmdc:mga0yw44_28476_c1 3300050492 Bacteria 3213
661 nmdc:mga0yw44_478019_c1 3300050492 Bacteria 845
662 nmdc:mga0k408_22684_c1 3300050493 Bacteria 3536
663 nmdc:mga0k408_34040_c1 3300050493 Bacteria 2915
664 nmdc:mga0k408_89021_c1 3300050493 Bacteria 1813
665 nmdc:mga06z11_297568_c1 3300050494 Bacteria 959
666 nmdc:mga06z11_5710_c1 3300050494 Bacteria 5012
667 nmdc:mga04h51_48324_c1 3300050495 Bacteria 1417
668 nmdc:mga07m45_42522_c1 3300050496 Bacteria 2547
669 nmdc:mga07m45_527_c1 3300050496 Bacteria 16233
670 nmdc:mga05p37_6901_c1 3300050507 Bacteria 13387
671 nmdc:mga09592_159191_c1 3300050508 Bacteria 1950
672 nmdc:mga09592_4077_c1 3300050508 Bacteria 11795
673 nmdc:mga09592_5902_c1 3300050508 Bacteria 9989
674 nmdc:mga09592_859_c1 3300050508 Bacteria 23706
675 nmdc:mga0qj67_4193_c1 3300050509 Bacteria 10443
676 nmdc:mga06r32_220734_c1 3300050510 Bacteria 1884
677 nmdc:mga06r32_35242_c1 3300050510 Bacteria 4722
678 nmdc:mga08y16_14823_c1 3300050511 Bacteria 8197
679 nmdc:mga08y16_431644_c1 3300050511 Bacteria 1345
680 nmdc:mga0rr50_95526_c1 3300050513 Bacteria 2323
681 nmdc:mga0sz30_2905_c1 3300050516 Bacteria 6140
682 Ga0500610_0001037 3300053079 Bacteria 9100
683 Ga0500610_0021069 3300053079 Bacteria 3192
684 Ga0500635_0000025 3300053080 Bacteria 105726
685 Ga0500578_0001187 3300053086 Bacteria 27526
686 Ga0500644_0001451 3300053088 Bacteria 6255
687 Ga0500641_0008683 3300053096 Bacteria 3633
688 Ga0500641_0119735 3300053096 Bacteria 1134
689 Ga0500562_001416 3300053108 Bacteria 5893
690 Ga0500593_001175 3300053117 Bacteria 9454
691 Ga0500593_146308 3300053117 Bacteria 923
692 Ga0500597_197105 3300053120 Bacteria 847
693 Ga0500607_000368 3300053121 Bacteria 43100
694 Ga0500608_009545 3300053122 Bacteria 4127
695 Ga0500628_002085 3300053129 Bacteria 3354
696 Ga0500561_0025890 3300053137 Bacteria 1432
697 Ga0500568_0008442 3300053139 Bacteria 4960
698 Ga0500604_0005928 3300053151 Bacteria 3228
699 Ga0500619_000183 3300053154 Bacteria 14804
700 Ga0500622_0125911 3300053156 Bacteria 1237
701 Ga0500627_0017867 3300053158 Bacteria 2795
702 Ga0500636_0153269 3300053177 Bacteria 1263
703 Ga0500587_002124 3300053739 Bacteria 2830
704 Ga0501084_0023612 3300054114 Bacteria 5129
705 Ga0501084_0056926 3300054114 Bacteria 3271
706 Ga0501082_0005977 3300060353 Bacteria 10555
707 Ga0501082_0014790 3300060353 Bacteria 6719
708 Ga0466962_0012160 3300061719 Bacteria 4138
709 Ga0530510_0022112 3300061734 Bacteria 4528

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042010 Ga0439452_062604 Ga0439452_062604_173_814 210
2 3300048924 Ga0496121_0006346 Ga0496121_0006346_3589_4362 211
3 3300005616 Ga0068852_100036176 Ga0068852_1000361765 213
4 3300013307 Ga0157372_10477128 Ga0157372_104771282 213
5 3300028794 Ga0307515_10110109 Ga0307515_101101093 216
6 3300036401 Ga0373937_0821452 Ga0373937_0821452_20_751 218
7 3300053137 Ga0500561_0025890 Ga0500561_0025890_122_913 218
8 3300038443 Ga0395901_0248551 Ga0395901_0248551_12_746 220
9 3300005328 Ga0070676_10042449 Ga0070676_100424493 221
10 3300005331 Ga0070670_100052538 Ga0070670_1000525384 221
11 3300005354 Ga0070675_100073009 Ga0070675_1000730093 221
12 3300005543 Ga0070672_100164859 Ga0070672_1001648593 221
13 3300025907 Ga0207645_10053165 Ga0207645_100531651 221
14 3300025925 Ga0207650_10027784 Ga0207650_100277845 221
15 3300025940 Ga0207691_10020929 Ga0207691_100209293 221
16 3300048927 Ga0496124_0001194 Ga0496124_0001194_25146_25907 221
17 3300032002 Ga0307416_101141087 Ga0307416_1011410872 222
18 3300037471 Ga0395905_0269989 Ga0395905_0269989_466_1209 222
19 3300042138 Ga0450903_016201 Ga0450903_016201_265_1053 222
20 3300005338 Ga0068868_100342648 Ga0068868_1003426482 224
21 3300026023 Ga0207677_10396024 Ga0207677_103960242 224
22 3300032133 Ga0316583_10015793 Ga0316583_100157933 224
23 3300053156 Ga0500622_0125911 Ga0500622_0125911_265_1056 224
24 3300049571 Ga0501034_0000222 Ga0501034_0000222_11360_12037 225
25 3300053117 Ga0500593_146308 Ga0500593_146308_37_828 225
26 3300054114 Ga0501084_0056926 Ga0501084_0056926_336_1118 226
27 3300005333 Ga0070677_10159219 Ga0070677_101592192 227
28 3300005347 Ga0070668_100211738 Ga0070668_1002117382 227
29 3300005367 Ga0070667_100130790 Ga0070667_1001307903 227
30 3300013306 Ga0163162_10181586 Ga0163162_101815863 227
31 3300025924 Ga0207694_10181914 Ga0207694_101819142 227
32 3300025986 Ga0207658_10104335 Ga0207658_101043352 227
33 3300048904 Ga0496101_0006811 Ga0496101_0006811_5225_5992 227
34 3300048906 Ga0496103_0028850 Ga0496103_0028850_1322_2089 227
35 3300048908 Ga0496105_0002846 Ga0496105_0002846_6119_6886 227
36 3300048909 Ga0496106_0058106 Ga0496106_0058106_679_1446 227
37 3300048910 Ga0496107_0029116 Ga0496107_0029116_1360_2127 227
38 3300048911 Ga0496108_0068954 Ga0496108_0068954_32_799 227
39 3300048913 Ga0496110_0123111 Ga0496110_0123111_766_1533 227
40 3300048914 Ga0496111_0116415 Ga0496111_0116415_649_1416 227
41 3300048917 Ga0496114_0128320 Ga0496114_0128320_62_829 227
42 3300006038 Ga0075365_10048421 Ga0075365_100484215 228
43 3300037312 Ga0395899_0250249 Ga0395899_0250249_103_873 228
44 3300037466 Ga0395898_0024937 Ga0395898_0024937_2110_2880 228
45 3300053080 Ga0500635_0000025 Ga0500635_0000025_19753_20532 228
46 3300006175 Ga0070712_100569735 Ga0070712_1005697351 230
47 3300005262 Ga0065165_1003590 Ga0065165_10035905 231
48 3300025922 Ga0207646_10151450 Ga0207646_101514502 231
49 3300031251 Ga0265327_10008749 Ga0265327_100087497 231
50 3300045051 Ga0451576_0147436 Ga0451576_0147436_458_1162 231
51 3300046535 Ga0495586_0022024 Ga0495586_0022024_1514_2341 231
52 3300005841 Ga0068863_100093710 Ga0068863_1000937103 232
53 3300026088 Ga0207641_10078072 Ga0207641_100780723 232
54 3300042007 Ga0439449_0008418 Ga0439449_0008418_2990_3760 232
55 3300042120 Ga0450917_000970 Ga0450917_000970_1095_1898 232
56 3300042126 Ga0450888_000401 Ga0450888_000401_1582_2385 232
57 3300042144 Ga0450889_001420 Ga0450889_001420_390_1193 232
58 3300042435 Ga0439434_0075677 Ga0439434_0075677_45_824 232
59 3300049577 Ga0501041_0357588 Ga0501041_0357588_176_880 232
60 3300015262 Ga0182007_10045136 Ga0182007_100451361 233
61 3300025910 Ga0207684_10091817 Ga0207684_100918173 233
62 3300031548 Ga0307408_100086803 Ga0307408_1000868032 233
63 3300031548 Ga0307408_100119983 Ga0307408_1001199833 233
64 3300031616 Ga0307508_10200014 Ga0307508_102000142 233
65 3300031731 Ga0307405_10254474 Ga0307405_102544742 233
66 3300031901 Ga0307406_10288612 Ga0307406_102886121 233
67 3300031911 Ga0307412_10022514 Ga0307412_100225143 233
68 3300031911 Ga0307412_10060115 Ga0307412_100601153 233
69 3300031911 Ga0307412_10143127 Ga0307412_101431272 233
70 3300046453 Ga0495627_027845 Ga0495627_027845_424_1233 233
71 3300048928 Ga0496125_0121450 Ga0496125_0121450_305_1114 233
72 3300049570 Ga0501033_0053494 Ga0501033_0053494_532_1314 233
73 3300049574 Ga0501038_0141493 Ga0501038_0141493_338_1120 233
74 3300049575 Ga0501039_0010790 Ga0501039_0010790_2239_3021 233
75 3300049578 Ga0501042_0366992 Ga0501042_0366992_146_856 233
76 3300049579 Ga0501043_0139603 Ga0501043_0139603_819_1601 233
77 3300049580 Ga0501046_0246501 Ga0501046_0246501_443_1225 233
78 3300049587 Ga0501071_0014912 Ga0501071_0014912_3531_4313 233
79 3300049588 Ga0501072_0037193 Ga0501072_0037193_182_964 233
80 3300049591 Ga0501075_0344075 Ga0501075_0344075_293_1075 233
81 3300049592 Ga0501076_0006136 Ga0501076_0006136_1379_2161 233
82 3300049593 Ga0501077_0029861 Ga0501077_0029861_29_811 233
83 3300049743 Ga0501081_0015619 Ga0501081_0015619_1801_2583 233
84 3300049824 Ga0501045_0007526 Ga0501045_0007526_4373_5155 233
85 3300060353 Ga0501082_0014790 Ga0501082_0014790_4147_4929 233
86 3300061734 Ga0530510_0022112 Ga0530510_0022112_1308_2090 233
87 3300005353 Ga0070669_100219498 Ga0070669_1002194982 234
88 3300005354 Ga0070675_100266688 Ga0070675_1002666882 234
89 3300005356 Ga0070674_100171135 Ga0070674_1001711352 234
90 3300005457 Ga0070662_100303250 Ga0070662_1003032501 234
91 3300005459 Ga0068867_100587446 Ga0068867_1005874461 234
92 3300005543 Ga0070672_100116189 Ga0070672_1001161892 234
93 3300005543 Ga0070672_100128982 Ga0070672_1001289822 234
94 3300005840 Ga0068870_10041850 Ga0068870_100418502 234
95 3300005840 Ga0068870_10119732 Ga0068870_101197322 234
96 3300006931 Ga0097620_100104708 Ga0097620_1001047083 234
97 3300009553 Ga0105249_10652291 Ga0105249_106522912 234
98 3300014326 Ga0157380_10294006 Ga0157380_102940062 234
99 3300025926 Ga0207659_10327028 Ga0207659_103270282 234
100 3300025938 Ga0207704_10428917 Ga0207704_104289171 234
101 3300025940 Ga0207691_10010991 Ga0207691_100109915 234
102 3300025940 Ga0207691_10077217 Ga0207691_100772173 234
103 3300026089 Ga0207648_10237217 Ga0207648_102372172 234
104 3300005436 Ga0070713_100173092 Ga0070713_1001730923 235
105 3300006028 Ga0070717_10441651 Ga0070717_104416512 235
106 3300006237 Ga0097621_100284698 Ga0097621_1002846982 235
107 3300030733 Ga0314311_1150282 Ga0314311_11502823 235
108 3300032005 Ga0307411_10293811 Ga0307411_102938112 235
109 3300041410 Ga0439461_0021134 Ga0439461_0021134_57_845 235
110 3300042156 Ga0439446_0002028 Ga0439446_0002028_2456_3244 235
111 3300048925 Ga0496122_0034206 Ga0496122_0034206_2309_3118 235
112 3300048926 Ga0496123_0004412 Ga0496123_0004412_5364_6173 235
113 3300049572 Ga0501036_0189614 Ga0501036_0189614_216_941 235
114 3300049572 Ga0501036_0433907 Ga0501036_0433907_297_1085 235
115 3300049575 Ga0501039_0015187 Ga0501039_0015187_85_810 235
116 3300049576 Ga0501040_0028612 Ga0501040_0028612_2257_2982 235
117 3300049577 Ga0501041_0002404 Ga0501041_0002404_7569_8294 235
118 3300049577 Ga0501041_0006696 Ga0501041_0006696_1532_2320 235
119 3300049579 Ga0501043_0012695 Ga0501043_0012695_5621_6346 235
120 3300049582 Ga0501048_0189279 Ga0501048_0189279_325_1050 235
121 3300049587 Ga0501071_0011488 Ga0501071_0011488_3862_4587 235
122 3300049588 Ga0501072_0200199 Ga0501072_0200199_90_815 235
123 3300049591 Ga0501075_0058953 Ga0501075_0058953_612_1337 235
124 3300049592 Ga0501076_0011408 Ga0501076_0011408_2484_3209 235
125 3300049822 Ga0501035_0155201 Ga0501035_0155201_54_779 235
126 3300049824 Ga0501045_0062480 Ga0501045_0062480_255_980 235
127 3300054114 Ga0501084_0023612 Ga0501084_0023612_447_1172 235
128 3300060353 Ga0501082_0005977 Ga0501082_0005977_5883_6608 235
129 3300003322 rootL2_10055265 rootL2_100552652 236
130 3300003784 Ga0055534_1003939 Ga0055534_10039392 236
131 3300005354 Ga0070675_100321492 Ga0070675_1003214922 236
132 3300005364 Ga0070673_100524112 Ga0070673_1005241122 236
133 3300025284 Ga0209130_1016584 Ga0209130_10165842 236
134 3300025291 Ga0209675_1001897 Ga0209675_10018972 236
135 3300025292 Ga0209676_1020288 Ga0209676_10202882 236
136 3300025295 Ga0209564_1039105 Ga0209564_10391051 236
137 3300025303 Ga0209051_1020044 Ga0209051_10200442 236
138 3300025304 Ga0209257_1007879 Ga0209257_10078794 236
139 3300046615 Ga0495656_0013520 Ga0495656_0013520_750_1472 236
140 3300046616 Ga0495668_0000681 Ga0495668_0000681_15254_16042 236
141 3300047318 Ga0495636_0011051 Ga0495636_0011051_2767_3489 236
142 3300048911 Ga0496108_0224766 Ga0496108_0224766_175_897 236
143 3300048912 Ga0496109_0121333 Ga0496109_0121333_395_1117 236
144 3300048914 Ga0496111_0278171 Ga0496111_0278171_270_992 236
145 3300048917 Ga0496114_0158950 Ga0496114_0158950_1232_1954 236
146 3300005436 Ga0070713_100437197 Ga0070713_1004371971 237
147 3300005459 Ga0068867_100549100 Ga0068867_1005491001 237
148 3300005467 Ga0070706_100046962 Ga0070706_1000469622 237
149 3300005467 Ga0070706_100147422 Ga0070706_1001474222 237
150 3300005468 Ga0070707_100311578 Ga0070707_1003115782 237
151 3300005471 Ga0070698_100131748 Ga0070698_1001317481 237
152 3300005518 Ga0070699_100123539 Ga0070699_1001235392 237
153 3300005536 Ga0070697_100118575 Ga0070697_1001185752 237
154 3300006028 Ga0070717_10072109 Ga0070717_100721094 237
155 3300006237 Ga0097621_100022185 Ga0097621_1000221853 237
156 3300006358 Ga0068871_100017429 Ga0068871_1000174292 237
157 3300025910 Ga0207684_10099326 Ga0207684_100993263 237
158 3300025910 Ga0207684_10221853 Ga0207684_102218531 237
159 3300025922 Ga0207646_10624795 Ga0207646_106247952 237
160 3300025928 Ga0207700_10135300 Ga0207700_101353001 237
161 3300025929 Ga0207664_10691548 Ga0207664_106915481 237
162 3300041501 Ga0451845_0393817 Ga0451845_0393817_30_848 237
163 3300003792 Ga0055540_1000625 Ga0055540_100062511 238
164 3300005456 Ga0070678_100104732 Ga0070678_1001047323 238
165 3300025303 Ga0209051_1000271 Ga0209051_100027140 238
166 3300026075 Ga0207708_10071198 Ga0207708_100711982 238
167 3300026121 Ga0207683_10076230 Ga0207683_100762303 238
168 3300031251 Ga0265327_10117302 Ga0265327_101173022 238
169 3300039447 Ga0436361_0759821 Ga0436361_0759821_502_1275 238
170 3300050496 nmdc:mga07m45_42522_c1 nmdc:mga07m45_42522_c1_1095_1928 238
171 3300005327 Ga0070658_10006378 Ga0070658_1000637811 239
172 3300005364 Ga0070673_100236884 Ga0070673_1002368842 239
173 3300005548 Ga0070665_100005593 Ga0070665_10000559310 239
174 3300005617 Ga0068859_100288940 Ga0068859_1002889402 239
175 3300006931 Ga0097620_100288967 Ga0097620_1002889674 239
176 3300009093 Ga0105240_10331375 Ga0105240_103313753 239
177 3300021361 Ga0213872_10030461 Ga0213872_100304612 239
178 3300025908 Ga0207643_10223059 Ga0207643_102230592 239
179 3300025925 Ga0207650_10490009 Ga0207650_104900092 239
180 3300025961 Ga0207712_10342035 Ga0207712_103420351 239
181 3300026089 Ga0207648_10144894 Ga0207648_101448941 239
182 3300028379 Ga0268266_10000276 Ga0268266_1000027627 239
183 3300028794 Ga0307515_10001343 Ga0307515_1000134315 239
184 3300031665 Ga0316575_10164074 Ga0316575_101640742 239
185 3300039447 Ga0436361_0201117 Ga0436361_0201117_3168_3953 239
186 3300041512 Ga0451853_1218881 Ga0451853_1218881_54_836 239
187 3300048924 Ga0496121_0049489 Ga0496121_0049489_1859_2593 239
188 3300048929 Ga0496126_0044652 Ga0496126_0044652_259_993 239
189 3300050511 nmdc:mga08y16_431644_c1 nmdc:mga08y16_431644_c1_248_982 239
190 iso_pu_bacteria 2643221585 2643934351 239
191 iso_pu_bacteria 2643221656 2644315838 239
192 3300013308 Ga0157375_10724851 Ga0157375_107248511 240
193 3300025909 Ga0207705_10232650 Ga0207705_102326502 240
194 3300025944 Ga0207661_10349605 Ga0207661_103496052 240
195 3300025960 Ga0207651_10007310 Ga0207651_100073102 240
196 3300041407 Ga0439447_000529 Ga0439447_000529_2364_3152 240
197 3300006178 Ga0075367_10071757 Ga0075367_100717573 241
198 3300010375 Ga0105239_10113071 Ga0105239_101130712 241
199 3300013297 Ga0157378_10047413 Ga0157378_100474133 241
200 3300025263 Ga0209565_1013694 Ga0209565_10136942 241
201 3300025299 Ga0209256_1000120 Ga0209256_100012021 241
202 3300025728 Ga0207655_1047804 Ga0207655_10478042 241
203 3300048917 Ga0496114_0043794 Ga0496114_0043794_2249_3010 241
204 3300050489 nmdc:mga03683_100965_c1 nmdc:mga03683_100965_c1_258_1040 241
205 3300005333 Ga0070677_10097407 Ga0070677_100974072 242
206 3300005985 Ga0081539_10029495 Ga0081539_100294953 242
207 3300006038 Ga0075365_10131459 Ga0075365_101314591 242
208 3300006880 Ga0075429_100396202 Ga0075429_1003962022 242
209 3300009094 Ga0111539_10015684 Ga0111539_100156847 242
210 3300009147 Ga0114129_10171771 Ga0114129_101717712 242
211 3300011119 Ga0105246_10048831 Ga0105246_100488312 242
212 3300025937 Ga0207669_10072473 Ga0207669_100724732 242
213 3300027907 Ga0207428_10010548 Ga0207428_100105487 242
214 3300046542 Ga0495597_0003400 Ga0495597_0003400_5793_6557 242
215 3300046664 Ga0495659_0000557 Ga0495659_0000557_6483_7247 242
216 3300046692 Ga0495671_0000086 Ga0495671_0000086_76159_76923 242
217 3300047320 Ga0495672_0000458 Ga0495672_0000458_27516_28280 242
218 3300050489 nmdc:mga03683_43024_c1 nmdc:mga03683_43024_c1_708_1448 242
219 3300050511 nmdc:mga08y16_14823_c1 nmdc:mga08y16_14823_c1_1798_2559 242
220 3300005327 Ga0070658_10393348 Ga0070658_103933483 243
221 3300005329 Ga0070683_100007807 Ga0070683_10000780711 243
222 3300005337 Ga0070682_100461931 Ga0070682_1004619311 243
223 3300005344 Ga0070661_100039349 Ga0070661_1000393493 243
224 3300005563 Ga0068855_100032438 Ga0068855_1000324384 243
225 3300005563 Ga0068855_100655682 Ga0068855_1006556822 243
226 3300005564 Ga0070664_100006836 Ga0070664_1000068367 243
227 3300005614 Ga0068856_100005465 Ga0068856_1000054655 243
228 3300005616 Ga0068852_100077532 Ga0068852_1000775323 243
229 3300005834 Ga0068851_10215542 Ga0068851_102155421 243
230 3300005937 Ga0081455_10023053 Ga0081455_100230532 243
231 3300011119 Ga0105246_10278320 Ga0105246_102783202 243
232 3300013100 Ga0157373_10268384 Ga0157373_102683841 243
233 3300013104 Ga0157370_10469454 Ga0157370_104694542 243
234 3300013105 Ga0157369_10070182 Ga0157369_100701822 243
235 3300013307 Ga0157372_10008371 Ga0157372_100083714 243
236 3300014497 Ga0182008_10100425 Ga0182008_101004251 243
237 3300017792 Ga0163161_10000127 Ga0163161_100001279 243
238 3300025944 Ga0207661_10007104 Ga0207661_1000710411 243
239 3300025949 Ga0207667_10024754 Ga0207667_100247545 243
240 3300025949 Ga0207667_10523706 Ga0207667_105237062 243
241 3300026078 Ga0207702_10016789 Ga0207702_100167894 243
242 3300026116 Ga0207674_10067265 Ga0207674_100672654 243
243 3300026118 Ga0207675_100848070 Ga0207675_1008480701 243
244 3300026142 Ga0207698_10004401 Ga0207698_100044014 243
245 3300030731 Ga0316177_1121344 Ga0316177_11213444 243
246 3300031507 Ga0307509_10023870 Ga0307509_100238704 243
247 3300031616 Ga0307508_10060284 Ga0307508_100602842 243
248 3300037312 Ga0395899_0047170 Ga0395899_0047170_1131_1898 243
249 3300037471 Ga0395905_0114921 Ga0395905_0114921_1127_1873 243
250 3300038443 Ga0395901_0013644 Ga0395901_0013644_1224_1991 243
251 3300042005 Ga0439448_0074588 Ga0439448_0074588_53_820 243
252 3300046517 Ga0495630_0000030 Ga0495630_0000030_64511_65275 243
253 3300049759 Ga0501262_000176 Ga0501262_000176_6165_7004 243
254 3300005439 Ga0070711_100490847 Ga0070711_1004908471 244
255 3300005548 Ga0070665_100749225 Ga0070665_1007492251 244
256 3300006048 Ga0075363_100072347 Ga0075363_1000723473 244
257 3300006186 Ga0075369_10014386 Ga0075369_100143862 244
258 3300014968 Ga0157379_10243909 Ga0157379_102439092 244
259 3300026088 Ga0207641_10644410 Ga0207641_106444102 244
260 3300028380 Ga0268265_10583115 Ga0268265_105831151 244
261 3300028381 Ga0268264_10641211 Ga0268264_106412112 244
262 3300030734 Ga0316179_1019061 Ga0316179_10190612 244
263 3300030742 Ga0316183_1128149 Ga0316183_11281492 244
264 3300030744 Ga0316181_1134026 Ga0316181_11340263 244
265 3300030745 Ga0316182_1365804 Ga0316182_13658041 244
266 3300031548 Ga0307408_100252878 Ga0307408_1002528781 244
267 3300031911 Ga0307412_10005923 Ga0307412_100059233 244
268 3300037418 Ga0395900_0066916 Ga0395900_0066916_2841_3599 244
269 3300037471 Ga0395905_0086403 Ga0395905_0086403_364_1122 244
270 3300038443 Ga0395901_0070453 Ga0395901_0070453_2634_3392 244
271 3300049663 Ga0501223_021719 Ga0501223_021719_91_879 244
272 3300050489 nmdc:mga03683_31153_c1 nmdc:mga03683_31153_c1_198_992 244
273 3300050489 nmdc:mga03683_7996_c1 nmdc:mga03683_7996_c1_864_1619 244
274 3300053139 Ga0500568_0008442 Ga0500568_0008442_2857_3708 244
275 3300005548 Ga0070665_100027314 Ga0070665_1000273146 245
276 3300005563 Ga0068855_100055019 Ga0068855_1000550191 245
277 3300005577 Ga0068857_100413942 Ga0068857_1004139422 245
278 3300006058 Ga0075432_10017697 Ga0075432_100176973 245
279 3300007076 Ga0075435_100110885 Ga0075435_1001108852 245
280 3300009093 Ga0105240_10039722 Ga0105240_100397227 245
281 3300009093 Ga0105240_10048411 Ga0105240_100484116 245
282 3300025913 Ga0207695_10125579 Ga0207695_101255793 245
283 3300025949 Ga0207667_10119750 Ga0207667_101197502 245
284 3300026116 Ga0207674_10356524 Ga0207674_103565241 245
285 3300031251 Ga0265327_10000841 Ga0265327_1000084110 245
286 3300031731 Ga0307405_10033160 Ga0307405_100331605 245
287 3300031824 Ga0307413_10202749 Ga0307413_102027492 245
288 3300031995 Ga0307409_100000680 Ga0307409_10000068013 245
289 3300032002 Ga0307416_100001182 Ga0307416_10000118211 245
290 3300032004 Ga0307414_10069798 Ga0307414_100697983 245
291 3300032126 Ga0307415_100003784 Ga0307415_10000378410 245
292 3300042004 Ga0439445_0056153 Ga0439445_0056153_225_1007 245
293 3300042531 Ga0450918_000414 Ga0450918_000414_6177_6917 245
294 3300048924 Ga0496121_0008905 Ga0496121_0008905_2796_3587 245
295 3300050492 nmdc:mga0yw44_478019_c1 nmdc:mga0yw44_478019_c1_28_780 245
296 3300050513 nmdc:mga0rr50_95526_c1 nmdc:mga0rr50_95526_c1_677_1441 245
297 3300053096 Ga0500641_0008683 Ga0500641_0008683_2464_3237 245
298 iso_pu_bacteria 2643221683 2644468701 245
299 3300005563 Ga0068855_100202244 Ga0068855_1002022442 246
300 3300009098 Ga0105245_10504539 Ga0105245_105045392 246
301 3300014969 Ga0157376_10000023 Ga0157376_10000023161 246
302 3300025291 Ga0209675_1027953 Ga0209675_10279532 246
303 3300025918 Ga0207662_10036678 Ga0207662_100366782 246
304 3300041413 Ga0439465_0000084 Ga0439465_0000084_7104_7901 246
305 3300042007 Ga0439449_0000268 Ga0439449_0000268_9497_10294 246
306 3300048917 Ga0496114_0006538 Ga0496114_0006538_443_1315 246
307 iso_pu_bacteria 2738541280 2738742656 246
308 iso_pu_bacteria 2738541300 2738846566 246
309 iso_pu_bacteria 2738543018 2739277208 246
310 iso_pu_bacteria 2738543030 2739346232 246
311 3300003323 rootH1_10154922 rootH1_101549222 247
312 3300003792 Ga0055540_1000015 Ga0055540_1000015173 247
313 3300003794 Ga0055531_10009441 Ga0055531_100094414 247
314 3300005330 Ga0070690_100279968 Ga0070690_1002799681 247
315 3300005544 Ga0070686_100468523 Ga0070686_1004685231 247
316 3300005617 Ga0068859_100637578 Ga0068859_1006375782 247
317 3300005937 Ga0081455_10221551 Ga0081455_102215512 247
318 3300006844 Ga0075428_100084707 Ga0075428_1000847074 247
319 3300006847 Ga0075431_100005078 Ga0075431_1000050781 247
320 3300006880 Ga0075429_100002970 Ga0075429_10000297011 247
321 3300006931 Ga0097620_100637647 Ga0097620_1006376472 247
322 3300009147 Ga0114129_10007699 Ga0114129_100076993 247
323 3300009174 Ga0105241_10092724 Ga0105241_100927243 247
324 3300009553 Ga0105249_10554275 Ga0105249_105542753 247
325 3300013104 Ga0157370_10121753 Ga0157370_101217532 247
326 3300025298 Ga0209050_1000170 Ga0209050_100017078 247
327 3300025298 Ga0209050_1000529 Ga0209050_100052945 247
328 3300025303 Ga0209051_1000020 Ga0209051_1000020418 247
329 3300025304 Ga0209257_1000189 Ga0209257_1000189152 247
330 3300031507 Ga0307509_10109053 Ga0307509_101090532 247
331 3300031616 Ga0307508_10000549 Ga0307508_1000054937 247
332 3300031649 Ga0307514_10003783 Ga0307514_1000378310 247
333 3300039438 Ga0436360_0378379 Ga0436360_0378379_2669_3457 247
334 3300039447 Ga0436361_1117914 Ga0436361_1117914_1570_2358 247
335 3300041491 Ga0451833_1255216 Ga0451833_1255216_90_863 247
336 3300046507 Ga0495606_0007042 Ga0495606_0007042_3248_3997 247
337 3300047472 Ga0495686_0006678 Ga0495686_0006678_1628_2398 247
338 3300049579 Ga0501043_0169394 Ga0501043_0169394_422_1174 247
339 3300050507 nmdc:mga05p37_6901_c1 nmdc:mga05p37_6901_c1_12068_12850 247
340 3300050508 nmdc:mga09592_4077_c1 nmdc:mga09592_4077_c1_538_1320 247
341 3300050510 nmdc:mga06r32_220734_c1 nmdc:mga06r32_220734_c1_380_1162 247
342 3300053120 Ga0500597_197105 Ga0500597_197105_17_766 247
343 iso_pu_bacteria 2738541277 2738720987 247
344 iso_pu_bacteria 2738543019 2739280186 247
345 3300002705 JGI25156J39149_1000016 JGI25156J39149_1000016129 248
346 3300002705 JGI25156J39149_1000061 JGI25156J39149_100006128 248
347 3300002741 JGI25157J39369_1000035 JGI25157J39369_10000359 248
348 3300002741 JGI25157J39369_1000180 JGI25157J39369_100018047 248
349 3300003752 Ga0055539_1008631 Ga0055539_10086312 248
350 3300005330 Ga0070690_100069279 Ga0070690_1000692793 248
351 3300005338 Ga0068868_100184829 Ga0068868_1001848292 248
352 3300005436 Ga0070713_100230015 Ga0070713_1002300153 248
353 3300005539 Ga0068853_100059813 Ga0068853_1000598132 248
354 3300005563 Ga0068855_100040092 Ga0068855_1000400923 248
355 3300005577 Ga0068857_100155059 Ga0068857_1001550591 248
356 3300005614 Ga0068856_100135356 Ga0068856_1001353562 248
357 3300005840 Ga0068870_10303013 Ga0068870_103030132 248
358 3300005937 Ga0081455_10000211 Ga0081455_1000021130 248
359 3300005937 Ga0081455_10033603 Ga0081455_100336032 248
360 3300005985 Ga0081539_10012312 Ga0081539_100123122 248
361 3300006042 Ga0075368_10067240 Ga0075368_100672402 248
362 3300006051 Ga0075364_10099648 Ga0075364_100996482 248
363 3300006195 Ga0075366_10014177 Ga0075366_100141777 248
364 3300006237 Ga0097621_100504782 Ga0097621_1005047822 248
365 3300009551 Ga0105238_10059850 Ga0105238_100598503 248
366 3300010375 Ga0105239_10047798 Ga0105239_100477985 248
367 3300013307 Ga0157372_10099893 Ga0157372_100998931 248
368 3300014497 Ga0182008_10021087 Ga0182008_100210872 248
369 3300015262 Ga0182007_10003164 Ga0182007_100031648 248
370 3300025246 Ga0209646_1000056 Ga0209646_1000056145 248
371 3300025250 Ga0209026_1000009 Ga0209026_1000009345 248
372 3300025253 Ga0209677_100198 Ga0209677_10019834 248
373 3300025256 Ga0209759_1000035 Ga0209759_1000035118 248
374 3300025908 Ga0207643_10290194 Ga0207643_102901941 248
375 3300025919 Ga0207657_10174036 Ga0207657_101740362 248
376 3300025924 Ga0207694_10070372 Ga0207694_100703723 248
377 3300025928 Ga0207700_10097431 Ga0207700_100974312 248
378 3300025949 Ga0207667_10059920 Ga0207667_100599202 248
379 3300025972 Ga0207668_10138875 Ga0207668_101388752 248
380 3300026041 Ga0207639_10016455 Ga0207639_100164555 248
381 3300026078 Ga0207702_10007291 Ga0207702_100072918 248
382 3300026116 Ga0207674_10004183 Ga0207674_1000418312 248
383 3300027866 Ga0209813_10070936 Ga0209813_100709361 248
384 3300028794 Ga0307515_10000212 Ga0307515_1000021252 248
385 3300028794 Ga0307515_10006216 Ga0307515_1000621618 248
386 3300037068 Ga0373925_0070054 Ga0373925_0070054_1284_2069 248
387 3300038443 Ga0395901_0010155 Ga0395901_0010155_7836_8606 248
388 3300042145 Ga0450906_023736 Ga0450906_023736_82_864 248
389 3300046471 Ga0495650_0067401 Ga0495650_0067401_400_1176 248
390 3300046539 Ga0495621_0036563 Ga0495621_0036563_674_1441 248
391 3300046660 Ga0495625_0018461 Ga0495625_0018461_3561_4319 248
392 3300048907 Ga0496104_0027094 Ga0496104_0027094_3226_3993 248
393 3300048917 Ga0496114_0097975 Ga0496114_0097975_248_1015 248
394 3300049766 Ga0501269_000229 Ga0501269_000229_11808_12566 248
395 3300050489 nmdc:mga03683_126965_c1 nmdc:mga03683_126965_c1_264_1040 248
396 3300050491 nmdc:mga00v17_180286_c1 nmdc:mga00v17_180286_c1_276_1031 248
397 3300050493 nmdc:mga0k408_89021_c1 nmdc:mga0k408_89021_c1_241_1017 248
398 3300050494 nmdc:mga06z11_5710_c1 nmdc:mga06z11_5710_c1_2049_2816 248
399 3300050495 nmdc:mga04h51_48324_c1 nmdc:mga04h51_48324_c1_20_796 248
400 3300050508 nmdc:mga09592_159191_c1 nmdc:mga09592_159191_c1_709_1512 248
401 3300050516 nmdc:mga0sz30_2905_c1 nmdc:mga0sz30_2905_c1_2177_2944 248
402 3300053739 Ga0500587_002124 Ga0500587_002124_1206_1997 248
403 iso_pu_bacteria 2643221645 2644255374 248
404 iso_pu_bacteria 2643221664 2644359898 248
405 iso_pu_bacteria 2842677519 2842680949 248
406 iso_pu_bacteria 2894023352 2894025053 248
407 iso_pu_bacteria 2919462493 2919466757 248
408 3300003752 Ga0055539_1000124 Ga0055539_100012444 249
409 3300003756 Ga0055533_1000024 Ga0055533_10000243 249
410 3300003759 Ga0055525_1001151 Ga0055525_10011515 249
411 3300003781 Ga0055536_1002555 Ga0055536_10025552 249
412 3300003792 Ga0055540_1001156 Ga0055540_10011565 249
413 3300005344 Ga0070661_100001406 Ga0070661_10000140612 249
414 3300005353 Ga0070669_100306889 Ga0070669_1003068891 249
415 3300005356 Ga0070674_100008397 Ga0070674_1000083976 249
416 3300005367 Ga0070667_100423243 Ga0070667_1004232431 249
417 3300005456 Ga0070678_100321072 Ga0070678_1003210721 249
418 3300005459 Ga0068867_100000287 Ga0068867_1000002876 249
419 3300005564 Ga0070664_100005979 Ga0070664_1000059792 249
420 3300005718 Ga0068866_10001764 Ga0068866_100017647 249
421 3300005719 Ga0068861_100821686 Ga0068861_1008216861 249
422 3300005842 Ga0068858_100033996 Ga0068858_1000339963 249
423 3300005843 Ga0068860_100000444 Ga0068860_10000044423 249
424 3300005844 Ga0068862_100005619 Ga0068862_1000056193 249
425 3300005844 Ga0068862_100087278 Ga0068862_1000872781 249
426 3300006881 Ga0068865_100072113 Ga0068865_1000721132 249
427 3300009148 Ga0105243_10001557 Ga0105243_1000155723 249
428 3300009148 Ga0105243_10036123 Ga0105243_100361236 249
429 3300009176 Ga0105242_10631983 Ga0105242_106319832 249
430 3300013306 Ga0163162_10005859 Ga0163162_100058596 249
431 3300013308 Ga0157375_10042937 Ga0157375_100429372 249
432 3300025226 Ga0209674_100007 Ga0209674_10000749 249
433 3300025230 Ga0209563_100060 Ga0209563_100060220 249
434 3300025253 Ga0209677_100108 Ga0209677_10010842 249
435 3300025292 Ga0209676_1000785 Ga0209676_100078518 249
436 3300025294 Ga0209025_1002222 Ga0209025_100222214 249
437 3300025303 Ga0209051_1000398 Ga0209051_100039818 249
438 3300025304 Ga0209257_1009161 Ga0209257_10091616 249
439 3300025899 Ga0207642_10003806 Ga0207642_100038066 249
440 3300025920 Ga0207649_10023829 Ga0207649_100238294 249
441 3300025923 Ga0207681_10334874 Ga0207681_103348742 249
442 3300025932 Ga0207690_10095180 Ga0207690_100951803 249
443 3300025935 Ga0207709_10000295 Ga0207709_1000029529 249
444 3300025935 Ga0207709_10031111 Ga0207709_100311112 249
445 3300025938 Ga0207704_10004798 Ga0207704_100047982 249
446 3300025942 Ga0207689_10220933 Ga0207689_102209332 249
447 3300025945 Ga0207679_10000088 Ga0207679_1000008852 249
448 3300025945 Ga0207679_10000265 Ga0207679_1000026516 249
449 3300025986 Ga0207658_10447202 Ga0207658_104472021 249
450 3300026035 Ga0207703_10052243 Ga0207703_100522433 249
451 3300026089 Ga0207648_10000283 Ga0207648_1000028330 249
452 3300026118 Ga0207675_100119096 Ga0207675_1001190962 249
453 3300026118 Ga0207675_101037710 Ga0207675_1010377101 249
454 3300028380 Ga0268265_10051884 Ga0268265_100518843 249
455 3300028381 Ga0268264_10008357 Ga0268264_100083579 249
456 3300028666 Ga0265336_10000022 Ga0265336_10000022167 249
457 3300031548 Ga0307408_100044597 Ga0307408_1000445973 249
458 3300031731 Ga0307405_10023689 Ga0307405_100236893 249
459 3300032002 Ga0307416_100618044 Ga0307416_1006180441 249
460 3300044658 Ga0466972_0001578 Ga0466972_0001578_6453_7220 249
461 3300046506 Ga0495583_0000793 Ga0495583_0000793_30871_31644 249
462 3300046507 Ga0495606_0005138 Ga0495606_0005138_8288_9061 249
463 3300046507 Ga0495606_0155394 Ga0495606_0155394_379_1158 249
464 3300046660 Ga0495625_0114367 Ga0495625_0114367_299_1072 249
465 3300046694 Ga0495649_0004901 Ga0495649_0004901_456_1229 249
466 3300046794 Ga0495589_0008420 Ga0495589_0008420_758_1531 249
467 iso_pu_bacteria 2643221559 2643816855 249
468 iso_pu_bacteria 2643221586 2643939275 249
469 iso_pu_bacteria 2643221593 2643976020 249
470 iso_pu_bacteria 2643221612 2644077951 249
471 iso_pu_bacteria 2643221727 2644696252 249
472 iso_pu_bacteria 2738541307 2738880979 249
473 3300003316 rootH1_10001573 rootH1_100015732 250
474 3300003322 rootL2_10049763 rootL2_100497634 250
475 3300003761 Ga0055535_1000183 Ga0055535_100018310 250
476 3300003761 Ga0055535_1000393 Ga0055535_10003933 250
477 3300003761 Ga0055535_1006549 Ga0055535_10065492 250
478 3300003763 Ga0055529_1000064 Ga0055529_100006463 250
479 3300003763 Ga0055529_1002064 Ga0055529_10020645 250
480 3300005288 Ga0065714_10012400 Ga0065714_100124003 250
481 3300005339 Ga0070660_100374063 Ga0070660_1003740631 250
482 3300005344 Ga0070661_100292933 Ga0070661_1002929332 250
483 3300005355 Ga0070671_100014483 Ga0070671_1000144833 250
484 3300005618 Ga0068864_100083709 Ga0068864_1000837092 250
485 3300005841 Ga0068863_100120711 Ga0068863_1001207112 250
486 3300006177 Ga0075362_10075928 Ga0075362_100759282 250
487 3300006353 Ga0075370_10049998 Ga0075370_100499982 250
488 3300006880 Ga0075429_100006854 Ga0075429_1000068543 250
489 3300006881 Ga0068865_100537199 Ga0068865_1005371991 250
490 3300009093 Ga0105240_10003444 Ga0105240_1000344411 250
491 3300009176 Ga0105242_10006406 Ga0105242_100064068 250
492 3300009177 Ga0105248_10001750 Ga0105248_1000175017 250
493 3300025228 Ga0209672_103582 Ga0209672_1035823 250
494 3300025242 Ga0209258_100124 Ga0209258_100124116 250
495 3300025242 Ga0209258_100415 Ga0209258_10041521 250
496 3300025256 Ga0209759_1001942 Ga0209759_100194210 250
497 3300025272 Ga0209455_1000114 Ga0209455_100011463 250
498 3300025272 Ga0209455_1000337 Ga0209455_100033742 250
499 3300025728 Ga0207655_1003754 Ga0207655_10037546 250
500 3300025913 Ga0207695_10001146 Ga0207695_1000114610 250
501 3300025931 Ga0207644_10031872 Ga0207644_100318723 250
502 3300025940 Ga0207691_10113200 Ga0207691_101132002 250
503 3300026088 Ga0207641_10108254 Ga0207641_101082542 250
504 3300026089 Ga0207648_10185179 Ga0207648_101851793 250
505 3300028786 Ga0307517_10100690 Ga0307517_101006901 250
506 3300030521 Ga0307511_10138468 Ga0307511_101384682 250
507 3300031730 Ga0307516_10001203 Ga0307516_100012033 250
508 3300031901 Ga0307406_10036690 Ga0307406_100366903 250
509 3300039447 Ga0436361_1173055 Ga0436361_1173055_2308_3081 250
510 3300046453 Ga0495627_006828 Ga0495627_006828_2114_2896 250
511 3300046475 Ga0495639_0002546 Ga0495639_0002546_6701_7483 250
512 3300046491 Ga0495584_0003469 Ga0495584_0003469_5356_6126 250
513 3300046492 Ga0495585_0053252 Ga0495585_0053252_95_874 250
514 3300046515 Ga0495620_0137700 Ga0495620_0137700_35_817 250
515 3300046520 Ga0495637_0000370 Ga0495637_0000370_26202_26972 250
516 3300046520 Ga0495637_0001189 Ga0495637_0001189_3721_4503 250
517 3300046530 Ga0495654_0062108 Ga0495654_0062108_729_1529 250
518 3300046530 Ga0495654_0077578 Ga0495654_0077578_118_888 250
519 3300046539 Ga0495621_0037761 Ga0495621_0037761_756_1526 250
520 3300046660 Ga0495625_0193880 Ga0495625_0193880_222_1004 250
521 3300046674 Ga0495588_0043306 Ga0495588_0043306_326_1108 250
522 3300046691 Ga0495670_0027741 Ga0495670_0027741_926_1708 250
523 3300047469 Ga0495673_0088134 Ga0495673_0088134_169_939 250
524 3300048907 Ga0496104_0025417 Ga0496104_0025417_205_993 250
525 3300048909 Ga0496106_0321985 Ga0496106_0321985_128_898 250
526 3300048911 Ga0496108_0056426 Ga0496108_0056426_1036_1824 250
527 3300048912 Ga0496109_0061608 Ga0496109_0061608_309_1079 250
528 3300048912 Ga0496109_0245079 Ga0496109_0245079_473_1261 250
529 3300048913 Ga0496110_0052425 Ga0496110_0052425_2569_3339 250
530 3300048917 Ga0496114_0518415 Ga0496114_0518415_137_907 250
531 3300048925 Ga0496122_0199841 Ga0496122_0199841_30_812 250
532 3300049459 Ga0495678_000302 Ga0495678_000302_38673_39443 250
533 3300049579 Ga0501043_0254805 Ga0501043_0254805_276_1103 250
534 3300049822 Ga0501035_0020829 Ga0501035_0020829_2095_2922 250
535 3300050492 nmdc:mga0yw44_28476_c1 nmdc:mga0yw44_28476_c1_2152_2964 250
536 3300053079 Ga0500610_0001037 Ga0500610_0001037_7463_8245 250
537 3300053079 Ga0500610_0021069 Ga0500610_0021069_1652_2434 250
538 3300053088 Ga0500644_0001451 Ga0500644_0001451_4169_4948 250
539 3300053096 Ga0500641_0119735 Ga0500641_0119735_65_847 250
540 3300053108 Ga0500562_001416 Ga0500562_001416_3412_4203 250
541 3300053117 Ga0500593_001175 Ga0500593_001175_951_1733 250
542 3300053121 Ga0500607_000368 Ga0500607_000368_1361_2146 250
543 3300053158 Ga0500627_0017867 Ga0500627_0017867_1032_1814 250
544 3300053177 Ga0500636_0153269 Ga0500636_0153269_390_1166 250
545 iso_pu_bacteria 2585428062 2587754043 250
546 iso_pu_bacteria 2643221573 2643880333 250
547 iso_pu_bacteria 2643221581 2643915481 250
548 iso_pu_bacteria 2643221592 2643970832 250
549 iso_pu_bacteria 2643221625 2644138895 250
550 iso_pu_bacteria 2643221628 2644159153 250
551 iso_pu_bacteria 2643221648 2644273874 250
552 iso_pu_bacteria 2643221728 2644698992 250
553 iso_pu_bacteria 2894414249 2894417004 250
554 iso_pu_bacteria 2904449895 2904453405 250
555 iso_pu_bacteria 2904456579 2904459376 250
556 iso_pu_bacteria 2923516293 2923518992 250
557 iso_pu_bacteria 2929520902 2929523138 250
558 iso_pu_bacteria 2945909444 2945910479 250
559 iso_pu_bacteria 2945945610 2945948485 250
560 iso_pu_bacteria 2945972063 2945972174 250
561 iso_pu_bacteria 2945984333 2945987465 250
562 3300003578 Ga0006562J51391_1111735 Ga0006562J51391_11117352 251
563 3300003771 Ga0055526_1032910 Ga0055526_10329102 251
564 3300003775 Ga0055524_1002702 Ga0055524_10027024 251
565 3300003775 Ga0055524_1002878 Ga0055524_10028787 251
566 3300003781 Ga0055536_1011792 Ga0055536_10117924 251
567 3300003784 Ga0055534_1024889 Ga0055534_10248891 251
568 3300003791 Ga0055530_10005109 Ga0055530_100051096 251
569 3300003794 Ga0055531_10031543 Ga0055531_100315432 251
570 3300005288 Ga0065714_10135375 Ga0065714_101353751 251
571 3300005353 Ga0070669_100238623 Ga0070669_1002386232 251
572 3300005455 Ga0070663_100307632 Ga0070663_1003076321 251
573 3300005457 Ga0070662_100007583 Ga0070662_1000075838 251
574 3300005578 Ga0068854_100018452 Ga0068854_1000184526 251
575 3300005844 Ga0068862_100007521 Ga0068862_1000075213 251
576 3300006186 Ga0075369_10142855 Ga0075369_101428551 251
577 3300006881 Ga0068865_100177807 Ga0068865_1001778072 251
578 3300013100 Ga0157373_10036351 Ga0157373_100363513 251
579 3300013306 Ga0163162_10244309 Ga0163162_102443092 251
580 3300014497 Ga0182008_10000711 Ga0182008_100007117 251
581 3300015261 Ga0182006_1000964 Ga0182006_100096416 251
582 3300025273 Ga0209673_1006170 Ga0209673_10061706 251
583 3300025292 Ga0209676_1003468 Ga0209676_10034687 251
584 3300025295 Ga0209564_1004349 Ga0209564_10043492 251
585 3300025298 Ga0209050_1000528 Ga0209050_10005288 251
586 3300025299 Ga0209256_1000980 Ga0209256_10009802 251
587 3300025303 Ga0209051_1016226 Ga0209051_10162263 251
588 3300025304 Ga0209257_1000727 Ga0209257_100072749 251
589 3300025304 Ga0209257_1004132 Ga0209257_10041323 251
590 3300026089 Ga0207648_10169073 Ga0207648_101690732 251
591 3300028380 Ga0268265_10017636 Ga0268265_100176362 251
592 3300031730 Ga0307516_10000926 Ga0307516_1000092613 251
593 3300049705 Ga0501225_0035994 Ga0501225_0035994_265_1053 251
594 iso_pu_bacteria 2738543012 2739245075 251
595 3300003187 JGI25151J46595_10001011 JGI25151J46595_1000101118 252
596 3300005435 Ga0070714_100675924 Ga0070714_1006759242 252
597 3300005719 Ga0068861_100022190 Ga0068861_1000221902 252
598 3300005843 Ga0068860_100181705 Ga0068860_1001817052 252
599 3300006195 Ga0075366_10022500 Ga0075366_100225003 252
600 3300009148 Ga0105243_10001974 Ga0105243_100019745 252
601 3300009176 Ga0105242_10004095 Ga0105242_100040952 252
602 3300009177 Ga0105248_10209272 Ga0105248_102092723 252
603 3300014326 Ga0157380_10195170 Ga0157380_101951702 252
604 3300025245 Ga0207425_1008473 Ga0207425_10084733 252
605 3300025258 Ga0209129_1003835 Ga0209129_10038353 252
606 3300025294 Ga0209025_1000005 Ga0209025_1000005244 252
607 3300025294 Ga0209025_1001450 Ga0209025_100145024 252
608 3300025297 Ga0209758_1024888 Ga0209758_10248882 252
609 3300025929 Ga0207664_10461960 Ga0207664_104619602 252
610 3300025935 Ga0207709_10006321 Ga0207709_100063218 252
611 3300025935 Ga0207709_10054605 Ga0207709_100546052 252
612 3300025937 Ga0207669_10030757 Ga0207669_100307572 252
613 3300025941 Ga0207711_10218808 Ga0207711_102188082 252
614 3300026035 Ga0207703_10010771 Ga0207703_100107713 252
615 3300026075 Ga0207708_10000659 Ga0207708_100006592 252
616 3300026089 Ga0207648_10000741 Ga0207648_100007417 252
617 3300026118 Ga0207675_100000946 Ga0207675_10000094625 252
618 3300031548 Ga0307408_100029462 Ga0307408_1000294622 252
619 3300042006 Ga0439432_074696 Ga0439432_074696_124_912 252
620 3300049579 Ga0501043_0000101 Ga0501043_0000101_36331_37116 252
621 3300049580 Ga0501046_0000135 Ga0501046_0000135_41848_42633 252
622 3300049581 Ga0501047_0000173 Ga0501047_0000173_36438_37223 252
623 3300049582 Ga0501048_0000452 Ga0501048_0000452_8277_9062 252
624 3300049824 Ga0501045_0002898 Ga0501045_0002898_1488_2273 252
625 3300050489 nmdc:mga03683_8539_c1 nmdc:mga03683_8539_c1_21_818 252
626 3300050493 nmdc:mga0k408_34040_c1 nmdc:mga0k408_34040_c1_1655_2440 252
627 3300050494 nmdc:mga06z11_297568_c1 nmdc:mga06z11_297568_c1_141_926 252
628 3300053129 Ga0500628_002085 Ga0500628_002085_1608_2471 252
629 iso_pu_bacteria 2643221609 2644061923 252
630 iso_pu_bacteria 2643221611 2644071569 252
631 iso_pu_bacteria 2816332133 2816474568 252
632 3300003773 Ga0055537_1000010 Ga0055537_1000010101 253
633 3300003784 Ga0055534_1000015 Ga0055534_100001529 253
634 3300003790 Ga0055528_1027352 Ga0055528_10273522 253
635 3300005289 Ga0065704_10190037 Ga0065704_101900372 253
636 3300005328 Ga0070676_10059644 Ga0070676_100596441 253
637 3300005331 Ga0070670_100015017 Ga0070670_1000150177 253
638 3300005333 Ga0070677_10001118 Ga0070677_100011189 253
639 3300005335 Ga0070666_10246187 Ga0070666_102461871 253
640 3300005353 Ga0070669_100001153 Ga0070669_1000011535 253
641 3300005354 Ga0070675_100000219 Ga0070675_10000021935 253
642 3300005355 Ga0070671_100073955 Ga0070671_1000739554 253
643 3300005356 Ga0070674_100030134 Ga0070674_1000301344 253
644 3300005364 Ga0070673_100016775 Ga0070673_1000167752 253
645 3300005456 Ga0070678_100082305 Ga0070678_1000823052 253
646 3300005459 Ga0068867_100000257 Ga0068867_1000002574 253
647 3300005543 Ga0070672_100024889 Ga0070672_1000248894 253
648 3300005618 Ga0068864_100031303 Ga0068864_1000313032 253
649 3300005618 Ga0068864_100471248 Ga0068864_1004712482 253
650 3300005834 Ga0068851_10256556 Ga0068851_102565561 253
651 3300006038 Ga0075365_10059553 Ga0075365_100595532 253
652 3300006051 Ga0075364_10034721 Ga0075364_100347212 253
653 3300006051 Ga0075364_10057960 Ga0075364_100579603 253
654 3300006237 Ga0097621_100010684 Ga0097621_1000106844 253
655 3300006237 Ga0097621_100439109 Ga0097621_1004391092 253
656 3300006353 Ga0075370_10029763 Ga0075370_100297633 253
657 3300006358 Ga0068871_100026498 Ga0068871_1000264981 253
658 3300009551 Ga0105238_10009551 Ga0105238_100095515 253
659 3300013306 Ga0163162_10075011 Ga0163162_100750112 253
660 3300013308 Ga0157375_10144787 Ga0157375_101447872 253
661 3300017792 Ga0163161_10065478 Ga0163161_100654783 253
662 3300025245 Ga0207425_1034144 Ga0207425_10341442 253
663 3300025263 Ga0209565_1000025 Ga0209565_1000025165 253
664 3300025263 Ga0209565_1010809 Ga0209565_10108093 253
665 3300025273 Ga0209673_1000077 Ga0209673_1000077210 253
666 3300025273 Ga0209673_1001615 Ga0209673_100161519 253
667 3300025291 Ga0209675_1000017 Ga0209675_1000017209 253
668 3300025294 Ga0209025_1035923 Ga0209025_10359231 253
669 3300025315 Ga0207697_10155989 Ga0207697_101559891 253
670 3300025893 Ga0207682_10000318 Ga0207682_1000031819 253
671 3300025903 Ga0207680_10115550 Ga0207680_101155503 253
672 3300025923 Ga0207681_10001999 Ga0207681_1000199910 253
673 3300025924 Ga0207694_10014155 Ga0207694_100141555 253
674 3300025925 Ga0207650_10000435 Ga0207650_100004355 253
675 3300025926 Ga0207659_10000301 Ga0207659_1000030113 253
676 3300025931 Ga0207644_10037348 Ga0207644_100373483 253
677 3300025937 Ga0207669_10000291 Ga0207669_100002914 253
678 3300025940 Ga0207691_10000148 Ga0207691_1000014842 253
679 3300025960 Ga0207651_10093246 Ga0207651_100932463 253
680 3300025986 Ga0207658_10211584 Ga0207658_102115841 253
681 3300026041 Ga0207639_10353577 Ga0207639_103535772 253
682 3300026089 Ga0207648_10001569 Ga0207648_100015699 253
683 3300026095 Ga0207676_10005361 Ga0207676_100053618 253
684 3300026095 Ga0207676_10703245 Ga0207676_107032451 253
685 3300026121 Ga0207683_10027159 Ga0207683_100271597 253
686 3300028794 Ga0307515_10002672 Ga0307515_1000267215 253
687 3300028794 Ga0307515_10003631 Ga0307515_1000363125 253
688 3300030733 Ga0314311_1170870 Ga0314311_11708702 253
689 3300031548 Ga0307408_100087023 Ga0307408_1000870233 253
690 3300031649 Ga0307514_10230827 Ga0307514_102308272 253
691 3300031730 Ga0307516_10005479 Ga0307516_100054793 253
692 3300031730 Ga0307516_10009294 Ga0307516_100092949 253
693 3300031731 Ga0307405_10059202 Ga0307405_100592023 253
694 3300031901 Ga0307406_10000356 Ga0307406_100003569 253
695 3300031901 Ga0307406_10000418 Ga0307406_1000041814 253
696 3300032005 Ga0307411_10151779 Ga0307411_101517792 253
697 3300041413 Ga0439465_0040571 Ga0439465_0040571_564_1361 253
698 3300041452 Ga0451793_1414310 Ga0451793_1414310_130_921 253
699 3300041512 Ga0451853_0547373 Ga0451853_0547373_629_1420 253
700 3300042134 Ga0450898_010536 Ga0450898_010536_189_977 253
701 3300042147 Ga0450910_013718 Ga0450910_013718_353_1150 253
702 3300042184 Ga0450908_006003 Ga0450908_006003_611_1408 253
703 3300042435 Ga0439434_0026513 Ga0439434_0026513_19_816 253
704 3300042531 Ga0450918_006895 Ga0450918_006895_1029_1826 253
705 3300044683 Ga0466965_0086719 Ga0466965_0086719_505_1287 253
706 3300044719 Ga0466971_0234295 Ga0466971_0234295_74_856 253
707 3300044765 Ga0466970_0075878 Ga0466970_0075878_500_1282 253
708 3300044842 Ga0466957_0074081 Ga0466957_0074081_348_1133 253
709 3300046525 Ga0495663_0044485 Ga0495663_0044485_330_1121 253
710 3300046615 Ga0495656_0001230 Ga0495656_0001230_1432_2223 253
711 3300046660 Ga0495625_0000638 Ga0495625_0000638_18702_19499 253
712 3300046660 Ga0495625_0024281 Ga0495625_0024281_2216_3004 253
713 3300049743 Ga0501081_0312261 Ga0501081_0312261_195_983 253
714 3300050489 nmdc:mga03683_54099_c1 nmdc:mga03683_54099_c1_415_1212 253
715 3300050489 nmdc:mga03683_6512_c1 nmdc:mga03683_6512_c1_1776_2573 253
716 3300050490 nmdc:mga03n38_7168_c1 nmdc:mga03n38_7168_c1_2366_3163 253
717 3300050491 nmdc:mga00v17_36229_c1 nmdc:mga00v17_36229_c1_465_1262 253
718 3300050492 nmdc:mga0yw44_13764_c1 nmdc:mga0yw44_13764_c1_1684_2481 253
719 3300050493 nmdc:mga0k408_22684_c1 nmdc:mga0k408_22684_c1_1813_2610 253
720 3300053086 Ga0500578_0001187 Ga0500578_0001187_2118_2888 253
721 3300053122 Ga0500608_009545 Ga0500608_009545_1114_1908 253
722 3300053151 Ga0500604_0005928 Ga0500604_0005928_348_1118 253
723 3300061719 Ga0466962_0012160 Ga0466962_0012160_1577_2362 253
724 3300003781 Ga0055536_1007581 Ga0055536_10075814 254
725 3300005289 Ga0065704_10071167 Ga0065704_100711673 254
726 3300025292 Ga0209676_1000034 Ga0209676_100003480 254
727 3300031911 Ga0307412_10413423 Ga0307412_104134232 254
728 3300048920 Ga0496117_0004897 Ga0496117_0004897_10410_11240 254
729 3300049571 Ga0501034_0000898 Ga0501034_0000898_17919_18683 254
730 3300049741 Ga0501079_0425576 Ga0501079_0425576_105_935 255
731 3300050492 nmdc:mga0yw44_147998_c1 nmdc:mga0yw44_147998_c1_129_911 256
732 3300013104 Ga0157370_10001585 Ga0157370_1000158526 257
733 3300013308 Ga0157375_10303401 Ga0157375_103034012 257
734 3300015261 Ga0182006_1092354 Ga0182006_10923541 257
735 3300050508 nmdc:mga09592_5902_c1 nmdc:mga09592_5902_c1_5292_6098 257
736 3300050510 nmdc:mga06r32_35242_c1 nmdc:mga06r32_35242_c1_535_1341 257
737 3300037471 Ga0395905_0001288 Ga0395905_0001288_2095_2922 260
738 3300037471 Ga0395905_0405666 Ga0395905_0405666_219_1061 261
739 3300005288 Ga0065714_10098198 Ga0065714_100981982 262
740 3300006948 Ga0099826_10062906 Ga0099826_100629063 262
741 3300027666 Ga0209282_1000229 Ga0209282_10002293 262
742 3300046543 Ga0495645_0343906 Ga0495645_0343906_12_851 262
743 3300050489 nmdc:mga03683_6403_c1 nmdc:mga03683_6403_c1_914_1804 262
744 3300050508 nmdc:mga09592_859_c1 nmdc:mga09592_859_c1_6207_7025 262
745 3300050509 nmdc:mga0qj67_4193_c1 nmdc:mga0qj67_4193_c1_7600_8418 262
746 3300053154 Ga0500619_000183 Ga0500619_000183_4952_5842 264
747 3300005339 Ga0070660_100115501 Ga0070660_1001155012 265
748 3300050496 nmdc:mga07m45_527_c1 nmdc:mga07m45_527_c1_13460_14359 265
749 3300003790 Ga0055528_1000377 Ga0055528_10003778 268
750 2162886007 SwRhRL2b_contig_2058914 SwRhRL2b_0078.00006360 270

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

49

283

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bpf-assembly1.cif.gz_B crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis 0.8151 193 215
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.764 61 222
2yjh-assembly1.cif.gz_A-2 thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s 0.7538 68 216
3d3l-assembly1.cif.gz_A the 2.6 a crystal structure of the lipoxygenase domain of human arachidonate 12-lipoxygenase, 12s-type 0.7438 189 215
4xih-assembly1.cif.gz_B-2 crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis 0.7339 61 218
ID Description Score Start End Superfamily
5d8dD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.8168 193 216 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7872 193 216 3.30.470.20
af_P21264_187_380_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7702 189 215 3.30.470.20
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7682 69 156 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7639 61 222 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V6KS03-F1-model_v4 DUF899 domain-containing protein 0.986 40 254
AF-A0A2V6G796-F1-model_v4 DUF899 domain-containing protein 0.9859 23 254
AF-A0A538SV51-F1-model_v4 DUF899 domain-containing protein 0.9845 63 254
AF-A0A2S6R5Q2-F1-model_v4 Thioredoxin domain-containing protein 0.9824 23 203
AF-A0A2R8B491-F1-model_v4 Thioredoxin domain-containing protein 0.9822 25 255

Feature Viewer

pLDDT pTM Quality
88.37 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map