F479028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 750 | 418 | 709 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300003790|Ga0055528_1000377|Ga0055528_10003778 |
| Length | 304 |
| Sequence | VRRKPPFGLTAEDERASHRRVKPRMDEPRIRLIEPKEKCMNTAVAATPAAHHAVVSKDRWLAQRKALLAREKELTHLRDQIARERRALPWTRVEKDYVFDTPEGARALADLFEGRRQLLVQHFMLGPDWEQGCPSCSYMSDHLDGMKVHLENRDLSLLVVSRAPLDQIERFRRRMGWQFKWVSSHGSDFNYXXXVSFEPRQWAEGKGEVYYNYSVRPFPAQEAPGISVFYRDDAGEVFHTYSTYERGVEAMMGTYNLLDLTPKGRDEPNPVHAMDWVRHHDRYEPAAPAAKPAGGSGSCCHGPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 4 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 5 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 6 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 7 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 8 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 9 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 10 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 11 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 12 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 15 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 16 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 17 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 18 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 19 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 20 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 21 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 22 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 23 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 24 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 25 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 26 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 27 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 28 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 29 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 30 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 31 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 32 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 33 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 34 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 35 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 36 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 37 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 38 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 39 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 40 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 41 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 42 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 43 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 44 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 47 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 50 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 56 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 60 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 62 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 64 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 65 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 76 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 110 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 111 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 119 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 121 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 122 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 123 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 124 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 125 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 127 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 128 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 129 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 133 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 134 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 139 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 140 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 167 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 244 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 245 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 246 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 247 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 248 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 249 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 250 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 251 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 252 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 253 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 254 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 255 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 256 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 257 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 258 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 264 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 265 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 266 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 267 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 273 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 274 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 275 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 276 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 277 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 278 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 279 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 280 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 281 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 282 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 284 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 287 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 288 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 289 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 290 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 291 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 292 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 293 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 294 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 295 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 296 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 297 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 298 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 299 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 300 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 301 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 302 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 303 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 304 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 305 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 306 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 348 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 349 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 350 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 351 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 352 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 353 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 354 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 355 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 378 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 379 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 383 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 398 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 403 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 404 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 405 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 406 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 407 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 411 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 412 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.4 |
| Metatranscriptomes | 0.13 |
| Isolates | 5.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.8 |
| Nodule | 0.4 |
| Rhizoplane | 3.33 |
| Rhizosphere | 67.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2058914 | 2162886007 | Bacteria | 4642 |
| 2 | JGI25156J39149_1000016 | 3300002705 | Bacteria | 178691 |
| 3 | JGI25156J39149_1000061 | 3300002705 | Bacteria | 84583 |
| 4 | JGI25157J39369_1000035 | 3300002741 | Bacteria | 136011 |
| 5 | JGI25157J39369_1000180 | 3300002741 | Bacteria | 53594 |
| 6 | JGI25151J46595_10001011 | 3300003187 | Bacteria | 21245 |
| 7 | rootH1_10001573 | 3300003316 | Bacteria | 2984 |
| 8 | rootL2_10049763 | 3300003322 | Bacteria | 2860 |
| 9 | rootL2_10055265 | 3300003322 | Bacteria | 4735 |
| 10 | rootH1_10154922 | 3300003323 | Bacteria | 1405 |
| 11 | Ga0006562J51391_1111735 | 3300003578 | Bacteria | 2630 |
| 12 | Ga0055539_1000124 | 3300003752 | Bacteria | 82223 |
| 13 | Ga0055539_1008631 | 3300003752 | Bacteria | 1273 |
| 14 | Ga0055533_1000024 | 3300003756 | Bacteria | 338067 |
| 15 | Ga0055525_1001151 | 3300003759 | Bacteria | 6253 |
| 16 | Ga0055535_1000183 | 3300003761 | Bacteria | 66520 |
| 17 | Ga0055535_1000393 | 3300003761 | Bacteria | 41335 |
| 18 | Ga0055535_1006549 | 3300003761 | Bacteria | 2339 |
| 19 | Ga0055529_1000064 | 3300003763 | Bacteria | 178831 |
| 20 | Ga0055529_1002064 | 3300003763 | Bacteria | 4342 |
| 21 | Ga0055526_1032910 | 3300003771 | Bacteria | 1451 |
| 22 | Ga0055537_1000010 | 3300003773 | Bacteria | 138059 |
| 23 | Ga0055524_1002702 | 3300003775 | Bacteria | 8965 |
| 24 | Ga0055524_1002878 | 3300003775 | Bacteria | 8615 |
| 25 | Ga0055536_1002555 | 3300003781 | Bacteria | 10174 |
| 26 | Ga0055536_1007581 | 3300003781 | Bacteria | 4824 |
| 27 | Ga0055536_1011792 | 3300003781 | Bacteria | 3304 |
| 28 | Ga0055534_1000015 | 3300003784 | Bacteria | 148531 |
| 29 | Ga0055534_1003939 | 3300003784 | Bacteria | 4477 |
| 30 | Ga0055534_1024889 | 3300003784 | Bacteria | 966 |
| 31 | Ga0055528_1000377 | 3300003790 | Bacteria | 36291 |
| 32 | Ga0055528_1027352 | 3300003790 | Bacteria | 1608 |
| 33 | Ga0055530_10005109 | 3300003791 | Bacteria | 6420 |
| 34 | Ga0055540_1000015 | 3300003792 | Bacteria | 232986 |
| 35 | Ga0055540_1000625 | 3300003792 | Bacteria | 25161 |
| 36 | Ga0055540_1001156 | 3300003792 | Bacteria | 16424 |
| 37 | Ga0055531_10009441 | 3300003794 | Bacteria | 4983 |
| 38 | Ga0055531_10031543 | 3300003794 | Bacteria | 1752 |
| 39 | Ga0065165_1003590 | 3300005262 | Bacteria | 10695 |
| 40 | Ga0065714_10012400 | 3300005288 | Bacteria | 2045 |
| 41 | Ga0065714_10098198 | 3300005288 | Bacteria | 1717 |
| 42 | Ga0065714_10135375 | 3300005288 | Bacteria | 1214 |
| 43 | Ga0065704_10071167 | 3300005289 | Bacteria | 12711 |
| 44 | Ga0065704_10190037 | 3300005289 | Bacteria | 1194 |
| 45 | Ga0070658_10006378 | 3300005327 | Bacteria | 9559 |
| 46 | Ga0070658_10393348 | 3300005327 | Bacteria | 1190 |
| 47 | Ga0070676_10042449 | 3300005328 | Bacteria | 2641 |
| 48 | Ga0070676_10059644 | 3300005328 | Bacteria | 2264 |
| 49 | Ga0070683_100007807 | 3300005329 | Bacteria | 9060 |
| 50 | Ga0070690_100069279 | 3300005330 | Bacteria | 2289 |
| 51 | Ga0070690_100279968 | 3300005330 | Bacteria | 1189 |
| 52 | Ga0070670_100015017 | 3300005331 | Bacteria | 6645 |
| 53 | Ga0070670_100052538 | 3300005331 | Bacteria | 3499 |
| 54 | Ga0070677_10001118 | 3300005333 | Bacteria | 8610 |
| 55 | Ga0070677_10097407 | 3300005333 | Bacteria | 1290 |
| 56 | Ga0070677_10159219 | 3300005333 | Bacteria | 1058 |
| 57 | Ga0070666_10246187 | 3300005335 | Bacteria | 1265 |
| 58 | Ga0070682_100461931 | 3300005337 | Bacteria | 975 |
| 59 | Ga0068868_100184829 | 3300005338 | Bacteria | 1731 |
| 60 | Ga0068868_100342648 | 3300005338 | Unclassified | 1278 |
| 61 | Ga0070660_100115501 | 3300005339 | Bacteria | 2139 |
| 62 | Ga0070660_100374063 | 3300005339 | Bacteria | 1176 |
| 63 | Ga0070661_100001406 | 3300005344 | Bacteria | 16794 |
| 64 | Ga0070661_100039349 | 3300005344 | Bacteria | 3445 |
| 65 | Ga0070661_100292933 | 3300005344 | Bacteria | 1265 |
| 66 | Ga0070668_100211738 | 3300005347 | Bacteria | 1595 |
| 67 | Ga0070669_100001153 | 3300005353 | Bacteria | 19303 |
| 68 | Ga0070669_100219498 | 3300005353 | Bacteria | 1503 |
| 69 | Ga0070669_100238623 | 3300005353 | Bacteria | 1443 |
| 70 | Ga0070669_100306889 | 3300005353 | Bacteria | 1278 |
| 71 | Ga0070675_100000219 | 3300005354 | Bacteria | 36584 |
| 72 | Ga0070675_100073009 | 3300005354 | Bacteria | 2848 |
| 73 | Ga0070675_100266688 | 3300005354 | Bacteria | 1502 |
| 74 | Ga0070675_100321492 | 3300005354 | Bacteria | 1367 |
| 75 | Ga0070671_100014483 | 3300005355 | Bacteria | 6373 |
| 76 | Ga0070671_100073955 | 3300005355 | Bacteria | 2846 |
| 77 | Ga0070674_100008397 | 3300005356 | Bacteria | 6150 |
| 78 | Ga0070674_100030134 | 3300005356 | Bacteria | 3582 |
| 79 | Ga0070674_100171135 | 3300005356 | Bacteria | 1656 |
| 80 | Ga0070673_100016775 | 3300005364 | Bacteria | 5190 |
| 81 | Ga0070673_100236884 | 3300005364 | Bacteria | 1585 |
| 82 | Ga0070673_100524112 | 3300005364 | Bacteria | 1074 |
| 83 | Ga0070667_100130790 | 3300005367 | Bacteria | 2190 |
| 84 | Ga0070667_100423243 | 3300005367 | Bacteria | 1214 |
| 85 | Ga0070714_100675924 | 3300005435 | Bacteria | 995 |
| 86 | Ga0070713_100173092 | 3300005436 | Unclassified | 1935 |
| 87 | Ga0070713_100230015 | 3300005436 | Bacteria | 1685 |
| 88 | Ga0070713_100437197 | 3300005436 | Bacteria | 1227 |
| 89 | Ga0070711_100490847 | 3300005439 | Bacteria | 1011 |
| 90 | Ga0070663_100307632 | 3300005455 | Bacteria | 1271 |
| 91 | Ga0070678_100082305 | 3300005456 | Bacteria | 2443 |
| 92 | Ga0070678_100104732 | 3300005456 | Bacteria | 2201 |
| 93 | Ga0070678_100321072 | 3300005456 | Bacteria | 1322 |
| 94 | Ga0070662_100007583 | 3300005457 | Bacteria | 7041 |
| 95 | Ga0070662_100303250 | 3300005457 | Bacteria | 1298 |
| 96 | Ga0068867_100000257 | 3300005459 | Bacteria | 34998 |
| 97 | Ga0068867_100000287 | 3300005459 | Bacteria | 33183 |
| 98 | Ga0068867_100549100 | 3300005459 | Bacteria | 1000 |
| 99 | Ga0068867_100587446 | 3300005459 | Bacteria | 969 |
| 100 | Ga0070706_100046962 | 3300005467 | Bacteria | 3984 |
| 101 | Ga0070706_100147422 | 3300005467 | Bacteria | 2197 |
| 102 | Ga0070707_100311578 | 3300005468 | Bacteria | 1530 |
| 103 | Ga0070698_100131748 | 3300005471 | Bacteria | 2455 |
| 104 | Ga0070699_100123539 | 3300005518 | Bacteria | 2278 |
| 105 | Ga0070697_100118575 | 3300005536 | Bacteria | 2212 |
| 106 | Ga0068853_100059813 | 3300005539 | Bacteria | 3292 |
| 107 | Ga0070672_100024889 | 3300005543 | Bacteria | 4432 |
| 108 | Ga0070672_100116189 | 3300005543 | Bacteria | 2186 |
| 109 | Ga0070672_100128982 | 3300005543 | Bacteria | 2077 |
| 110 | Ga0070672_100164859 | 3300005543 | Bacteria | 1840 |
| 111 | Ga0070686_100468523 | 3300005544 | Bacteria | 972 |
| 112 | Ga0070665_100005593 | 3300005548 | Bacteria | 12922 |
| 113 | Ga0070665_100027314 | 3300005548 | Bacteria | 5749 |
| 114 | Ga0070665_100749225 | 3300005548 | Bacteria | 990 |
| 115 | Ga0068855_100032438 | 3300005563 | Bacteria | 6237 |
| 116 | Ga0068855_100040092 | 3300005563 | Bacteria | 5559 |
| 117 | Ga0068855_100055019 | 3300005563 | Bacteria | 4675 |
| 118 | Ga0068855_100202244 | 3300005563 | Bacteria | 2236 |
| 119 | Ga0068855_100655682 | 3300005563 | Bacteria | 1127 |
| 120 | Ga0070664_100005979 | 3300005564 | Bacteria | 9837 |
| 121 | Ga0070664_100006836 | 3300005564 | Bacteria | 9200 |
| 122 | Ga0068857_100155059 | 3300005577 | Bacteria | 2076 |
| 123 | Ga0068857_100413942 | 3300005577 | Bacteria | 1256 |
| 124 | Ga0068854_100018452 | 3300005578 | Bacteria | 4683 |
| 125 | Ga0068856_100005465 | 3300005614 | Bacteria | 12519 |
| 126 | Ga0068856_100135356 | 3300005614 | Bacteria | 2469 |
| 127 | Ga0068852_100036176 | 3300005616 | Bacteria | 4128 |
| 128 | Ga0068852_100077532 | 3300005616 | Bacteria | 2938 |
| 129 | Ga0068859_100288940 | 3300005617 | Bacteria | 1732 |
| 130 | Ga0068859_100637578 | 3300005617 | Bacteria | 1158 |
| 131 | Ga0068864_100031303 | 3300005618 | Bacteria | 4514 |
| 132 | Ga0068864_100083709 | 3300005618 | Bacteria | 2802 |
| 133 | Ga0068864_100471248 | 3300005618 | Bacteria | 1204 |
| 134 | Ga0068866_10001764 | 3300005718 | Bacteria | 9099 |
| 135 | Ga0068861_100022190 | 3300005719 | Bacteria | 4570 |
| 136 | Ga0068861_100821686 | 3300005719 | Bacteria | 874 |
| 137 | Ga0068851_10215542 | 3300005834 | Bacteria | 1077 |
| 138 | Ga0068851_10256556 | 3300005834 | Bacteria | 993 |
| 139 | Ga0068870_10041850 | 3300005840 | Bacteria | 2383 |
| 140 | Ga0068870_10119732 | 3300005840 | Bacteria | 1515 |
| 141 | Ga0068870_10303013 | 3300005840 | Bacteria | 1009 |
| 142 | Ga0068863_100093710 | 3300005841 | Bacteria | 2850 |
| 143 | Ga0068863_100120711 | 3300005841 | Bacteria | 2499 |
| 144 | Ga0068858_100033996 | 3300005842 | Bacteria | 4729 |
| 145 | Ga0068860_100000444 | 3300005843 | Bacteria | 52273 |
| 146 | Ga0068860_100181705 | 3300005843 | Bacteria | 2033 |
| 147 | Ga0068862_100005619 | 3300005844 | Bacteria | 10481 |
| 148 | Ga0068862_100007521 | 3300005844 | Bacteria | 9026 |
| 149 | Ga0068862_100087278 | 3300005844 | Bacteria | 2714 |
| 150 | Ga0081455_10000211 | 3300005937 | Bacteria | 74488 |
| 151 | Ga0081455_10023053 | 3300005937 | Bacteria | 5802 |
| 152 | Ga0081455_10033603 | 3300005937 | Bacteria | 4607 |
| 153 | Ga0081455_10221551 | 3300005937 | Bacteria | 1401 |
| 154 | Ga0081539_10012312 | 3300005985 | Bacteria | 6614 |
| 155 | Ga0081539_10029495 | 3300005985 | Bacteria | 3425 |
| 156 | Ga0070717_10072109 | 3300006028 | Bacteria | 2883 |
| 157 | Ga0070717_10441651 | 3300006028 | Unclassified | 1172 |
| 158 | Ga0075365_10048421 | 3300006038 | Bacteria | 2798 |
| 159 | Ga0075365_10059553 | 3300006038 | Bacteria | 2545 |
| 160 | Ga0075365_10131459 | 3300006038 | Bacteria | 1732 |
| 161 | Ga0075368_10067240 | 3300006042 | Bacteria | 1442 |
| 162 | Ga0075363_100072347 | 3300006048 | Bacteria | 1874 |
| 163 | Ga0075364_10034721 | 3300006051 | Bacteria | 3256 |
| 164 | Ga0075364_10057960 | 3300006051 | Bacteria | 2538 |
| 165 | Ga0075364_10099648 | 3300006051 | Bacteria | 1934 |
| 166 | Ga0075432_10017697 | 3300006058 | Bacteria | 2429 |
| 167 | Ga0070712_100569735 | 3300006175 | Bacteria | 956 |
| 168 | Ga0075362_10075928 | 3300006177 | Bacteria | 1542 |
| 169 | Ga0075367_10071757 | 3300006178 | Bacteria | 2084 |
| 170 | Ga0075369_10014386 | 3300006186 | Bacteria | 3160 |
| 171 | Ga0075369_10142855 | 3300006186 | Bacteria | 1092 |
| 172 | Ga0075366_10014177 | 3300006195 | Bacteria | 4550 |
| 173 | Ga0075366_10022500 | 3300006195 | Bacteria | 3667 |
| 174 | Ga0097621_100010684 | 3300006237 | Bacteria | 6727 |
| 175 | Ga0097621_100022185 | 3300006237 | Bacteria | 4925 |
| 176 | Ga0097621_100284698 | 3300006237 | Bacteria | 1456 |
| 177 | Ga0097621_100439109 | 3300006237 | Bacteria | 1174 |
| 178 | Ga0097621_100504782 | 3300006237 | Bacteria | 1096 |
| 179 | Ga0075370_10029763 | 3300006353 | Bacteria | 3043 |
| 180 | Ga0075370_10049998 | 3300006353 | Bacteria | 2371 |
| 181 | Ga0068871_100017429 | 3300006358 | Bacteria | 5436 |
| 182 | Ga0068871_100026498 | 3300006358 | Bacteria | 4524 |
| 183 | Ga0075428_100084707 | 3300006844 | Bacteria | 3458 |
| 184 | Ga0075431_100005078 | 3300006847 | Bacteria | 12949 |
| 185 | Ga0075429_100002970 | 3300006880 | Bacteria | 14385 |
| 186 | Ga0075429_100006854 | 3300006880 | Bacteria | 9886 |
| 187 | Ga0075429_100396202 | 3300006880 | Bacteria | 1209 |
| 188 | Ga0068865_100072113 | 3300006881 | Bacteria | 2452 |
| 189 | Ga0068865_100177807 | 3300006881 | Bacteria | 1637 |
| 190 | Ga0068865_100537199 | 3300006881 | Bacteria | 980 |
| 191 | Ga0097620_100104708 | 3300006931 | Bacteria | 2889 |
| 192 | Ga0097620_100288967 | 3300006931 | Bacteria | 1732 |
| 193 | Ga0097620_100637647 | 3300006931 | Bacteria | 1158 |
| 194 | Ga0099826_10062906 | 3300006948 | Bacteria | 2402 |
| 195 | Ga0075435_100110885 | 3300007076 | Bacteria | 2282 |
| 196 | Ga0105240_10003444 | 3300009093 | Bacteria | 24555 |
| 197 | Ga0105240_10039722 | 3300009093 | Bacteria | 6024 |
| 198 | Ga0105240_10048411 | 3300009093 | Bacteria | 5373 |
| 199 | Ga0105240_10331375 | 3300009093 | Bacteria | 1732 |
| 200 | Ga0111539_10015684 | 3300009094 | Bacteria | 9418 |
| 201 | Ga0105245_10504539 | 3300009098 | Bacteria | 1226 |
| 202 | Ga0114129_10007699 | 3300009147 | Bacteria | 15329 |
| 203 | Ga0114129_10171771 | 3300009147 | Bacteria | 2955 |
| 204 | Ga0105243_10001557 | 3300009148 | Bacteria | 20059 |
| 205 | Ga0105243_10001974 | 3300009148 | Bacteria | 17474 |
| 206 | Ga0105243_10036123 | 3300009148 | Bacteria | 3833 |
| 207 | Ga0105241_10092724 | 3300009174 | Bacteria | 2385 |
| 208 | Ga0105242_10004095 | 3300009176 | Bacteria | 11335 |
| 209 | Ga0105242_10006406 | 3300009176 | Bacteria | 9065 |
| 210 | Ga0105242_10631983 | 3300009176 | Bacteria | 1039 |
| 211 | Ga0105248_10001750 | 3300009177 | Bacteria | 24170 |
| 212 | Ga0105248_10209272 | 3300009177 | Bacteria | 2197 |
| 213 | Ga0105238_10009551 | 3300009551 | Bacteria | 9705 |
| 214 | Ga0105238_10059850 | 3300009551 | Bacteria | 3815 |
| 215 | Ga0105249_10554275 | 3300009553 | Bacteria | 1200 |
| 216 | Ga0105249_10652291 | 3300009553 | Bacteria | 1110 |
| 217 | Ga0105239_10047798 | 3300010375 | Bacteria | 4690 |
| 218 | Ga0105239_10113071 | 3300010375 | Bacteria | 3011 |
| 219 | Ga0105246_10048831 | 3300011119 | Bacteria | 2895 |
| 220 | Ga0105246_10278320 | 3300011119 | Bacteria | 1341 |
| 221 | Ga0157373_10036351 | 3300013100 | Bacteria | 3535 |
| 222 | Ga0157373_10268384 | 3300013100 | Bacteria | 1208 |
| 223 | Ga0157370_10001585 | 3300013104 | Bacteria | 28149 |
| 224 | Ga0157370_10121753 | 3300013104 | Bacteria | 2436 |
| 225 | Ga0157370_10469454 | 3300013104 | Bacteria | 1156 |
| 226 | Ga0157369_10070182 | 3300013105 | Bacteria | 3764 |
| 227 | Ga0157378_10047413 | 3300013297 | Bacteria | 3821 |
| 228 | Ga0163162_10005859 | 3300013306 | Bacteria | 11891 |
| 229 | Ga0163162_10075011 | 3300013306 | Bacteria | 3442 |
| 230 | Ga0163162_10181586 | 3300013306 | Bacteria | 2230 |
| 231 | Ga0163162_10244309 | 3300013306 | Bacteria | 1926 |
| 232 | Ga0157372_10008371 | 3300013307 | Bacteria | 10996 |
| 233 | Ga0157372_10099893 | 3300013307 | Bacteria | 3311 |
| 234 | Ga0157372_10477128 | 3300013307 | Bacteria | 1454 |
| 235 | Ga0157375_10042937 | 3300013308 | Bacteria | 4381 |
| 236 | Ga0157375_10144787 | 3300013308 | Bacteria | 2506 |
| 237 | Ga0157375_10303401 | 3300013308 | Bacteria | 1760 |
| 238 | Ga0157375_10724851 | 3300013308 | Bacteria | 1147 |
| 239 | Ga0157380_10195170 | 3300014326 | Bacteria | 1791 |
| 240 | Ga0157380_10294006 | 3300014326 | Bacteria | 1493 |
| 241 | Ga0182008_10000711 | 3300014497 | Bacteria | 23842 |
| 242 | Ga0182008_10021087 | 3300014497 | Bacteria | 3350 |
| 243 | Ga0182008_10100425 | 3300014497 | Bacteria | 1430 |
| 244 | Ga0157379_10243909 | 3300014968 | Bacteria | 1630 |
| 245 | Ga0157376_10000023 | 3300014969 | Bacteria | 223978 |
| 246 | Ga0182006_1000964 | 3300015261 | Bacteria | 19073 |
| 247 | Ga0182006_1092354 | 3300015261 | Bacteria | 1087 |
| 248 | Ga0182007_10003164 | 3300015262 | Bacteria | 7886 |
| 249 | Ga0182007_10045136 | 3300015262 | Bacteria | 1461 |
| 250 | Ga0163161_10000127 | 3300017792 | Bacteria | 71051 |
| 251 | Ga0163161_10065478 | 3300017792 | Bacteria | 2652 |
| 252 | Ga0213872_10030461 | 3300021361 | Bacteria | 2473 |
| 253 | Ga0209674_100007 | 3300025226 | Bacteria | 1077082 |
| 254 | Ga0209672_103582 | 3300025228 | Bacteria | 3150 |
| 255 | Ga0209563_100060 | 3300025230 | Bacteria | 284876 |
| 256 | Ga0209258_100124 | 3300025242 | Bacteria | 178883 |
| 257 | Ga0209258_100415 | 3300025242 | Bacteria | 51014 |
| 258 | Ga0207425_1008473 | 3300025245 | Bacteria | 2627 |
| 259 | Ga0207425_1034144 | 3300025245 | Bacteria | 999 |
| 260 | Ga0209646_1000056 | 3300025246 | Bacteria | 269860 |
| 261 | Ga0209026_1000009 | 3300025250 | Bacteria | 531812 |
| 262 | Ga0209677_100108 | 3300025253 | Bacteria | 89018 |
| 263 | Ga0209677_100198 | 3300025253 | Bacteria | 48090 |
| 264 | Ga0209759_1000035 | 3300025256 | Bacteria | 264254 |
| 265 | Ga0209759_1001942 | 3300025256 | Bacteria | 10052 |
| 266 | Ga0209129_1003835 | 3300025258 | Bacteria | 6275 |
| 267 | Ga0209565_1000025 | 3300025263 | Bacteria | 377969 |
| 268 | Ga0209565_1010809 | 3300025263 | Bacteria | 2251 |
| 269 | Ga0209565_1013694 | 3300025263 | Bacteria | 1891 |
| 270 | Ga0209455_1000114 | 3300025272 | Bacteria | 178883 |
| 271 | Ga0209455_1000337 | 3300025272 | Bacteria | 44758 |
| 272 | Ga0209673_1000077 | 3300025273 | Bacteria | 229470 |
| 273 | Ga0209673_1001615 | 3300025273 | Bacteria | 19674 |
| 274 | Ga0209673_1006170 | 3300025273 | Bacteria | 5864 |
| 275 | Ga0209130_1016584 | 3300025284 | Bacteria | 1778 |
| 276 | Ga0209675_1000017 | 3300025291 | Bacteria | 378002 |
| 277 | Ga0209675_1001897 | 3300025291 | Bacteria | 11275 |
| 278 | Ga0209675_1027953 | 3300025291 | Bacteria | 1378 |
| 279 | Ga0209676_1000034 | 3300025292 | Bacteria | 460125 |
| 280 | Ga0209676_1000785 | 3300025292 | Bacteria | 42175 |
| 281 | Ga0209676_1003468 | 3300025292 | Bacteria | 9682 |
| 282 | Ga0209676_1020288 | 3300025292 | Bacteria | 2262 |
| 283 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 284 | Ga0209025_1001450 | 3300025294 | Bacteria | 31111 |
| 285 | Ga0209025_1002222 | 3300025294 | Bacteria | 21391 |
| 286 | Ga0209025_1035923 | 3300025294 | Bacteria | 2229 |
| 287 | Ga0209564_1004349 | 3300025295 | Bacteria | 8723 |
| 288 | Ga0209564_1039105 | 3300025295 | Bacteria | 1309 |
| 289 | Ga0209758_1024888 | 3300025297 | Bacteria | 2649 |
| 290 | Ga0209050_1000170 | 3300025298 | Bacteria | 151162 |
| 291 | Ga0209050_1000528 | 3300025298 | Bacteria | 63464 |
| 292 | Ga0209050_1000529 | 3300025298 | Bacteria | 63410 |
| 293 | Ga0209256_1000120 | 3300025299 | Bacteria | 167691 |
| 294 | Ga0209256_1000980 | 3300025299 | Bacteria | 34284 |
| 295 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 296 | Ga0209051_1000271 | 3300025303 | Bacteria | 86541 |
| 297 | Ga0209051_1000398 | 3300025303 | Bacteria | 60408 |
| 298 | Ga0209051_1016226 | 3300025303 | Bacteria | 3384 |
| 299 | Ga0209051_1020044 | 3300025303 | Bacteria | 2897 |
| 300 | Ga0209257_1000189 | 3300025304 | Bacteria | 153917 |
| 301 | Ga0209257_1000727 | 3300025304 | Bacteria | 50163 |
| 302 | Ga0209257_1004132 | 3300025304 | Bacteria | 11573 |
| 303 | Ga0209257_1007879 | 3300025304 | Bacteria | 6270 |
| 304 | Ga0209257_1009161 | 3300025304 | Bacteria | 5388 |
| 305 | Ga0207697_10155989 | 3300025315 | Bacteria | 994 |
| 306 | Ga0207655_1003754 | 3300025728 | Bacteria | 11132 |
| 307 | Ga0207655_1047804 | 3300025728 | Bacteria | 1762 |
| 308 | Ga0207682_10000318 | 3300025893 | Bacteria | 21940 |
| 309 | Ga0207642_10003806 | 3300025899 | Bacteria | 4809 |
| 310 | Ga0207680_10115550 | 3300025903 | Bacteria | 1748 |
| 311 | Ga0207645_10053165 | 3300025907 | Bacteria | 2588 |
| 312 | Ga0207643_10223059 | 3300025908 | Bacteria | 1154 |
| 313 | Ga0207643_10290194 | 3300025908 | Bacteria | 1016 |
| 314 | Ga0207705_10232650 | 3300025909 | Bacteria | 1402 |
| 315 | Ga0207684_10091817 | 3300025910 | Bacteria | 2588 |
| 316 | Ga0207684_10099326 | 3300025910 | Bacteria | 2486 |
| 317 | Ga0207684_10221853 | 3300025910 | Bacteria | 1631 |
| 318 | Ga0207695_10001146 | 3300025913 | Bacteria | 45967 |
| 319 | Ga0207695_10125579 | 3300025913 | Bacteria | 2528 |
| 320 | Ga0207662_10036678 | 3300025918 | Bacteria | 2867 |
| 321 | Ga0207657_10174036 | 3300025919 | Bacteria | 1743 |
| 322 | Ga0207649_10023829 | 3300025920 | Bacteria | 3549 |
| 323 | Ga0207646_10151450 | 3300025922 | Bacteria | 2092 |
| 324 | Ga0207646_10624795 | 3300025922 | Bacteria | 966 |
| 325 | Ga0207681_10001999 | 3300025923 | Bacteria | 13101 |
| 326 | Ga0207681_10334874 | 3300025923 | Bacteria | 1207 |
| 327 | Ga0207694_10014155 | 3300025924 | Bacteria | 6014 |
| 328 | Ga0207694_10070372 | 3300025924 | Bacteria | 2733 |
| 329 | Ga0207694_10181914 | 3300025924 | Bacteria | 1705 |
| 330 | Ga0207650_10000435 | 3300025925 | Bacteria | 36300 |
| 331 | Ga0207650_10027784 | 3300025925 | Bacteria | 4052 |
| 332 | Ga0207650_10490009 | 3300025925 | Bacteria | 1026 |
| 333 | Ga0207659_10000301 | 3300025926 | Bacteria | 29933 |
| 334 | Ga0207659_10327028 | 3300025926 | Bacteria | 1266 |
| 335 | Ga0207700_10097431 | 3300025928 | Bacteria | 2337 |
| 336 | Ga0207700_10135300 | 3300025928 | Bacteria | 2018 |
| 337 | Ga0207664_10461960 | 3300025929 | Bacteria | 1134 |
| 338 | Ga0207664_10691548 | 3300025929 | Bacteria | 917 |
| 339 | Ga0207644_10031872 | 3300025931 | Bacteria | 3676 |
| 340 | Ga0207644_10037348 | 3300025931 | Bacteria | 3416 |
| 341 | Ga0207690_10095180 | 3300025932 | Bacteria | 2115 |
| 342 | Ga0207709_10000295 | 3300025935 | Bacteria | 55888 |
| 343 | Ga0207709_10006321 | 3300025935 | Bacteria | 6649 |
| 344 | Ga0207709_10031111 | 3300025935 | Bacteria | 3113 |
| 345 | Ga0207709_10054605 | 3300025935 | Bacteria | 2464 |
| 346 | Ga0207669_10000291 | 3300025937 | Bacteria | 22986 |
| 347 | Ga0207669_10030757 | 3300025937 | Bacteria | 2988 |
| 348 | Ga0207669_10072473 | 3300025937 | Bacteria | 2169 |
| 349 | Ga0207704_10004798 | 3300025938 | Bacteria | 6207 |
| 350 | Ga0207704_10428917 | 3300025938 | Bacteria | 1050 |
| 351 | Ga0207691_10000148 | 3300025940 | Bacteria | 64859 |
| 352 | Ga0207691_10010991 | 3300025940 | Bacteria | 8686 |
| 353 | Ga0207691_10020929 | 3300025940 | Bacteria | 6182 |
| 354 | Ga0207691_10077217 | 3300025940 | Bacteria | 3001 |
| 355 | Ga0207691_10113200 | 3300025940 | Bacteria | 2411 |
| 356 | Ga0207711_10218808 | 3300025941 | Bacteria | 1741 |
| 357 | Ga0207689_10220933 | 3300025942 | Bacteria | 1565 |
| 358 | Ga0207661_10007104 | 3300025944 | Bacteria | 7956 |
| 359 | Ga0207661_10349605 | 3300025944 | Bacteria | 1334 |
| 360 | Ga0207679_10000088 | 3300025945 | Bacteria | 79836 |
| 361 | Ga0207679_10000265 | 3300025945 | Bacteria | 39990 |
| 362 | Ga0207667_10024754 | 3300025949 | Bacteria | 6583 |
| 363 | Ga0207667_10059920 | 3300025949 | Bacteria | 3985 |
| 364 | Ga0207667_10119750 | 3300025949 | Bacteria | 2713 |
| 365 | Ga0207667_10523706 | 3300025949 | Bacteria | 1201 |
| 366 | Ga0207651_10007310 | 3300025960 | Bacteria | 5872 |
| 367 | Ga0207651_10093246 | 3300025960 | Bacteria | 2210 |
| 368 | Ga0207712_10342035 | 3300025961 | Bacteria | 1241 |
| 369 | Ga0207668_10138875 | 3300025972 | Bacteria | 1866 |
| 370 | Ga0207658_10104335 | 3300025986 | Bacteria | 2227 |
| 371 | Ga0207658_10211584 | 3300025986 | Bacteria | 1625 |
| 372 | Ga0207658_10447202 | 3300025986 | Bacteria | 1143 |
| 373 | Ga0207677_10396024 | 3300026023 | Unclassified | 1170 |
| 374 | Ga0207703_10010771 | 3300026035 | Bacteria | 7134 |
| 375 | Ga0207703_10052243 | 3300026035 | Bacteria | 3317 |
| 376 | Ga0207639_10016455 | 3300026041 | Bacteria | 5233 |
| 377 | Ga0207639_10353577 | 3300026041 | Bacteria | 1313 |
| 378 | Ga0207708_10000659 | 3300026075 | Bacteria | 26455 |
| 379 | Ga0207708_10071198 | 3300026075 | Bacteria | 2663 |
| 380 | Ga0207702_10007291 | 3300026078 | Bacteria | 9454 |
| 381 | Ga0207702_10016789 | 3300026078 | Bacteria | 6059 |
| 382 | Ga0207641_10078072 | 3300026088 | Bacteria | 2867 |
| 383 | Ga0207641_10108254 | 3300026088 | Bacteria | 2460 |
| 384 | Ga0207641_10644410 | 3300026088 | Bacteria | 1040 |
| 385 | Ga0207648_10000283 | 3300026089 | Bacteria | 55253 |
| 386 | Ga0207648_10000741 | 3300026089 | Bacteria | 36624 |
| 387 | Ga0207648_10001569 | 3300026089 | Bacteria | 25081 |
| 388 | Ga0207648_10144894 | 3300026089 | Bacteria | 2095 |
| 389 | Ga0207648_10169073 | 3300026089 | Bacteria | 1932 |
| 390 | Ga0207648_10185179 | 3300026089 | Bacteria | 1844 |
| 391 | Ga0207648_10237217 | 3300026089 | Bacteria | 1623 |
| 392 | Ga0207676_10005361 | 3300026095 | Bacteria | 9081 |
| 393 | Ga0207676_10703245 | 3300026095 | Bacteria | 979 |
| 394 | Ga0207674_10004183 | 3300026116 | Bacteria | 17430 |
| 395 | Ga0207674_10067265 | 3300026116 | Bacteria | 3607 |
| 396 | Ga0207674_10356524 | 3300026116 | Bacteria | 1414 |
| 397 | Ga0207675_100000946 | 3300026118 | Bacteria | 29002 |
| 398 | Ga0207675_100119096 | 3300026118 | Bacteria | 2497 |
| 399 | Ga0207675_100848070 | 3300026118 | Bacteria | 928 |
| 400 | Ga0207675_101037710 | 3300026118 | Bacteria | 839 |
| 401 | Ga0207683_10027159 | 3300026121 | Bacteria | 4946 |
| 402 | Ga0207683_10076230 | 3300026121 | Bacteria | 2969 |
| 403 | Ga0207698_10004401 | 3300026142 | Bacteria | 8580 |
| 404 | Ga0209282_1000229 | 3300027666 | Bacteria | 29075 |
| 405 | Ga0209813_10070936 | 3300027866 | Bacteria | 1132 |
| 406 | Ga0207428_10010548 | 3300027907 | Bacteria | 8247 |
| 407 | Ga0268266_10000276 | 3300028379 | Bacteria | 84981 |
| 408 | Ga0268265_10017636 | 3300028380 | Bacteria | 4933 |
| 409 | Ga0268265_10051884 | 3300028380 | Bacteria | 3098 |
| 410 | Ga0268265_10583115 | 3300028380 | Bacteria | 1066 |
| 411 | Ga0268264_10008357 | 3300028381 | Bacteria | 8604 |
| 412 | Ga0268264_10641211 | 3300028381 | Bacteria | 1050 |
| 413 | Ga0265336_10000022 | 3300028666 | Bacteria | 192716 |
| 414 | Ga0307517_10100690 | 3300028786 | Bacteria | 2280 |
| 415 | Ga0307515_10000212 | 3300028794 | Bacteria | 143024 |
| 416 | Ga0307515_10001343 | 3300028794 | Bacteria | 55676 |
| 417 | Ga0307515_10002672 | 3300028794 | Bacteria | 38207 |
| 418 | Ga0307515_10003631 | 3300028794 | Bacteria | 32412 |
| 419 | Ga0307515_10006216 | 3300028794 | Bacteria | 23987 |
| 420 | Ga0307515_10110109 | 3300028794 | Bacteria | 3227 |
| 421 | Ga0307511_10138468 | 3300030521 | Bacteria | 1440 |
| 422 | Ga0316177_1121344 | 3300030731 | Bacteria | 5730 |
| 423 | Ga0314311_1150282 | 3300030733 | Bacteria | 3746 |
| 424 | Ga0314311_1170870 | 3300030733 | Bacteria | 1327 |
| 425 | Ga0316179_1019061 | 3300030734 | Bacteria | 2452 |
| 426 | Ga0316183_1128149 | 3300030742 | Bacteria | 1966 |
| 427 | Ga0316181_1134026 | 3300030744 | Bacteria | 7152 |
| 428 | Ga0316182_1365804 | 3300030745 | Bacteria | 1342 |
| 429 | Ga0265327_10000841 | 3300031251 | Bacteria | 45822 |
| 430 | Ga0265327_10008749 | 3300031251 | Bacteria | 7480 |
| 431 | Ga0265327_10117302 | 3300031251 | Bacteria | 1265 |
| 432 | Ga0307509_10023870 | 3300031507 | Bacteria | 6855 |
| 433 | Ga0307509_10109053 | 3300031507 | Bacteria | 2780 |
| 434 | Ga0307408_100029462 | 3300031548 | Bacteria | 3804 |
| 435 | Ga0307408_100044597 | 3300031548 | Bacteria | 3161 |
| 436 | Ga0307408_100086803 | 3300031548 | Bacteria | 2352 |
| 437 | Ga0307408_100087023 | 3300031548 | Bacteria | 2349 |
| 438 | Ga0307408_100119983 | 3300031548 | Bacteria | 2035 |
| 439 | Ga0307408_100252878 | 3300031548 | Bacteria | 1454 |
| 440 | Ga0307508_10000549 | 3300031616 | Bacteria | 44475 |
| 441 | Ga0307508_10060284 | 3300031616 | Bacteria | 3355 |
| 442 | Ga0307508_10200014 | 3300031616 | Bacteria | 1599 |
| 443 | Ga0307514_10003783 | 3300031649 | Bacteria | 14253 |
| 444 | Ga0307514_10230827 | 3300031649 | Bacteria | 1122 |
| 445 | Ga0316575_10164074 | 3300031665 | Bacteria | 919 |
| 446 | Ga0307516_10000926 | 3300031730 | Bacteria | 40364 |
| 447 | Ga0307516_10001203 | 3300031730 | Bacteria | 36097 |
| 448 | Ga0307516_10005479 | 3300031730 | Bacteria | 15154 |
| 449 | Ga0307516_10009294 | 3300031730 | Bacteria | 10985 |
| 450 | Ga0307405_10023689 | 3300031731 | Bacteria | 3493 |
| 451 | Ga0307405_10033160 | 3300031731 | Bacteria | 3060 |
| 452 | Ga0307405_10059202 | 3300031731 | Bacteria | 2413 |
| 453 | Ga0307405_10254474 | 3300031731 | Bacteria | 1308 |
| 454 | Ga0307413_10202749 | 3300031824 | Bacteria | 1434 |
| 455 | Ga0307406_10000356 | 3300031901 | Bacteria | 26772 |
| 456 | Ga0307406_10000418 | 3300031901 | Bacteria | 24737 |
| 457 | Ga0307406_10036690 | 3300031901 | Bacteria | 3022 |
| 458 | Ga0307406_10288612 | 3300031901 | Bacteria | 1255 |
| 459 | Ga0307412_10005923 | 3300031911 | Bacteria | 6890 |
| 460 | Ga0307412_10022514 | 3300031911 | Bacteria | 3864 |
| 461 | Ga0307412_10060115 | 3300031911 | Bacteria | 2549 |
| 462 | Ga0307412_10143127 | 3300031911 | Bacteria | 1754 |
| 463 | Ga0307412_10413423 | 3300031911 | Bacteria | 1102 |
| 464 | Ga0307409_100000680 | 3300031995 | Bacteria | 15083 |
| 465 | Ga0307416_100001182 | 3300032002 | Bacteria | 14007 |
| 466 | Ga0307416_100618044 | 3300032002 | Bacteria | 1165 |
| 467 | Ga0307416_101141087 | 3300032002 | Bacteria | 884 |
| 468 | Ga0307414_10069798 | 3300032004 | Bacteria | 2527 |
| 469 | Ga0307411_10151779 | 3300032005 | Bacteria | 1722 |
| 470 | Ga0307411_10293811 | 3300032005 | Bacteria | 1300 |
| 471 | Ga0307415_100003784 | 3300032126 | Bacteria | 7753 |
| 472 | Ga0316583_10015793 | 3300032133 | Bacteria | 2719 |
| 473 | Ga0373937_0821452 | 3300036401 | Bacteria | 878 |
| 474 | Ga0373925_0070054 | 3300037068 | Bacteria | 2650 |
| 475 | Ga0395899_0047170 | 3300037312 | Bacteria | 3208 |
| 476 | Ga0395899_0250249 | 3300037312 | Bacteria | 1216 |
| 477 | Ga0395900_0066916 | 3300037418 | Bacteria | 3692 |
| 478 | Ga0395898_0024937 | 3300037466 | Bacteria | 6029 |
| 479 | Ga0395905_0001288 | 3300037471 | Bacteria | 30819 |
| 480 | Ga0395905_0086403 | 3300037471 | Bacteria | 2939 |
| 481 | Ga0395905_0114921 | 3300037471 | Bacteria | 2529 |
| 482 | Ga0395905_0269989 | 3300037471 | Bacteria | 1587 |
| 483 | Ga0395905_0405666 | 3300037471 | Bacteria | 1258 |
| 484 | Ga0395901_0010155 | 3300038443 | Bacteria | 9540 |
| 485 | Ga0395901_0013644 | 3300038443 | Bacteria | 8261 |
| 486 | Ga0395901_0070453 | 3300038443 | Bacteria | 3643 |
| 487 | Ga0395901_0248551 | 3300038443 | Bacteria | 1853 |
| 488 | Ga0436360_0378379 | 3300039438 | Bacteria | 3603 |
| 489 | Ga0436361_0201117 | 3300039447 | Bacteria | 5845 |
| 490 | Ga0436361_0759821 | 3300039447 | Bacteria | 1501 |
| 491 | Ga0436361_1117914 | 3300039447 | Bacteria | 4441 |
| 492 | Ga0436361_1173055 | 3300039447 | Bacteria | 3143 |
| 493 | Ga0439447_000529 | 3300041407 | Bacteria | 14138 |
| 494 | Ga0439461_0021134 | 3300041410 | Bacteria | 1295 |
| 495 | Ga0439465_0000084 | 3300041413 | Bacteria | 20771 |
| 496 | Ga0439465_0040571 | 3300041413 | Bacteria | 1505 |
| 497 | Ga0451793_1414310 | 3300041452 | Bacteria | 1389 |
| 498 | Ga0451833_1255216 | 3300041491 | Bacteria | 954 |
| 499 | Ga0451845_0393817 | 3300041501 | Bacteria | 931 |
| 500 | Ga0451853_0547373 | 3300041512 | Bacteria | 1576 |
| 501 | Ga0451853_1218881 | 3300041512 | Bacteria | 859 |
| 502 | Ga0439445_0056153 | 3300042004 | Bacteria | 1070 |
| 503 | Ga0439448_0074588 | 3300042005 | Bacteria | 1133 |
| 504 | Ga0439432_074696 | 3300042006 | Bacteria | 1031 |
| 505 | Ga0439449_0000268 | 3300042007 | Bacteria | 18787 |
| 506 | Ga0439449_0008418 | 3300042007 | Bacteria | 3920 |
| 507 | Ga0439452_062604 | 3300042010 | Bacteria | 831 |
| 508 | Ga0450917_000970 | 3300042120 | Bacteria | 2113 |
| 509 | Ga0450888_000401 | 3300042126 | Bacteria | 4104 |
| 510 | Ga0450898_010536 | 3300042134 | Bacteria | 1499 |
| 511 | Ga0450903_016201 | 3300042138 | Bacteria | 1170 |
| 512 | Ga0450889_001420 | 3300042144 | Bacteria | 2468 |
| 513 | Ga0450906_023736 | 3300042145 | Bacteria | 1091 |
| 514 | Ga0450910_013718 | 3300042147 | Bacteria | 1181 |
| 515 | Ga0439446_0002028 | 3300042156 | Bacteria | 4794 |
| 516 | Ga0450908_006003 | 3300042184 | Bacteria | 2318 |
| 517 | Ga0439434_0026513 | 3300042435 | Bacteria | 1750 |
| 518 | Ga0439434_0075677 | 3300042435 | Bacteria | 1064 |
| 519 | Ga0450918_000414 | 3300042531 | Bacteria | 9267 |
| 520 | Ga0450918_006895 | 3300042531 | Bacteria | 2018 |
| 521 | Ga0466972_0001578 | 3300044658 | Bacteria | 11124 |
| 522 | Ga0466965_0086719 | 3300044683 | Bacteria | 1588 |
| 523 | Ga0466971_0234295 | 3300044719 | Bacteria | 872 |
| 524 | Ga0466970_0075878 | 3300044765 | Bacteria | 1811 |
| 525 | Ga0466957_0074081 | 3300044842 | Bacteria | 2111 |
| 526 | Ga0451576_0147436 | 3300045051 | Bacteria | 2454 |
| 527 | Ga0495627_006828 | 3300046453 | Bacteria | 4439 |
| 528 | Ga0495627_027845 | 3300046453 | Bacteria | 1809 |
| 529 | Ga0495650_0067401 | 3300046471 | Bacteria | 1414 |
| 530 | Ga0495639_0002546 | 3300046475 | Bacteria | 7952 |
| 531 | Ga0495584_0003469 | 3300046491 | Bacteria | 8673 |
| 532 | Ga0495585_0053252 | 3300046492 | Bacteria | 2240 |
| 533 | Ga0495583_0000793 | 3300046506 | Bacteria | 39114 |
| 534 | Ga0495606_0005138 | 3300046507 | Bacteria | 12695 |
| 535 | Ga0495606_0007042 | 3300046507 | Bacteria | 10192 |
| 536 | Ga0495606_0155394 | 3300046507 | Bacteria | 1339 |
| 537 | Ga0495620_0137700 | 3300046515 | Bacteria | 955 |
| 538 | Ga0495630_0000030 | 3300046517 | Bacteria | 139077 |
| 539 | Ga0495637_0000370 | 3300046520 | Bacteria | 33899 |
| 540 | Ga0495637_0001189 | 3300046520 | Bacteria | 15841 |
| 541 | Ga0495663_0044485 | 3300046525 | Bacteria | 1359 |
| 542 | Ga0495654_0062108 | 3300046530 | Bacteria | 1792 |
| 543 | Ga0495654_0077578 | 3300046530 | Bacteria | 1563 |
| 544 | Ga0495586_0022024 | 3300046535 | Bacteria | 3401 |
| 545 | Ga0495621_0036563 | 3300046539 | Bacteria | 1705 |
| 546 | Ga0495621_0037761 | 3300046539 | Bacteria | 1681 |
| 547 | Ga0495597_0003400 | 3300046542 | Bacteria | 9320 |
| 548 | Ga0495645_0343906 | 3300046543 | Bacteria | 963 |
| 549 | Ga0495656_0001230 | 3300046615 | Bacteria | 8327 |
| 550 | Ga0495656_0013520 | 3300046615 | Bacteria | 3039 |
| 551 | Ga0495668_0000681 | 3300046616 | Bacteria | 40916 |
| 552 | Ga0495625_0000638 | 3300046660 | Bacteria | 50402 |
| 553 | Ga0495625_0018461 | 3300046660 | Bacteria | 5445 |
| 554 | Ga0495625_0024281 | 3300046660 | Bacteria | 4615 |
| 555 | Ga0495625_0114367 | 3300046660 | Bacteria | 1842 |
| 556 | Ga0495625_0193880 | 3300046660 | Bacteria | 1344 |
| 557 | Ga0495659_0000557 | 3300046664 | Bacteria | 13692 |
| 558 | Ga0495588_0043306 | 3300046674 | Bacteria | 2303 |
| 559 | Ga0495670_0027741 | 3300046691 | Bacteria | 2807 |
| 560 | Ga0495671_0000086 | 3300046692 | Bacteria | 87499 |
| 561 | Ga0495649_0004901 | 3300046694 | Bacteria | 8635 |
| 562 | Ga0495589_0008420 | 3300046794 | Bacteria | 5391 |
| 563 | Ga0495636_0011051 | 3300047318 | Bacteria | 3573 |
| 564 | Ga0495672_0000458 | 3300047320 | Bacteria | 48213 |
| 565 | Ga0495673_0088134 | 3300047469 | Bacteria | 1272 |
| 566 | Ga0495686_0006678 | 3300047472 | Bacteria | 8780 |
| 567 | Ga0496101_0006811 | 3300048904 | Bacteria | 7371 |
| 568 | Ga0496103_0028850 | 3300048906 | Bacteria | 3370 |
| 569 | Ga0496104_0025417 | 3300048907 | Bacteria | 5459 |
| 570 | Ga0496104_0027094 | 3300048907 | Bacteria | 5300 |
| 571 | Ga0496105_0002846 | 3300048908 | Bacteria | 12657 |
| 572 | Ga0496106_0058106 | 3300048909 | Bacteria | 2927 |
| 573 | Ga0496106_0321985 | 3300048909 | Bacteria | 1241 |
| 574 | Ga0496107_0029116 | 3300048910 | Bacteria | 3927 |
| 575 | Ga0496108_0056426 | 3300048911 | Bacteria | 3300 |
| 576 | Ga0496108_0068954 | 3300048911 | Bacteria | 2984 |
| 577 | Ga0496108_0224766 | 3300048911 | Bacteria | 1631 |
| 578 | Ga0496109_0061608 | 3300048912 | Bacteria | 3430 |
| 579 | Ga0496109_0121333 | 3300048912 | Bacteria | 2435 |
| 580 | Ga0496109_0245079 | 3300048912 | Bacteria | 1687 |
| 581 | Ga0496110_0052425 | 3300048913 | Bacteria | 3584 |
| 582 | Ga0496110_0123111 | 3300048913 | Bacteria | 2338 |
| 583 | Ga0496111_0116415 | 3300048914 | Bacteria | 1971 |
| 584 | Ga0496111_0278171 | 3300048914 | Bacteria | 1241 |
| 585 | Ga0496114_0006538 | 3300048917 | Bacteria | 9186 |
| 586 | Ga0496114_0043794 | 3300048917 | Bacteria | 3711 |
| 587 | Ga0496114_0097975 | 3300048917 | Bacteria | 2499 |
| 588 | Ga0496114_0128320 | 3300048917 | Bacteria | 2188 |
| 589 | Ga0496114_0158950 | 3300048917 | Bacteria | 1964 |
| 590 | Ga0496114_0518415 | 3300048917 | Bacteria | 1054 |
| 591 | Ga0496117_0004897 | 3300048920 | Bacteria | 14423 |
| 592 | Ga0496121_0006346 | 3300048924 | Bacteria | 14735 |
| 593 | Ga0496121_0008905 | 3300048924 | Bacteria | 11654 |
| 594 | Ga0496121_0049489 | 3300048924 | Bacteria | 3563 |
| 595 | Ga0496122_0034206 | 3300048925 | Bacteria | 4163 |
| 596 | Ga0496122_0199841 | 3300048925 | Bacteria | 1170 |
| 597 | Ga0496123_0004412 | 3300048926 | Bacteria | 14811 |
| 598 | Ga0496124_0001194 | 3300048927 | Bacteria | 40486 |
| 599 | Ga0496125_0121450 | 3300048928 | Bacteria | 1863 |
| 600 | Ga0496126_0044652 | 3300048929 | Bacteria | 4079 |
| 601 | Ga0495678_000302 | 3300049459 | Bacteria | 53782 |
| 602 | Ga0501033_0053494 | 3300049570 | Bacteria | 2990 |
| 603 | Ga0501034_0000222 | 3300049571 | Bacteria | 108857 |
| 604 | Ga0501034_0000898 | 3300049571 | Bacteria | 43341 |
| 605 | Ga0501036_0189614 | 3300049572 | Bacteria | 1730 |
| 606 | Ga0501036_0433907 | 3300049572 | Bacteria | 1095 |
| 607 | Ga0501038_0141493 | 3300049574 | Bacteria | 1968 |
| 608 | Ga0501039_0010790 | 3300049575 | Bacteria | 6958 |
| 609 | Ga0501039_0015187 | 3300049575 | Bacteria | 5893 |
| 610 | Ga0501040_0028612 | 3300049576 | Bacteria | 3758 |
| 611 | Ga0501041_0002404 | 3300049577 | Bacteria | 10600 |
| 612 | Ga0501041_0006696 | 3300049577 | Bacteria | 6752 |
| 613 | Ga0501041_0357588 | 3300049577 | Bacteria | 923 |
| 614 | Ga0501042_0366992 | 3300049578 | Bacteria | 1042 |
| 615 | Ga0501043_0000101 | 3300049579 | Bacteria | 78983 |
| 616 | Ga0501043_0012695 | 3300049579 | Bacteria | 6588 |
| 617 | Ga0501043_0139603 | 3300049579 | Bacteria | 1898 |
| 618 | Ga0501043_0169394 | 3300049579 | Bacteria | 1704 |
| 619 | Ga0501043_0254805 | 3300049579 | Bacteria | 1351 |
| 620 | Ga0501046_0000135 | 3300049580 | Bacteria | 79084 |
| 621 | Ga0501046_0246501 | 3300049580 | Bacteria | 1316 |
| 622 | Ga0501047_0000173 | 3300049581 | Bacteria | 79071 |
| 623 | Ga0501048_0000452 | 3300049582 | Bacteria | 28741 |
| 624 | Ga0501048_0189279 | 3300049582 | Bacteria | 1458 |
| 625 | Ga0501071_0011488 | 3300049587 | Bacteria | 5969 |
| 626 | Ga0501071_0014912 | 3300049587 | Bacteria | 5325 |
| 627 | Ga0501072_0037193 | 3300049588 | Bacteria | 3817 |
| 628 | Ga0501072_0200199 | 3300049588 | Bacteria | 1592 |
| 629 | Ga0501075_0058953 | 3300049591 | Bacteria | 2891 |
| 630 | Ga0501075_0344075 | 3300049591 | Bacteria | 1136 |
| 631 | Ga0501076_0006136 | 3300049592 | Bacteria | 8698 |
| 632 | Ga0501076_0011408 | 3300049592 | Bacteria | 6617 |
| 633 | Ga0501077_0029861 | 3300049593 | Bacteria | 3467 |
| 634 | Ga0501223_021719 | 3300049663 | Bacteria | 1255 |
| 635 | Ga0501225_0035994 | 3300049705 | Bacteria | 1364 |
| 636 | Ga0501079_0425576 | 3300049741 | Bacteria | 1042 |
| 637 | Ga0501081_0015619 | 3300049743 | Bacteria | 5012 |
| 638 | Ga0501081_0312261 | 3300049743 | Bacteria | 1154 |
| 639 | Ga0501262_000176 | 3300049759 | Bacteria | 8070 |
| 640 | Ga0501269_000229 | 3300049766 | Bacteria | 16443 |
| 641 | Ga0501035_0020829 | 3300049822 | Bacteria | 6025 |
| 642 | Ga0501035_0155201 | 3300049822 | Bacteria | 1984 |
| 643 | Ga0501045_0002898 | 3300049824 | Bacteria | 11719 |
| 644 | Ga0501045_0007526 | 3300049824 | Bacteria | 7568 |
| 645 | Ga0501045_0062480 | 3300049824 | Bacteria | 2733 |
| 646 | nmdc:mga03683_100965_c1 | 3300050489 | Bacteria | 1268 |
| 647 | nmdc:mga03683_126965_c1 | 3300050489 | Bacteria | 1138 |
| 648 | nmdc:mga03683_31153_c1 | 3300050489 | Bacteria | 2138 |
| 649 | nmdc:mga03683_43024_c1 | 3300050489 | Bacteria | 1861 |
| 650 | nmdc:mga03683_54099_c1 | 3300050489 | Bacteria | 1682 |
| 651 | nmdc:mga03683_6403_c1 | 3300050489 | Bacteria | 4028 |
| 652 | nmdc:mga03683_6512_c1 | 3300050489 | Bacteria | 4002 |
| 653 | nmdc:mga03683_7996_c1 | 3300050489 | Bacteria | 3698 |
| 654 | nmdc:mga03683_8539_c1 | 3300050489 | Bacteria | 3605 |
| 655 | nmdc:mga03n38_7168_c1 | 3300050490 | Bacteria | 3927 |
| 656 | nmdc:mga00v17_180286_c1 | 3300050491 | Bacteria | 1363 |
| 657 | nmdc:mga00v17_36229_c1 | 3300050491 | Bacteria | 2940 |
| 658 | nmdc:mga0yw44_13764_c1 | 3300050492 | Bacteria | 4272 |
| 659 | nmdc:mga0yw44_147998_c1 | 3300050492 | Bacteria | 1530 |
| 660 | nmdc:mga0yw44_28476_c1 | 3300050492 | Bacteria | 3213 |
| 661 | nmdc:mga0yw44_478019_c1 | 3300050492 | Bacteria | 845 |
| 662 | nmdc:mga0k408_22684_c1 | 3300050493 | Bacteria | 3536 |
| 663 | nmdc:mga0k408_34040_c1 | 3300050493 | Bacteria | 2915 |
| 664 | nmdc:mga0k408_89021_c1 | 3300050493 | Bacteria | 1813 |
| 665 | nmdc:mga06z11_297568_c1 | 3300050494 | Bacteria | 959 |
| 666 | nmdc:mga06z11_5710_c1 | 3300050494 | Bacteria | 5012 |
| 667 | nmdc:mga04h51_48324_c1 | 3300050495 | Bacteria | 1417 |
| 668 | nmdc:mga07m45_42522_c1 | 3300050496 | Bacteria | 2547 |
| 669 | nmdc:mga07m45_527_c1 | 3300050496 | Bacteria | 16233 |
| 670 | nmdc:mga05p37_6901_c1 | 3300050507 | Bacteria | 13387 |
| 671 | nmdc:mga09592_159191_c1 | 3300050508 | Bacteria | 1950 |
| 672 | nmdc:mga09592_4077_c1 | 3300050508 | Bacteria | 11795 |
| 673 | nmdc:mga09592_5902_c1 | 3300050508 | Bacteria | 9989 |
| 674 | nmdc:mga09592_859_c1 | 3300050508 | Bacteria | 23706 |
| 675 | nmdc:mga0qj67_4193_c1 | 3300050509 | Bacteria | 10443 |
| 676 | nmdc:mga06r32_220734_c1 | 3300050510 | Bacteria | 1884 |
| 677 | nmdc:mga06r32_35242_c1 | 3300050510 | Bacteria | 4722 |
| 678 | nmdc:mga08y16_14823_c1 | 3300050511 | Bacteria | 8197 |
| 679 | nmdc:mga08y16_431644_c1 | 3300050511 | Bacteria | 1345 |
| 680 | nmdc:mga0rr50_95526_c1 | 3300050513 | Bacteria | 2323 |
| 681 | nmdc:mga0sz30_2905_c1 | 3300050516 | Bacteria | 6140 |
| 682 | Ga0500610_0001037 | 3300053079 | Bacteria | 9100 |
| 683 | Ga0500610_0021069 | 3300053079 | Bacteria | 3192 |
| 684 | Ga0500635_0000025 | 3300053080 | Bacteria | 105726 |
| 685 | Ga0500578_0001187 | 3300053086 | Bacteria | 27526 |
| 686 | Ga0500644_0001451 | 3300053088 | Bacteria | 6255 |
| 687 | Ga0500641_0008683 | 3300053096 | Bacteria | 3633 |
| 688 | Ga0500641_0119735 | 3300053096 | Bacteria | 1134 |
| 689 | Ga0500562_001416 | 3300053108 | Bacteria | 5893 |
| 690 | Ga0500593_001175 | 3300053117 | Bacteria | 9454 |
| 691 | Ga0500593_146308 | 3300053117 | Bacteria | 923 |
| 692 | Ga0500597_197105 | 3300053120 | Bacteria | 847 |
| 693 | Ga0500607_000368 | 3300053121 | Bacteria | 43100 |
| 694 | Ga0500608_009545 | 3300053122 | Bacteria | 4127 |
| 695 | Ga0500628_002085 | 3300053129 | Bacteria | 3354 |
| 696 | Ga0500561_0025890 | 3300053137 | Bacteria | 1432 |
| 697 | Ga0500568_0008442 | 3300053139 | Bacteria | 4960 |
| 698 | Ga0500604_0005928 | 3300053151 | Bacteria | 3228 |
| 699 | Ga0500619_000183 | 3300053154 | Bacteria | 14804 |
| 700 | Ga0500622_0125911 | 3300053156 | Bacteria | 1237 |
| 701 | Ga0500627_0017867 | 3300053158 | Bacteria | 2795 |
| 702 | Ga0500636_0153269 | 3300053177 | Bacteria | 1263 |
| 703 | Ga0500587_002124 | 3300053739 | Bacteria | 2830 |
| 704 | Ga0501084_0023612 | 3300054114 | Bacteria | 5129 |
| 705 | Ga0501084_0056926 | 3300054114 | Bacteria | 3271 |
| 706 | Ga0501082_0005977 | 3300060353 | Bacteria | 10555 |
| 707 | Ga0501082_0014790 | 3300060353 | Bacteria | 6719 |
| 708 | Ga0466962_0012160 | 3300061719 | Bacteria | 4138 |
| 709 | Ga0530510_0022112 | 3300061734 | Bacteria | 4528 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042010 | Ga0439452_062604 | Ga0439452_062604_173_814 | 210 |
| 2 | 3300048924 | Ga0496121_0006346 | Ga0496121_0006346_3589_4362 | 211 |
| 3 | 3300005616 | Ga0068852_100036176 | Ga0068852_1000361765 | 213 |
| 4 | 3300013307 | Ga0157372_10477128 | Ga0157372_104771282 | 213 |
| 5 | 3300028794 | Ga0307515_10110109 | Ga0307515_101101093 | 216 |
| 6 | 3300036401 | Ga0373937_0821452 | Ga0373937_0821452_20_751 | 218 |
| 7 | 3300053137 | Ga0500561_0025890 | Ga0500561_0025890_122_913 | 218 |
| 8 | 3300038443 | Ga0395901_0248551 | Ga0395901_0248551_12_746 | 220 |
| 9 | 3300005328 | Ga0070676_10042449 | Ga0070676_100424493 | 221 |
| 10 | 3300005331 | Ga0070670_100052538 | Ga0070670_1000525384 | 221 |
| 11 | 3300005354 | Ga0070675_100073009 | Ga0070675_1000730093 | 221 |
| 12 | 3300005543 | Ga0070672_100164859 | Ga0070672_1001648593 | 221 |
| 13 | 3300025907 | Ga0207645_10053165 | Ga0207645_100531651 | 221 |
| 14 | 3300025925 | Ga0207650_10027784 | Ga0207650_100277845 | 221 |
| 15 | 3300025940 | Ga0207691_10020929 | Ga0207691_100209293 | 221 |
| 16 | 3300048927 | Ga0496124_0001194 | Ga0496124_0001194_25146_25907 | 221 |
| 17 | 3300032002 | Ga0307416_101141087 | Ga0307416_1011410872 | 222 |
| 18 | 3300037471 | Ga0395905_0269989 | Ga0395905_0269989_466_1209 | 222 |
| 19 | 3300042138 | Ga0450903_016201 | Ga0450903_016201_265_1053 | 222 |
| 20 | 3300005338 | Ga0068868_100342648 | Ga0068868_1003426482 | 224 |
| 21 | 3300026023 | Ga0207677_10396024 | Ga0207677_103960242 | 224 |
| 22 | 3300032133 | Ga0316583_10015793 | Ga0316583_100157933 | 224 |
| 23 | 3300053156 | Ga0500622_0125911 | Ga0500622_0125911_265_1056 | 224 |
| 24 | 3300049571 | Ga0501034_0000222 | Ga0501034_0000222_11360_12037 | 225 |
| 25 | 3300053117 | Ga0500593_146308 | Ga0500593_146308_37_828 | 225 |
| 26 | 3300054114 | Ga0501084_0056926 | Ga0501084_0056926_336_1118 | 226 |
| 27 | 3300005333 | Ga0070677_10159219 | Ga0070677_101592192 | 227 |
| 28 | 3300005347 | Ga0070668_100211738 | Ga0070668_1002117382 | 227 |
| 29 | 3300005367 | Ga0070667_100130790 | Ga0070667_1001307903 | 227 |
| 30 | 3300013306 | Ga0163162_10181586 | Ga0163162_101815863 | 227 |
| 31 | 3300025924 | Ga0207694_10181914 | Ga0207694_101819142 | 227 |
| 32 | 3300025986 | Ga0207658_10104335 | Ga0207658_101043352 | 227 |
| 33 | 3300048904 | Ga0496101_0006811 | Ga0496101_0006811_5225_5992 | 227 |
| 34 | 3300048906 | Ga0496103_0028850 | Ga0496103_0028850_1322_2089 | 227 |
| 35 | 3300048908 | Ga0496105_0002846 | Ga0496105_0002846_6119_6886 | 227 |
| 36 | 3300048909 | Ga0496106_0058106 | Ga0496106_0058106_679_1446 | 227 |
| 37 | 3300048910 | Ga0496107_0029116 | Ga0496107_0029116_1360_2127 | 227 |
| 38 | 3300048911 | Ga0496108_0068954 | Ga0496108_0068954_32_799 | 227 |
| 39 | 3300048913 | Ga0496110_0123111 | Ga0496110_0123111_766_1533 | 227 |
| 40 | 3300048914 | Ga0496111_0116415 | Ga0496111_0116415_649_1416 | 227 |
| 41 | 3300048917 | Ga0496114_0128320 | Ga0496114_0128320_62_829 | 227 |
| 42 | 3300006038 | Ga0075365_10048421 | Ga0075365_100484215 | 228 |
| 43 | 3300037312 | Ga0395899_0250249 | Ga0395899_0250249_103_873 | 228 |
| 44 | 3300037466 | Ga0395898_0024937 | Ga0395898_0024937_2110_2880 | 228 |
| 45 | 3300053080 | Ga0500635_0000025 | Ga0500635_0000025_19753_20532 | 228 |
| 46 | 3300006175 | Ga0070712_100569735 | Ga0070712_1005697351 | 230 |
| 47 | 3300005262 | Ga0065165_1003590 | Ga0065165_10035905 | 231 |
| 48 | 3300025922 | Ga0207646_10151450 | Ga0207646_101514502 | 231 |
| 49 | 3300031251 | Ga0265327_10008749 | Ga0265327_100087497 | 231 |
| 50 | 3300045051 | Ga0451576_0147436 | Ga0451576_0147436_458_1162 | 231 |
| 51 | 3300046535 | Ga0495586_0022024 | Ga0495586_0022024_1514_2341 | 231 |
| 52 | 3300005841 | Ga0068863_100093710 | Ga0068863_1000937103 | 232 |
| 53 | 3300026088 | Ga0207641_10078072 | Ga0207641_100780723 | 232 |
| 54 | 3300042007 | Ga0439449_0008418 | Ga0439449_0008418_2990_3760 | 232 |
| 55 | 3300042120 | Ga0450917_000970 | Ga0450917_000970_1095_1898 | 232 |
| 56 | 3300042126 | Ga0450888_000401 | Ga0450888_000401_1582_2385 | 232 |
| 57 | 3300042144 | Ga0450889_001420 | Ga0450889_001420_390_1193 | 232 |
| 58 | 3300042435 | Ga0439434_0075677 | Ga0439434_0075677_45_824 | 232 |
| 59 | 3300049577 | Ga0501041_0357588 | Ga0501041_0357588_176_880 | 232 |
| 60 | 3300015262 | Ga0182007_10045136 | Ga0182007_100451361 | 233 |
| 61 | 3300025910 | Ga0207684_10091817 | Ga0207684_100918173 | 233 |
| 62 | 3300031548 | Ga0307408_100086803 | Ga0307408_1000868032 | 233 |
| 63 | 3300031548 | Ga0307408_100119983 | Ga0307408_1001199833 | 233 |
| 64 | 3300031616 | Ga0307508_10200014 | Ga0307508_102000142 | 233 |
| 65 | 3300031731 | Ga0307405_10254474 | Ga0307405_102544742 | 233 |
| 66 | 3300031901 | Ga0307406_10288612 | Ga0307406_102886121 | 233 |
| 67 | 3300031911 | Ga0307412_10022514 | Ga0307412_100225143 | 233 |
| 68 | 3300031911 | Ga0307412_10060115 | Ga0307412_100601153 | 233 |
| 69 | 3300031911 | Ga0307412_10143127 | Ga0307412_101431272 | 233 |
| 70 | 3300046453 | Ga0495627_027845 | Ga0495627_027845_424_1233 | 233 |
| 71 | 3300048928 | Ga0496125_0121450 | Ga0496125_0121450_305_1114 | 233 |
| 72 | 3300049570 | Ga0501033_0053494 | Ga0501033_0053494_532_1314 | 233 |
| 73 | 3300049574 | Ga0501038_0141493 | Ga0501038_0141493_338_1120 | 233 |
| 74 | 3300049575 | Ga0501039_0010790 | Ga0501039_0010790_2239_3021 | 233 |
| 75 | 3300049578 | Ga0501042_0366992 | Ga0501042_0366992_146_856 | 233 |
| 76 | 3300049579 | Ga0501043_0139603 | Ga0501043_0139603_819_1601 | 233 |
| 77 | 3300049580 | Ga0501046_0246501 | Ga0501046_0246501_443_1225 | 233 |
| 78 | 3300049587 | Ga0501071_0014912 | Ga0501071_0014912_3531_4313 | 233 |
| 79 | 3300049588 | Ga0501072_0037193 | Ga0501072_0037193_182_964 | 233 |
| 80 | 3300049591 | Ga0501075_0344075 | Ga0501075_0344075_293_1075 | 233 |
| 81 | 3300049592 | Ga0501076_0006136 | Ga0501076_0006136_1379_2161 | 233 |
| 82 | 3300049593 | Ga0501077_0029861 | Ga0501077_0029861_29_811 | 233 |
| 83 | 3300049743 | Ga0501081_0015619 | Ga0501081_0015619_1801_2583 | 233 |
| 84 | 3300049824 | Ga0501045_0007526 | Ga0501045_0007526_4373_5155 | 233 |
| 85 | 3300060353 | Ga0501082_0014790 | Ga0501082_0014790_4147_4929 | 233 |
| 86 | 3300061734 | Ga0530510_0022112 | Ga0530510_0022112_1308_2090 | 233 |
| 87 | 3300005353 | Ga0070669_100219498 | Ga0070669_1002194982 | 234 |
| 88 | 3300005354 | Ga0070675_100266688 | Ga0070675_1002666882 | 234 |
| 89 | 3300005356 | Ga0070674_100171135 | Ga0070674_1001711352 | 234 |
| 90 | 3300005457 | Ga0070662_100303250 | Ga0070662_1003032501 | 234 |
| 91 | 3300005459 | Ga0068867_100587446 | Ga0068867_1005874461 | 234 |
| 92 | 3300005543 | Ga0070672_100116189 | Ga0070672_1001161892 | 234 |
| 93 | 3300005543 | Ga0070672_100128982 | Ga0070672_1001289822 | 234 |
| 94 | 3300005840 | Ga0068870_10041850 | Ga0068870_100418502 | 234 |
| 95 | 3300005840 | Ga0068870_10119732 | Ga0068870_101197322 | 234 |
| 96 | 3300006931 | Ga0097620_100104708 | Ga0097620_1001047083 | 234 |
| 97 | 3300009553 | Ga0105249_10652291 | Ga0105249_106522912 | 234 |
| 98 | 3300014326 | Ga0157380_10294006 | Ga0157380_102940062 | 234 |
| 99 | 3300025926 | Ga0207659_10327028 | Ga0207659_103270282 | 234 |
| 100 | 3300025938 | Ga0207704_10428917 | Ga0207704_104289171 | 234 |
| 101 | 3300025940 | Ga0207691_10010991 | Ga0207691_100109915 | 234 |
| 102 | 3300025940 | Ga0207691_10077217 | Ga0207691_100772173 | 234 |
| 103 | 3300026089 | Ga0207648_10237217 | Ga0207648_102372172 | 234 |
| 104 | 3300005436 | Ga0070713_100173092 | Ga0070713_1001730923 | 235 |
| 105 | 3300006028 | Ga0070717_10441651 | Ga0070717_104416512 | 235 |
| 106 | 3300006237 | Ga0097621_100284698 | Ga0097621_1002846982 | 235 |
| 107 | 3300030733 | Ga0314311_1150282 | Ga0314311_11502823 | 235 |
| 108 | 3300032005 | Ga0307411_10293811 | Ga0307411_102938112 | 235 |
| 109 | 3300041410 | Ga0439461_0021134 | Ga0439461_0021134_57_845 | 235 |
| 110 | 3300042156 | Ga0439446_0002028 | Ga0439446_0002028_2456_3244 | 235 |
| 111 | 3300048925 | Ga0496122_0034206 | Ga0496122_0034206_2309_3118 | 235 |
| 112 | 3300048926 | Ga0496123_0004412 | Ga0496123_0004412_5364_6173 | 235 |
| 113 | 3300049572 | Ga0501036_0189614 | Ga0501036_0189614_216_941 | 235 |
| 114 | 3300049572 | Ga0501036_0433907 | Ga0501036_0433907_297_1085 | 235 |
| 115 | 3300049575 | Ga0501039_0015187 | Ga0501039_0015187_85_810 | 235 |
| 116 | 3300049576 | Ga0501040_0028612 | Ga0501040_0028612_2257_2982 | 235 |
| 117 | 3300049577 | Ga0501041_0002404 | Ga0501041_0002404_7569_8294 | 235 |
| 118 | 3300049577 | Ga0501041_0006696 | Ga0501041_0006696_1532_2320 | 235 |
| 119 | 3300049579 | Ga0501043_0012695 | Ga0501043_0012695_5621_6346 | 235 |
| 120 | 3300049582 | Ga0501048_0189279 | Ga0501048_0189279_325_1050 | 235 |
| 121 | 3300049587 | Ga0501071_0011488 | Ga0501071_0011488_3862_4587 | 235 |
| 122 | 3300049588 | Ga0501072_0200199 | Ga0501072_0200199_90_815 | 235 |
| 123 | 3300049591 | Ga0501075_0058953 | Ga0501075_0058953_612_1337 | 235 |
| 124 | 3300049592 | Ga0501076_0011408 | Ga0501076_0011408_2484_3209 | 235 |
| 125 | 3300049822 | Ga0501035_0155201 | Ga0501035_0155201_54_779 | 235 |
| 126 | 3300049824 | Ga0501045_0062480 | Ga0501045_0062480_255_980 | 235 |
| 127 | 3300054114 | Ga0501084_0023612 | Ga0501084_0023612_447_1172 | 235 |
| 128 | 3300060353 | Ga0501082_0005977 | Ga0501082_0005977_5883_6608 | 235 |
| 129 | 3300003322 | rootL2_10055265 | rootL2_100552652 | 236 |
| 130 | 3300003784 | Ga0055534_1003939 | Ga0055534_10039392 | 236 |
| 131 | 3300005354 | Ga0070675_100321492 | Ga0070675_1003214922 | 236 |
| 132 | 3300005364 | Ga0070673_100524112 | Ga0070673_1005241122 | 236 |
| 133 | 3300025284 | Ga0209130_1016584 | Ga0209130_10165842 | 236 |
| 134 | 3300025291 | Ga0209675_1001897 | Ga0209675_10018972 | 236 |
| 135 | 3300025292 | Ga0209676_1020288 | Ga0209676_10202882 | 236 |
| 136 | 3300025295 | Ga0209564_1039105 | Ga0209564_10391051 | 236 |
| 137 | 3300025303 | Ga0209051_1020044 | Ga0209051_10200442 | 236 |
| 138 | 3300025304 | Ga0209257_1007879 | Ga0209257_10078794 | 236 |
| 139 | 3300046615 | Ga0495656_0013520 | Ga0495656_0013520_750_1472 | 236 |
| 140 | 3300046616 | Ga0495668_0000681 | Ga0495668_0000681_15254_16042 | 236 |
| 141 | 3300047318 | Ga0495636_0011051 | Ga0495636_0011051_2767_3489 | 236 |
| 142 | 3300048911 | Ga0496108_0224766 | Ga0496108_0224766_175_897 | 236 |
| 143 | 3300048912 | Ga0496109_0121333 | Ga0496109_0121333_395_1117 | 236 |
| 144 | 3300048914 | Ga0496111_0278171 | Ga0496111_0278171_270_992 | 236 |
| 145 | 3300048917 | Ga0496114_0158950 | Ga0496114_0158950_1232_1954 | 236 |
| 146 | 3300005436 | Ga0070713_100437197 | Ga0070713_1004371971 | 237 |
| 147 | 3300005459 | Ga0068867_100549100 | Ga0068867_1005491001 | 237 |
| 148 | 3300005467 | Ga0070706_100046962 | Ga0070706_1000469622 | 237 |
| 149 | 3300005467 | Ga0070706_100147422 | Ga0070706_1001474222 | 237 |
| 150 | 3300005468 | Ga0070707_100311578 | Ga0070707_1003115782 | 237 |
| 151 | 3300005471 | Ga0070698_100131748 | Ga0070698_1001317481 | 237 |
| 152 | 3300005518 | Ga0070699_100123539 | Ga0070699_1001235392 | 237 |
| 153 | 3300005536 | Ga0070697_100118575 | Ga0070697_1001185752 | 237 |
| 154 | 3300006028 | Ga0070717_10072109 | Ga0070717_100721094 | 237 |
| 155 | 3300006237 | Ga0097621_100022185 | Ga0097621_1000221853 | 237 |
| 156 | 3300006358 | Ga0068871_100017429 | Ga0068871_1000174292 | 237 |
| 157 | 3300025910 | Ga0207684_10099326 | Ga0207684_100993263 | 237 |
| 158 | 3300025910 | Ga0207684_10221853 | Ga0207684_102218531 | 237 |
| 159 | 3300025922 | Ga0207646_10624795 | Ga0207646_106247952 | 237 |
| 160 | 3300025928 | Ga0207700_10135300 | Ga0207700_101353001 | 237 |
| 161 | 3300025929 | Ga0207664_10691548 | Ga0207664_106915481 | 237 |
| 162 | 3300041501 | Ga0451845_0393817 | Ga0451845_0393817_30_848 | 237 |
| 163 | 3300003792 | Ga0055540_1000625 | Ga0055540_100062511 | 238 |
| 164 | 3300005456 | Ga0070678_100104732 | Ga0070678_1001047323 | 238 |
| 165 | 3300025303 | Ga0209051_1000271 | Ga0209051_100027140 | 238 |
| 166 | 3300026075 | Ga0207708_10071198 | Ga0207708_100711982 | 238 |
| 167 | 3300026121 | Ga0207683_10076230 | Ga0207683_100762303 | 238 |
| 168 | 3300031251 | Ga0265327_10117302 | Ga0265327_101173022 | 238 |
| 169 | 3300039447 | Ga0436361_0759821 | Ga0436361_0759821_502_1275 | 238 |
| 170 | 3300050496 | nmdc:mga07m45_42522_c1 | nmdc:mga07m45_42522_c1_1095_1928 | 238 |
| 171 | 3300005327 | Ga0070658_10006378 | Ga0070658_1000637811 | 239 |
| 172 | 3300005364 | Ga0070673_100236884 | Ga0070673_1002368842 | 239 |
| 173 | 3300005548 | Ga0070665_100005593 | Ga0070665_10000559310 | 239 |
| 174 | 3300005617 | Ga0068859_100288940 | Ga0068859_1002889402 | 239 |
| 175 | 3300006931 | Ga0097620_100288967 | Ga0097620_1002889674 | 239 |
| 176 | 3300009093 | Ga0105240_10331375 | Ga0105240_103313753 | 239 |
| 177 | 3300021361 | Ga0213872_10030461 | Ga0213872_100304612 | 239 |
| 178 | 3300025908 | Ga0207643_10223059 | Ga0207643_102230592 | 239 |
| 179 | 3300025925 | Ga0207650_10490009 | Ga0207650_104900092 | 239 |
| 180 | 3300025961 | Ga0207712_10342035 | Ga0207712_103420351 | 239 |
| 181 | 3300026089 | Ga0207648_10144894 | Ga0207648_101448941 | 239 |
| 182 | 3300028379 | Ga0268266_10000276 | Ga0268266_1000027627 | 239 |
| 183 | 3300028794 | Ga0307515_10001343 | Ga0307515_1000134315 | 239 |
| 184 | 3300031665 | Ga0316575_10164074 | Ga0316575_101640742 | 239 |
| 185 | 3300039447 | Ga0436361_0201117 | Ga0436361_0201117_3168_3953 | 239 |
| 186 | 3300041512 | Ga0451853_1218881 | Ga0451853_1218881_54_836 | 239 |
| 187 | 3300048924 | Ga0496121_0049489 | Ga0496121_0049489_1859_2593 | 239 |
| 188 | 3300048929 | Ga0496126_0044652 | Ga0496126_0044652_259_993 | 239 |
| 189 | 3300050511 | nmdc:mga08y16_431644_c1 | nmdc:mga08y16_431644_c1_248_982 | 239 |
| 190 | iso_pu_bacteria | 2643221585 | 2643934351 | 239 |
| 191 | iso_pu_bacteria | 2643221656 | 2644315838 | 239 |
| 192 | 3300013308 | Ga0157375_10724851 | Ga0157375_107248511 | 240 |
| 193 | 3300025909 | Ga0207705_10232650 | Ga0207705_102326502 | 240 |
| 194 | 3300025944 | Ga0207661_10349605 | Ga0207661_103496052 | 240 |
| 195 | 3300025960 | Ga0207651_10007310 | Ga0207651_100073102 | 240 |
| 196 | 3300041407 | Ga0439447_000529 | Ga0439447_000529_2364_3152 | 240 |
| 197 | 3300006178 | Ga0075367_10071757 | Ga0075367_100717573 | 241 |
| 198 | 3300010375 | Ga0105239_10113071 | Ga0105239_101130712 | 241 |
| 199 | 3300013297 | Ga0157378_10047413 | Ga0157378_100474133 | 241 |
| 200 | 3300025263 | Ga0209565_1013694 | Ga0209565_10136942 | 241 |
| 201 | 3300025299 | Ga0209256_1000120 | Ga0209256_100012021 | 241 |
| 202 | 3300025728 | Ga0207655_1047804 | Ga0207655_10478042 | 241 |
| 203 | 3300048917 | Ga0496114_0043794 | Ga0496114_0043794_2249_3010 | 241 |
| 204 | 3300050489 | nmdc:mga03683_100965_c1 | nmdc:mga03683_100965_c1_258_1040 | 241 |
| 205 | 3300005333 | Ga0070677_10097407 | Ga0070677_100974072 | 242 |
| 206 | 3300005985 | Ga0081539_10029495 | Ga0081539_100294953 | 242 |
| 207 | 3300006038 | Ga0075365_10131459 | Ga0075365_101314591 | 242 |
| 208 | 3300006880 | Ga0075429_100396202 | Ga0075429_1003962022 | 242 |
| 209 | 3300009094 | Ga0111539_10015684 | Ga0111539_100156847 | 242 |
| 210 | 3300009147 | Ga0114129_10171771 | Ga0114129_101717712 | 242 |
| 211 | 3300011119 | Ga0105246_10048831 | Ga0105246_100488312 | 242 |
| 212 | 3300025937 | Ga0207669_10072473 | Ga0207669_100724732 | 242 |
| 213 | 3300027907 | Ga0207428_10010548 | Ga0207428_100105487 | 242 |
| 214 | 3300046542 | Ga0495597_0003400 | Ga0495597_0003400_5793_6557 | 242 |
| 215 | 3300046664 | Ga0495659_0000557 | Ga0495659_0000557_6483_7247 | 242 |
| 216 | 3300046692 | Ga0495671_0000086 | Ga0495671_0000086_76159_76923 | 242 |
| 217 | 3300047320 | Ga0495672_0000458 | Ga0495672_0000458_27516_28280 | 242 |
| 218 | 3300050489 | nmdc:mga03683_43024_c1 | nmdc:mga03683_43024_c1_708_1448 | 242 |
| 219 | 3300050511 | nmdc:mga08y16_14823_c1 | nmdc:mga08y16_14823_c1_1798_2559 | 242 |
| 220 | 3300005327 | Ga0070658_10393348 | Ga0070658_103933483 | 243 |
| 221 | 3300005329 | Ga0070683_100007807 | Ga0070683_10000780711 | 243 |
| 222 | 3300005337 | Ga0070682_100461931 | Ga0070682_1004619311 | 243 |
| 223 | 3300005344 | Ga0070661_100039349 | Ga0070661_1000393493 | 243 |
| 224 | 3300005563 | Ga0068855_100032438 | Ga0068855_1000324384 | 243 |
| 225 | 3300005563 | Ga0068855_100655682 | Ga0068855_1006556822 | 243 |
| 226 | 3300005564 | Ga0070664_100006836 | Ga0070664_1000068367 | 243 |
| 227 | 3300005614 | Ga0068856_100005465 | Ga0068856_1000054655 | 243 |
| 228 | 3300005616 | Ga0068852_100077532 | Ga0068852_1000775323 | 243 |
| 229 | 3300005834 | Ga0068851_10215542 | Ga0068851_102155421 | 243 |
| 230 | 3300005937 | Ga0081455_10023053 | Ga0081455_100230532 | 243 |
| 231 | 3300011119 | Ga0105246_10278320 | Ga0105246_102783202 | 243 |
| 232 | 3300013100 | Ga0157373_10268384 | Ga0157373_102683841 | 243 |
| 233 | 3300013104 | Ga0157370_10469454 | Ga0157370_104694542 | 243 |
| 234 | 3300013105 | Ga0157369_10070182 | Ga0157369_100701822 | 243 |
| 235 | 3300013307 | Ga0157372_10008371 | Ga0157372_100083714 | 243 |
| 236 | 3300014497 | Ga0182008_10100425 | Ga0182008_101004251 | 243 |
| 237 | 3300017792 | Ga0163161_10000127 | Ga0163161_100001279 | 243 |
| 238 | 3300025944 | Ga0207661_10007104 | Ga0207661_1000710411 | 243 |
| 239 | 3300025949 | Ga0207667_10024754 | Ga0207667_100247545 | 243 |
| 240 | 3300025949 | Ga0207667_10523706 | Ga0207667_105237062 | 243 |
| 241 | 3300026078 | Ga0207702_10016789 | Ga0207702_100167894 | 243 |
| 242 | 3300026116 | Ga0207674_10067265 | Ga0207674_100672654 | 243 |
| 243 | 3300026118 | Ga0207675_100848070 | Ga0207675_1008480701 | 243 |
| 244 | 3300026142 | Ga0207698_10004401 | Ga0207698_100044014 | 243 |
| 245 | 3300030731 | Ga0316177_1121344 | Ga0316177_11213444 | 243 |
| 246 | 3300031507 | Ga0307509_10023870 | Ga0307509_100238704 | 243 |
| 247 | 3300031616 | Ga0307508_10060284 | Ga0307508_100602842 | 243 |
| 248 | 3300037312 | Ga0395899_0047170 | Ga0395899_0047170_1131_1898 | 243 |
| 249 | 3300037471 | Ga0395905_0114921 | Ga0395905_0114921_1127_1873 | 243 |
| 250 | 3300038443 | Ga0395901_0013644 | Ga0395901_0013644_1224_1991 | 243 |
| 251 | 3300042005 | Ga0439448_0074588 | Ga0439448_0074588_53_820 | 243 |
| 252 | 3300046517 | Ga0495630_0000030 | Ga0495630_0000030_64511_65275 | 243 |
| 253 | 3300049759 | Ga0501262_000176 | Ga0501262_000176_6165_7004 | 243 |
| 254 | 3300005439 | Ga0070711_100490847 | Ga0070711_1004908471 | 244 |
| 255 | 3300005548 | Ga0070665_100749225 | Ga0070665_1007492251 | 244 |
| 256 | 3300006048 | Ga0075363_100072347 | Ga0075363_1000723473 | 244 |
| 257 | 3300006186 | Ga0075369_10014386 | Ga0075369_100143862 | 244 |
| 258 | 3300014968 | Ga0157379_10243909 | Ga0157379_102439092 | 244 |
| 259 | 3300026088 | Ga0207641_10644410 | Ga0207641_106444102 | 244 |
| 260 | 3300028380 | Ga0268265_10583115 | Ga0268265_105831151 | 244 |
| 261 | 3300028381 | Ga0268264_10641211 | Ga0268264_106412112 | 244 |
| 262 | 3300030734 | Ga0316179_1019061 | Ga0316179_10190612 | 244 |
| 263 | 3300030742 | Ga0316183_1128149 | Ga0316183_11281492 | 244 |
| 264 | 3300030744 | Ga0316181_1134026 | Ga0316181_11340263 | 244 |
| 265 | 3300030745 | Ga0316182_1365804 | Ga0316182_13658041 | 244 |
| 266 | 3300031548 | Ga0307408_100252878 | Ga0307408_1002528781 | 244 |
| 267 | 3300031911 | Ga0307412_10005923 | Ga0307412_100059233 | 244 |
| 268 | 3300037418 | Ga0395900_0066916 | Ga0395900_0066916_2841_3599 | 244 |
| 269 | 3300037471 | Ga0395905_0086403 | Ga0395905_0086403_364_1122 | 244 |
| 270 | 3300038443 | Ga0395901_0070453 | Ga0395901_0070453_2634_3392 | 244 |
| 271 | 3300049663 | Ga0501223_021719 | Ga0501223_021719_91_879 | 244 |
| 272 | 3300050489 | nmdc:mga03683_31153_c1 | nmdc:mga03683_31153_c1_198_992 | 244 |
| 273 | 3300050489 | nmdc:mga03683_7996_c1 | nmdc:mga03683_7996_c1_864_1619 | 244 |
| 274 | 3300053139 | Ga0500568_0008442 | Ga0500568_0008442_2857_3708 | 244 |
| 275 | 3300005548 | Ga0070665_100027314 | Ga0070665_1000273146 | 245 |
| 276 | 3300005563 | Ga0068855_100055019 | Ga0068855_1000550191 | 245 |
| 277 | 3300005577 | Ga0068857_100413942 | Ga0068857_1004139422 | 245 |
| 278 | 3300006058 | Ga0075432_10017697 | Ga0075432_100176973 | 245 |
| 279 | 3300007076 | Ga0075435_100110885 | Ga0075435_1001108852 | 245 |
| 280 | 3300009093 | Ga0105240_10039722 | Ga0105240_100397227 | 245 |
| 281 | 3300009093 | Ga0105240_10048411 | Ga0105240_100484116 | 245 |
| 282 | 3300025913 | Ga0207695_10125579 | Ga0207695_101255793 | 245 |
| 283 | 3300025949 | Ga0207667_10119750 | Ga0207667_101197502 | 245 |
| 284 | 3300026116 | Ga0207674_10356524 | Ga0207674_103565241 | 245 |
| 285 | 3300031251 | Ga0265327_10000841 | Ga0265327_1000084110 | 245 |
| 286 | 3300031731 | Ga0307405_10033160 | Ga0307405_100331605 | 245 |
| 287 | 3300031824 | Ga0307413_10202749 | Ga0307413_102027492 | 245 |
| 288 | 3300031995 | Ga0307409_100000680 | Ga0307409_10000068013 | 245 |
| 289 | 3300032002 | Ga0307416_100001182 | Ga0307416_10000118211 | 245 |
| 290 | 3300032004 | Ga0307414_10069798 | Ga0307414_100697983 | 245 |
| 291 | 3300032126 | Ga0307415_100003784 | Ga0307415_10000378410 | 245 |
| 292 | 3300042004 | Ga0439445_0056153 | Ga0439445_0056153_225_1007 | 245 |
| 293 | 3300042531 | Ga0450918_000414 | Ga0450918_000414_6177_6917 | 245 |
| 294 | 3300048924 | Ga0496121_0008905 | Ga0496121_0008905_2796_3587 | 245 |
| 295 | 3300050492 | nmdc:mga0yw44_478019_c1 | nmdc:mga0yw44_478019_c1_28_780 | 245 |
| 296 | 3300050513 | nmdc:mga0rr50_95526_c1 | nmdc:mga0rr50_95526_c1_677_1441 | 245 |
| 297 | 3300053096 | Ga0500641_0008683 | Ga0500641_0008683_2464_3237 | 245 |
| 298 | iso_pu_bacteria | 2643221683 | 2644468701 | 245 |
| 299 | 3300005563 | Ga0068855_100202244 | Ga0068855_1002022442 | 246 |
| 300 | 3300009098 | Ga0105245_10504539 | Ga0105245_105045392 | 246 |
| 301 | 3300014969 | Ga0157376_10000023 | Ga0157376_10000023161 | 246 |
| 302 | 3300025291 | Ga0209675_1027953 | Ga0209675_10279532 | 246 |
| 303 | 3300025918 | Ga0207662_10036678 | Ga0207662_100366782 | 246 |
| 304 | 3300041413 | Ga0439465_0000084 | Ga0439465_0000084_7104_7901 | 246 |
| 305 | 3300042007 | Ga0439449_0000268 | Ga0439449_0000268_9497_10294 | 246 |
| 306 | 3300048917 | Ga0496114_0006538 | Ga0496114_0006538_443_1315 | 246 |
| 307 | iso_pu_bacteria | 2738541280 | 2738742656 | 246 |
| 308 | iso_pu_bacteria | 2738541300 | 2738846566 | 246 |
| 309 | iso_pu_bacteria | 2738543018 | 2739277208 | 246 |
| 310 | iso_pu_bacteria | 2738543030 | 2739346232 | 246 |
| 311 | 3300003323 | rootH1_10154922 | rootH1_101549222 | 247 |
| 312 | 3300003792 | Ga0055540_1000015 | Ga0055540_1000015173 | 247 |
| 313 | 3300003794 | Ga0055531_10009441 | Ga0055531_100094414 | 247 |
| 314 | 3300005330 | Ga0070690_100279968 | Ga0070690_1002799681 | 247 |
| 315 | 3300005544 | Ga0070686_100468523 | Ga0070686_1004685231 | 247 |
| 316 | 3300005617 | Ga0068859_100637578 | Ga0068859_1006375782 | 247 |
| 317 | 3300005937 | Ga0081455_10221551 | Ga0081455_102215512 | 247 |
| 318 | 3300006844 | Ga0075428_100084707 | Ga0075428_1000847074 | 247 |
| 319 | 3300006847 | Ga0075431_100005078 | Ga0075431_1000050781 | 247 |
| 320 | 3300006880 | Ga0075429_100002970 | Ga0075429_10000297011 | 247 |
| 321 | 3300006931 | Ga0097620_100637647 | Ga0097620_1006376472 | 247 |
| 322 | 3300009147 | Ga0114129_10007699 | Ga0114129_100076993 | 247 |
| 323 | 3300009174 | Ga0105241_10092724 | Ga0105241_100927243 | 247 |
| 324 | 3300009553 | Ga0105249_10554275 | Ga0105249_105542753 | 247 |
| 325 | 3300013104 | Ga0157370_10121753 | Ga0157370_101217532 | 247 |
| 326 | 3300025298 | Ga0209050_1000170 | Ga0209050_100017078 | 247 |
| 327 | 3300025298 | Ga0209050_1000529 | Ga0209050_100052945 | 247 |
| 328 | 3300025303 | Ga0209051_1000020 | Ga0209051_1000020418 | 247 |
| 329 | 3300025304 | Ga0209257_1000189 | Ga0209257_1000189152 | 247 |
| 330 | 3300031507 | Ga0307509_10109053 | Ga0307509_101090532 | 247 |
| 331 | 3300031616 | Ga0307508_10000549 | Ga0307508_1000054937 | 247 |
| 332 | 3300031649 | Ga0307514_10003783 | Ga0307514_1000378310 | 247 |
| 333 | 3300039438 | Ga0436360_0378379 | Ga0436360_0378379_2669_3457 | 247 |
| 334 | 3300039447 | Ga0436361_1117914 | Ga0436361_1117914_1570_2358 | 247 |
| 335 | 3300041491 | Ga0451833_1255216 | Ga0451833_1255216_90_863 | 247 |
| 336 | 3300046507 | Ga0495606_0007042 | Ga0495606_0007042_3248_3997 | 247 |
| 337 | 3300047472 | Ga0495686_0006678 | Ga0495686_0006678_1628_2398 | 247 |
| 338 | 3300049579 | Ga0501043_0169394 | Ga0501043_0169394_422_1174 | 247 |
| 339 | 3300050507 | nmdc:mga05p37_6901_c1 | nmdc:mga05p37_6901_c1_12068_12850 | 247 |
| 340 | 3300050508 | nmdc:mga09592_4077_c1 | nmdc:mga09592_4077_c1_538_1320 | 247 |
| 341 | 3300050510 | nmdc:mga06r32_220734_c1 | nmdc:mga06r32_220734_c1_380_1162 | 247 |
| 342 | 3300053120 | Ga0500597_197105 | Ga0500597_197105_17_766 | 247 |
| 343 | iso_pu_bacteria | 2738541277 | 2738720987 | 247 |
| 344 | iso_pu_bacteria | 2738543019 | 2739280186 | 247 |
| 345 | 3300002705 | JGI25156J39149_1000016 | JGI25156J39149_1000016129 | 248 |
| 346 | 3300002705 | JGI25156J39149_1000061 | JGI25156J39149_100006128 | 248 |
| 347 | 3300002741 | JGI25157J39369_1000035 | JGI25157J39369_10000359 | 248 |
| 348 | 3300002741 | JGI25157J39369_1000180 | JGI25157J39369_100018047 | 248 |
| 349 | 3300003752 | Ga0055539_1008631 | Ga0055539_10086312 | 248 |
| 350 | 3300005330 | Ga0070690_100069279 | Ga0070690_1000692793 | 248 |
| 351 | 3300005338 | Ga0068868_100184829 | Ga0068868_1001848292 | 248 |
| 352 | 3300005436 | Ga0070713_100230015 | Ga0070713_1002300153 | 248 |
| 353 | 3300005539 | Ga0068853_100059813 | Ga0068853_1000598132 | 248 |
| 354 | 3300005563 | Ga0068855_100040092 | Ga0068855_1000400923 | 248 |
| 355 | 3300005577 | Ga0068857_100155059 | Ga0068857_1001550591 | 248 |
| 356 | 3300005614 | Ga0068856_100135356 | Ga0068856_1001353562 | 248 |
| 357 | 3300005840 | Ga0068870_10303013 | Ga0068870_103030132 | 248 |
| 358 | 3300005937 | Ga0081455_10000211 | Ga0081455_1000021130 | 248 |
| 359 | 3300005937 | Ga0081455_10033603 | Ga0081455_100336032 | 248 |
| 360 | 3300005985 | Ga0081539_10012312 | Ga0081539_100123122 | 248 |
| 361 | 3300006042 | Ga0075368_10067240 | Ga0075368_100672402 | 248 |
| 362 | 3300006051 | Ga0075364_10099648 | Ga0075364_100996482 | 248 |
| 363 | 3300006195 | Ga0075366_10014177 | Ga0075366_100141777 | 248 |
| 364 | 3300006237 | Ga0097621_100504782 | Ga0097621_1005047822 | 248 |
| 365 | 3300009551 | Ga0105238_10059850 | Ga0105238_100598503 | 248 |
| 366 | 3300010375 | Ga0105239_10047798 | Ga0105239_100477985 | 248 |
| 367 | 3300013307 | Ga0157372_10099893 | Ga0157372_100998931 | 248 |
| 368 | 3300014497 | Ga0182008_10021087 | Ga0182008_100210872 | 248 |
| 369 | 3300015262 | Ga0182007_10003164 | Ga0182007_100031648 | 248 |
| 370 | 3300025246 | Ga0209646_1000056 | Ga0209646_1000056145 | 248 |
| 371 | 3300025250 | Ga0209026_1000009 | Ga0209026_1000009345 | 248 |
| 372 | 3300025253 | Ga0209677_100198 | Ga0209677_10019834 | 248 |
| 373 | 3300025256 | Ga0209759_1000035 | Ga0209759_1000035118 | 248 |
| 374 | 3300025908 | Ga0207643_10290194 | Ga0207643_102901941 | 248 |
| 375 | 3300025919 | Ga0207657_10174036 | Ga0207657_101740362 | 248 |
| 376 | 3300025924 | Ga0207694_10070372 | Ga0207694_100703723 | 248 |
| 377 | 3300025928 | Ga0207700_10097431 | Ga0207700_100974312 | 248 |
| 378 | 3300025949 | Ga0207667_10059920 | Ga0207667_100599202 | 248 |
| 379 | 3300025972 | Ga0207668_10138875 | Ga0207668_101388752 | 248 |
| 380 | 3300026041 | Ga0207639_10016455 | Ga0207639_100164555 | 248 |
| 381 | 3300026078 | Ga0207702_10007291 | Ga0207702_100072918 | 248 |
| 382 | 3300026116 | Ga0207674_10004183 | Ga0207674_1000418312 | 248 |
| 383 | 3300027866 | Ga0209813_10070936 | Ga0209813_100709361 | 248 |
| 384 | 3300028794 | Ga0307515_10000212 | Ga0307515_1000021252 | 248 |
| 385 | 3300028794 | Ga0307515_10006216 | Ga0307515_1000621618 | 248 |
| 386 | 3300037068 | Ga0373925_0070054 | Ga0373925_0070054_1284_2069 | 248 |
| 387 | 3300038443 | Ga0395901_0010155 | Ga0395901_0010155_7836_8606 | 248 |
| 388 | 3300042145 | Ga0450906_023736 | Ga0450906_023736_82_864 | 248 |
| 389 | 3300046471 | Ga0495650_0067401 | Ga0495650_0067401_400_1176 | 248 |
| 390 | 3300046539 | Ga0495621_0036563 | Ga0495621_0036563_674_1441 | 248 |
| 391 | 3300046660 | Ga0495625_0018461 | Ga0495625_0018461_3561_4319 | 248 |
| 392 | 3300048907 | Ga0496104_0027094 | Ga0496104_0027094_3226_3993 | 248 |
| 393 | 3300048917 | Ga0496114_0097975 | Ga0496114_0097975_248_1015 | 248 |
| 394 | 3300049766 | Ga0501269_000229 | Ga0501269_000229_11808_12566 | 248 |
| 395 | 3300050489 | nmdc:mga03683_126965_c1 | nmdc:mga03683_126965_c1_264_1040 | 248 |
| 396 | 3300050491 | nmdc:mga00v17_180286_c1 | nmdc:mga00v17_180286_c1_276_1031 | 248 |
| 397 | 3300050493 | nmdc:mga0k408_89021_c1 | nmdc:mga0k408_89021_c1_241_1017 | 248 |
| 398 | 3300050494 | nmdc:mga06z11_5710_c1 | nmdc:mga06z11_5710_c1_2049_2816 | 248 |
| 399 | 3300050495 | nmdc:mga04h51_48324_c1 | nmdc:mga04h51_48324_c1_20_796 | 248 |
| 400 | 3300050508 | nmdc:mga09592_159191_c1 | nmdc:mga09592_159191_c1_709_1512 | 248 |
| 401 | 3300050516 | nmdc:mga0sz30_2905_c1 | nmdc:mga0sz30_2905_c1_2177_2944 | 248 |
| 402 | 3300053739 | Ga0500587_002124 | Ga0500587_002124_1206_1997 | 248 |
| 403 | iso_pu_bacteria | 2643221645 | 2644255374 | 248 |
| 404 | iso_pu_bacteria | 2643221664 | 2644359898 | 248 |
| 405 | iso_pu_bacteria | 2842677519 | 2842680949 | 248 |
| 406 | iso_pu_bacteria | 2894023352 | 2894025053 | 248 |
| 407 | iso_pu_bacteria | 2919462493 | 2919466757 | 248 |
| 408 | 3300003752 | Ga0055539_1000124 | Ga0055539_100012444 | 249 |
| 409 | 3300003756 | Ga0055533_1000024 | Ga0055533_10000243 | 249 |
| 410 | 3300003759 | Ga0055525_1001151 | Ga0055525_10011515 | 249 |
| 411 | 3300003781 | Ga0055536_1002555 | Ga0055536_10025552 | 249 |
| 412 | 3300003792 | Ga0055540_1001156 | Ga0055540_10011565 | 249 |
| 413 | 3300005344 | Ga0070661_100001406 | Ga0070661_10000140612 | 249 |
| 414 | 3300005353 | Ga0070669_100306889 | Ga0070669_1003068891 | 249 |
| 415 | 3300005356 | Ga0070674_100008397 | Ga0070674_1000083976 | 249 |
| 416 | 3300005367 | Ga0070667_100423243 | Ga0070667_1004232431 | 249 |
| 417 | 3300005456 | Ga0070678_100321072 | Ga0070678_1003210721 | 249 |
| 418 | 3300005459 | Ga0068867_100000287 | Ga0068867_1000002876 | 249 |
| 419 | 3300005564 | Ga0070664_100005979 | Ga0070664_1000059792 | 249 |
| 420 | 3300005718 | Ga0068866_10001764 | Ga0068866_100017647 | 249 |
| 421 | 3300005719 | Ga0068861_100821686 | Ga0068861_1008216861 | 249 |
| 422 | 3300005842 | Ga0068858_100033996 | Ga0068858_1000339963 | 249 |
| 423 | 3300005843 | Ga0068860_100000444 | Ga0068860_10000044423 | 249 |
| 424 | 3300005844 | Ga0068862_100005619 | Ga0068862_1000056193 | 249 |
| 425 | 3300005844 | Ga0068862_100087278 | Ga0068862_1000872781 | 249 |
| 426 | 3300006881 | Ga0068865_100072113 | Ga0068865_1000721132 | 249 |
| 427 | 3300009148 | Ga0105243_10001557 | Ga0105243_1000155723 | 249 |
| 428 | 3300009148 | Ga0105243_10036123 | Ga0105243_100361236 | 249 |
| 429 | 3300009176 | Ga0105242_10631983 | Ga0105242_106319832 | 249 |
| 430 | 3300013306 | Ga0163162_10005859 | Ga0163162_100058596 | 249 |
| 431 | 3300013308 | Ga0157375_10042937 | Ga0157375_100429372 | 249 |
| 432 | 3300025226 | Ga0209674_100007 | Ga0209674_10000749 | 249 |
| 433 | 3300025230 | Ga0209563_100060 | Ga0209563_100060220 | 249 |
| 434 | 3300025253 | Ga0209677_100108 | Ga0209677_10010842 | 249 |
| 435 | 3300025292 | Ga0209676_1000785 | Ga0209676_100078518 | 249 |
| 436 | 3300025294 | Ga0209025_1002222 | Ga0209025_100222214 | 249 |
| 437 | 3300025303 | Ga0209051_1000398 | Ga0209051_100039818 | 249 |
| 438 | 3300025304 | Ga0209257_1009161 | Ga0209257_10091616 | 249 |
| 439 | 3300025899 | Ga0207642_10003806 | Ga0207642_100038066 | 249 |
| 440 | 3300025920 | Ga0207649_10023829 | Ga0207649_100238294 | 249 |
| 441 | 3300025923 | Ga0207681_10334874 | Ga0207681_103348742 | 249 |
| 442 | 3300025932 | Ga0207690_10095180 | Ga0207690_100951803 | 249 |
| 443 | 3300025935 | Ga0207709_10000295 | Ga0207709_1000029529 | 249 |
| 444 | 3300025935 | Ga0207709_10031111 | Ga0207709_100311112 | 249 |
| 445 | 3300025938 | Ga0207704_10004798 | Ga0207704_100047982 | 249 |
| 446 | 3300025942 | Ga0207689_10220933 | Ga0207689_102209332 | 249 |
| 447 | 3300025945 | Ga0207679_10000088 | Ga0207679_1000008852 | 249 |
| 448 | 3300025945 | Ga0207679_10000265 | Ga0207679_1000026516 | 249 |
| 449 | 3300025986 | Ga0207658_10447202 | Ga0207658_104472021 | 249 |
| 450 | 3300026035 | Ga0207703_10052243 | Ga0207703_100522433 | 249 |
| 451 | 3300026089 | Ga0207648_10000283 | Ga0207648_1000028330 | 249 |
| 452 | 3300026118 | Ga0207675_100119096 | Ga0207675_1001190962 | 249 |
| 453 | 3300026118 | Ga0207675_101037710 | Ga0207675_1010377101 | 249 |
| 454 | 3300028380 | Ga0268265_10051884 | Ga0268265_100518843 | 249 |
| 455 | 3300028381 | Ga0268264_10008357 | Ga0268264_100083579 | 249 |
| 456 | 3300028666 | Ga0265336_10000022 | Ga0265336_10000022167 | 249 |
| 457 | 3300031548 | Ga0307408_100044597 | Ga0307408_1000445973 | 249 |
| 458 | 3300031731 | Ga0307405_10023689 | Ga0307405_100236893 | 249 |
| 459 | 3300032002 | Ga0307416_100618044 | Ga0307416_1006180441 | 249 |
| 460 | 3300044658 | Ga0466972_0001578 | Ga0466972_0001578_6453_7220 | 249 |
| 461 | 3300046506 | Ga0495583_0000793 | Ga0495583_0000793_30871_31644 | 249 |
| 462 | 3300046507 | Ga0495606_0005138 | Ga0495606_0005138_8288_9061 | 249 |
| 463 | 3300046507 | Ga0495606_0155394 | Ga0495606_0155394_379_1158 | 249 |
| 464 | 3300046660 | Ga0495625_0114367 | Ga0495625_0114367_299_1072 | 249 |
| 465 | 3300046694 | Ga0495649_0004901 | Ga0495649_0004901_456_1229 | 249 |
| 466 | 3300046794 | Ga0495589_0008420 | Ga0495589_0008420_758_1531 | 249 |
| 467 | iso_pu_bacteria | 2643221559 | 2643816855 | 249 |
| 468 | iso_pu_bacteria | 2643221586 | 2643939275 | 249 |
| 469 | iso_pu_bacteria | 2643221593 | 2643976020 | 249 |
| 470 | iso_pu_bacteria | 2643221612 | 2644077951 | 249 |
| 471 | iso_pu_bacteria | 2643221727 | 2644696252 | 249 |
| 472 | iso_pu_bacteria | 2738541307 | 2738880979 | 249 |
| 473 | 3300003316 | rootH1_10001573 | rootH1_100015732 | 250 |
| 474 | 3300003322 | rootL2_10049763 | rootL2_100497634 | 250 |
| 475 | 3300003761 | Ga0055535_1000183 | Ga0055535_100018310 | 250 |
| 476 | 3300003761 | Ga0055535_1000393 | Ga0055535_10003933 | 250 |
| 477 | 3300003761 | Ga0055535_1006549 | Ga0055535_10065492 | 250 |
| 478 | 3300003763 | Ga0055529_1000064 | Ga0055529_100006463 | 250 |
| 479 | 3300003763 | Ga0055529_1002064 | Ga0055529_10020645 | 250 |
| 480 | 3300005288 | Ga0065714_10012400 | Ga0065714_100124003 | 250 |
| 481 | 3300005339 | Ga0070660_100374063 | Ga0070660_1003740631 | 250 |
| 482 | 3300005344 | Ga0070661_100292933 | Ga0070661_1002929332 | 250 |
| 483 | 3300005355 | Ga0070671_100014483 | Ga0070671_1000144833 | 250 |
| 484 | 3300005618 | Ga0068864_100083709 | Ga0068864_1000837092 | 250 |
| 485 | 3300005841 | Ga0068863_100120711 | Ga0068863_1001207112 | 250 |
| 486 | 3300006177 | Ga0075362_10075928 | Ga0075362_100759282 | 250 |
| 487 | 3300006353 | Ga0075370_10049998 | Ga0075370_100499982 | 250 |
| 488 | 3300006880 | Ga0075429_100006854 | Ga0075429_1000068543 | 250 |
| 489 | 3300006881 | Ga0068865_100537199 | Ga0068865_1005371991 | 250 |
| 490 | 3300009093 | Ga0105240_10003444 | Ga0105240_1000344411 | 250 |
| 491 | 3300009176 | Ga0105242_10006406 | Ga0105242_100064068 | 250 |
| 492 | 3300009177 | Ga0105248_10001750 | Ga0105248_1000175017 | 250 |
| 493 | 3300025228 | Ga0209672_103582 | Ga0209672_1035823 | 250 |
| 494 | 3300025242 | Ga0209258_100124 | Ga0209258_100124116 | 250 |
| 495 | 3300025242 | Ga0209258_100415 | Ga0209258_10041521 | 250 |
| 496 | 3300025256 | Ga0209759_1001942 | Ga0209759_100194210 | 250 |
| 497 | 3300025272 | Ga0209455_1000114 | Ga0209455_100011463 | 250 |
| 498 | 3300025272 | Ga0209455_1000337 | Ga0209455_100033742 | 250 |
| 499 | 3300025728 | Ga0207655_1003754 | Ga0207655_10037546 | 250 |
| 500 | 3300025913 | Ga0207695_10001146 | Ga0207695_1000114610 | 250 |
| 501 | 3300025931 | Ga0207644_10031872 | Ga0207644_100318723 | 250 |
| 502 | 3300025940 | Ga0207691_10113200 | Ga0207691_101132002 | 250 |
| 503 | 3300026088 | Ga0207641_10108254 | Ga0207641_101082542 | 250 |
| 504 | 3300026089 | Ga0207648_10185179 | Ga0207648_101851793 | 250 |
| 505 | 3300028786 | Ga0307517_10100690 | Ga0307517_101006901 | 250 |
| 506 | 3300030521 | Ga0307511_10138468 | Ga0307511_101384682 | 250 |
| 507 | 3300031730 | Ga0307516_10001203 | Ga0307516_100012033 | 250 |
| 508 | 3300031901 | Ga0307406_10036690 | Ga0307406_100366903 | 250 |
| 509 | 3300039447 | Ga0436361_1173055 | Ga0436361_1173055_2308_3081 | 250 |
| 510 | 3300046453 | Ga0495627_006828 | Ga0495627_006828_2114_2896 | 250 |
| 511 | 3300046475 | Ga0495639_0002546 | Ga0495639_0002546_6701_7483 | 250 |
| 512 | 3300046491 | Ga0495584_0003469 | Ga0495584_0003469_5356_6126 | 250 |
| 513 | 3300046492 | Ga0495585_0053252 | Ga0495585_0053252_95_874 | 250 |
| 514 | 3300046515 | Ga0495620_0137700 | Ga0495620_0137700_35_817 | 250 |
| 515 | 3300046520 | Ga0495637_0000370 | Ga0495637_0000370_26202_26972 | 250 |
| 516 | 3300046520 | Ga0495637_0001189 | Ga0495637_0001189_3721_4503 | 250 |
| 517 | 3300046530 | Ga0495654_0062108 | Ga0495654_0062108_729_1529 | 250 |
| 518 | 3300046530 | Ga0495654_0077578 | Ga0495654_0077578_118_888 | 250 |
| 519 | 3300046539 | Ga0495621_0037761 | Ga0495621_0037761_756_1526 | 250 |
| 520 | 3300046660 | Ga0495625_0193880 | Ga0495625_0193880_222_1004 | 250 |
| 521 | 3300046674 | Ga0495588_0043306 | Ga0495588_0043306_326_1108 | 250 |
| 522 | 3300046691 | Ga0495670_0027741 | Ga0495670_0027741_926_1708 | 250 |
| 523 | 3300047469 | Ga0495673_0088134 | Ga0495673_0088134_169_939 | 250 |
| 524 | 3300048907 | Ga0496104_0025417 | Ga0496104_0025417_205_993 | 250 |
| 525 | 3300048909 | Ga0496106_0321985 | Ga0496106_0321985_128_898 | 250 |
| 526 | 3300048911 | Ga0496108_0056426 | Ga0496108_0056426_1036_1824 | 250 |
| 527 | 3300048912 | Ga0496109_0061608 | Ga0496109_0061608_309_1079 | 250 |
| 528 | 3300048912 | Ga0496109_0245079 | Ga0496109_0245079_473_1261 | 250 |
| 529 | 3300048913 | Ga0496110_0052425 | Ga0496110_0052425_2569_3339 | 250 |
| 530 | 3300048917 | Ga0496114_0518415 | Ga0496114_0518415_137_907 | 250 |
| 531 | 3300048925 | Ga0496122_0199841 | Ga0496122_0199841_30_812 | 250 |
| 532 | 3300049459 | Ga0495678_000302 | Ga0495678_000302_38673_39443 | 250 |
| 533 | 3300049579 | Ga0501043_0254805 | Ga0501043_0254805_276_1103 | 250 |
| 534 | 3300049822 | Ga0501035_0020829 | Ga0501035_0020829_2095_2922 | 250 |
| 535 | 3300050492 | nmdc:mga0yw44_28476_c1 | nmdc:mga0yw44_28476_c1_2152_2964 | 250 |
| 536 | 3300053079 | Ga0500610_0001037 | Ga0500610_0001037_7463_8245 | 250 |
| 537 | 3300053079 | Ga0500610_0021069 | Ga0500610_0021069_1652_2434 | 250 |
| 538 | 3300053088 | Ga0500644_0001451 | Ga0500644_0001451_4169_4948 | 250 |
| 539 | 3300053096 | Ga0500641_0119735 | Ga0500641_0119735_65_847 | 250 |
| 540 | 3300053108 | Ga0500562_001416 | Ga0500562_001416_3412_4203 | 250 |
| 541 | 3300053117 | Ga0500593_001175 | Ga0500593_001175_951_1733 | 250 |
| 542 | 3300053121 | Ga0500607_000368 | Ga0500607_000368_1361_2146 | 250 |
| 543 | 3300053158 | Ga0500627_0017867 | Ga0500627_0017867_1032_1814 | 250 |
| 544 | 3300053177 | Ga0500636_0153269 | Ga0500636_0153269_390_1166 | 250 |
| 545 | iso_pu_bacteria | 2585428062 | 2587754043 | 250 |
| 546 | iso_pu_bacteria | 2643221573 | 2643880333 | 250 |
| 547 | iso_pu_bacteria | 2643221581 | 2643915481 | 250 |
| 548 | iso_pu_bacteria | 2643221592 | 2643970832 | 250 |
| 549 | iso_pu_bacteria | 2643221625 | 2644138895 | 250 |
| 550 | iso_pu_bacteria | 2643221628 | 2644159153 | 250 |
| 551 | iso_pu_bacteria | 2643221648 | 2644273874 | 250 |
| 552 | iso_pu_bacteria | 2643221728 | 2644698992 | 250 |
| 553 | iso_pu_bacteria | 2894414249 | 2894417004 | 250 |
| 554 | iso_pu_bacteria | 2904449895 | 2904453405 | 250 |
| 555 | iso_pu_bacteria | 2904456579 | 2904459376 | 250 |
| 556 | iso_pu_bacteria | 2923516293 | 2923518992 | 250 |
| 557 | iso_pu_bacteria | 2929520902 | 2929523138 | 250 |
| 558 | iso_pu_bacteria | 2945909444 | 2945910479 | 250 |
| 559 | iso_pu_bacteria | 2945945610 | 2945948485 | 250 |
| 560 | iso_pu_bacteria | 2945972063 | 2945972174 | 250 |
| 561 | iso_pu_bacteria | 2945984333 | 2945987465 | 250 |
| 562 | 3300003578 | Ga0006562J51391_1111735 | Ga0006562J51391_11117352 | 251 |
| 563 | 3300003771 | Ga0055526_1032910 | Ga0055526_10329102 | 251 |
| 564 | 3300003775 | Ga0055524_1002702 | Ga0055524_10027024 | 251 |
| 565 | 3300003775 | Ga0055524_1002878 | Ga0055524_10028787 | 251 |
| 566 | 3300003781 | Ga0055536_1011792 | Ga0055536_10117924 | 251 |
| 567 | 3300003784 | Ga0055534_1024889 | Ga0055534_10248891 | 251 |
| 568 | 3300003791 | Ga0055530_10005109 | Ga0055530_100051096 | 251 |
| 569 | 3300003794 | Ga0055531_10031543 | Ga0055531_100315432 | 251 |
| 570 | 3300005288 | Ga0065714_10135375 | Ga0065714_101353751 | 251 |
| 571 | 3300005353 | Ga0070669_100238623 | Ga0070669_1002386232 | 251 |
| 572 | 3300005455 | Ga0070663_100307632 | Ga0070663_1003076321 | 251 |
| 573 | 3300005457 | Ga0070662_100007583 | Ga0070662_1000075838 | 251 |
| 574 | 3300005578 | Ga0068854_100018452 | Ga0068854_1000184526 | 251 |
| 575 | 3300005844 | Ga0068862_100007521 | Ga0068862_1000075213 | 251 |
| 576 | 3300006186 | Ga0075369_10142855 | Ga0075369_101428551 | 251 |
| 577 | 3300006881 | Ga0068865_100177807 | Ga0068865_1001778072 | 251 |
| 578 | 3300013100 | Ga0157373_10036351 | Ga0157373_100363513 | 251 |
| 579 | 3300013306 | Ga0163162_10244309 | Ga0163162_102443092 | 251 |
| 580 | 3300014497 | Ga0182008_10000711 | Ga0182008_100007117 | 251 |
| 581 | 3300015261 | Ga0182006_1000964 | Ga0182006_100096416 | 251 |
| 582 | 3300025273 | Ga0209673_1006170 | Ga0209673_10061706 | 251 |
| 583 | 3300025292 | Ga0209676_1003468 | Ga0209676_10034687 | 251 |
| 584 | 3300025295 | Ga0209564_1004349 | Ga0209564_10043492 | 251 |
| 585 | 3300025298 | Ga0209050_1000528 | Ga0209050_10005288 | 251 |
| 586 | 3300025299 | Ga0209256_1000980 | Ga0209256_10009802 | 251 |
| 587 | 3300025303 | Ga0209051_1016226 | Ga0209051_10162263 | 251 |
| 588 | 3300025304 | Ga0209257_1000727 | Ga0209257_100072749 | 251 |
| 589 | 3300025304 | Ga0209257_1004132 | Ga0209257_10041323 | 251 |
| 590 | 3300026089 | Ga0207648_10169073 | Ga0207648_101690732 | 251 |
| 591 | 3300028380 | Ga0268265_10017636 | Ga0268265_100176362 | 251 |
| 592 | 3300031730 | Ga0307516_10000926 | Ga0307516_1000092613 | 251 |
| 593 | 3300049705 | Ga0501225_0035994 | Ga0501225_0035994_265_1053 | 251 |
| 594 | iso_pu_bacteria | 2738543012 | 2739245075 | 251 |
| 595 | 3300003187 | JGI25151J46595_10001011 | JGI25151J46595_1000101118 | 252 |
| 596 | 3300005435 | Ga0070714_100675924 | Ga0070714_1006759242 | 252 |
| 597 | 3300005719 | Ga0068861_100022190 | Ga0068861_1000221902 | 252 |
| 598 | 3300005843 | Ga0068860_100181705 | Ga0068860_1001817052 | 252 |
| 599 | 3300006195 | Ga0075366_10022500 | Ga0075366_100225003 | 252 |
| 600 | 3300009148 | Ga0105243_10001974 | Ga0105243_100019745 | 252 |
| 601 | 3300009176 | Ga0105242_10004095 | Ga0105242_100040952 | 252 |
| 602 | 3300009177 | Ga0105248_10209272 | Ga0105248_102092723 | 252 |
| 603 | 3300014326 | Ga0157380_10195170 | Ga0157380_101951702 | 252 |
| 604 | 3300025245 | Ga0207425_1008473 | Ga0207425_10084733 | 252 |
| 605 | 3300025258 | Ga0209129_1003835 | Ga0209129_10038353 | 252 |
| 606 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005244 | 252 |
| 607 | 3300025294 | Ga0209025_1001450 | Ga0209025_100145024 | 252 |
| 608 | 3300025297 | Ga0209758_1024888 | Ga0209758_10248882 | 252 |
| 609 | 3300025929 | Ga0207664_10461960 | Ga0207664_104619602 | 252 |
| 610 | 3300025935 | Ga0207709_10006321 | Ga0207709_100063218 | 252 |
| 611 | 3300025935 | Ga0207709_10054605 | Ga0207709_100546052 | 252 |
| 612 | 3300025937 | Ga0207669_10030757 | Ga0207669_100307572 | 252 |
| 613 | 3300025941 | Ga0207711_10218808 | Ga0207711_102188082 | 252 |
| 614 | 3300026035 | Ga0207703_10010771 | Ga0207703_100107713 | 252 |
| 615 | 3300026075 | Ga0207708_10000659 | Ga0207708_100006592 | 252 |
| 616 | 3300026089 | Ga0207648_10000741 | Ga0207648_100007417 | 252 |
| 617 | 3300026118 | Ga0207675_100000946 | Ga0207675_10000094625 | 252 |
| 618 | 3300031548 | Ga0307408_100029462 | Ga0307408_1000294622 | 252 |
| 619 | 3300042006 | Ga0439432_074696 | Ga0439432_074696_124_912 | 252 |
| 620 | 3300049579 | Ga0501043_0000101 | Ga0501043_0000101_36331_37116 | 252 |
| 621 | 3300049580 | Ga0501046_0000135 | Ga0501046_0000135_41848_42633 | 252 |
| 622 | 3300049581 | Ga0501047_0000173 | Ga0501047_0000173_36438_37223 | 252 |
| 623 | 3300049582 | Ga0501048_0000452 | Ga0501048_0000452_8277_9062 | 252 |
| 624 | 3300049824 | Ga0501045_0002898 | Ga0501045_0002898_1488_2273 | 252 |
| 625 | 3300050489 | nmdc:mga03683_8539_c1 | nmdc:mga03683_8539_c1_21_818 | 252 |
| 626 | 3300050493 | nmdc:mga0k408_34040_c1 | nmdc:mga0k408_34040_c1_1655_2440 | 252 |
| 627 | 3300050494 | nmdc:mga06z11_297568_c1 | nmdc:mga06z11_297568_c1_141_926 | 252 |
| 628 | 3300053129 | Ga0500628_002085 | Ga0500628_002085_1608_2471 | 252 |
| 629 | iso_pu_bacteria | 2643221609 | 2644061923 | 252 |
| 630 | iso_pu_bacteria | 2643221611 | 2644071569 | 252 |
| 631 | iso_pu_bacteria | 2816332133 | 2816474568 | 252 |
| 632 | 3300003773 | Ga0055537_1000010 | Ga0055537_1000010101 | 253 |
| 633 | 3300003784 | Ga0055534_1000015 | Ga0055534_100001529 | 253 |
| 634 | 3300003790 | Ga0055528_1027352 | Ga0055528_10273522 | 253 |
| 635 | 3300005289 | Ga0065704_10190037 | Ga0065704_101900372 | 253 |
| 636 | 3300005328 | Ga0070676_10059644 | Ga0070676_100596441 | 253 |
| 637 | 3300005331 | Ga0070670_100015017 | Ga0070670_1000150177 | 253 |
| 638 | 3300005333 | Ga0070677_10001118 | Ga0070677_100011189 | 253 |
| 639 | 3300005335 | Ga0070666_10246187 | Ga0070666_102461871 | 253 |
| 640 | 3300005353 | Ga0070669_100001153 | Ga0070669_1000011535 | 253 |
| 641 | 3300005354 | Ga0070675_100000219 | Ga0070675_10000021935 | 253 |
| 642 | 3300005355 | Ga0070671_100073955 | Ga0070671_1000739554 | 253 |
| 643 | 3300005356 | Ga0070674_100030134 | Ga0070674_1000301344 | 253 |
| 644 | 3300005364 | Ga0070673_100016775 | Ga0070673_1000167752 | 253 |
| 645 | 3300005456 | Ga0070678_100082305 | Ga0070678_1000823052 | 253 |
| 646 | 3300005459 | Ga0068867_100000257 | Ga0068867_1000002574 | 253 |
| 647 | 3300005543 | Ga0070672_100024889 | Ga0070672_1000248894 | 253 |
| 648 | 3300005618 | Ga0068864_100031303 | Ga0068864_1000313032 | 253 |
| 649 | 3300005618 | Ga0068864_100471248 | Ga0068864_1004712482 | 253 |
| 650 | 3300005834 | Ga0068851_10256556 | Ga0068851_102565561 | 253 |
| 651 | 3300006038 | Ga0075365_10059553 | Ga0075365_100595532 | 253 |
| 652 | 3300006051 | Ga0075364_10034721 | Ga0075364_100347212 | 253 |
| 653 | 3300006051 | Ga0075364_10057960 | Ga0075364_100579603 | 253 |
| 654 | 3300006237 | Ga0097621_100010684 | Ga0097621_1000106844 | 253 |
| 655 | 3300006237 | Ga0097621_100439109 | Ga0097621_1004391092 | 253 |
| 656 | 3300006353 | Ga0075370_10029763 | Ga0075370_100297633 | 253 |
| 657 | 3300006358 | Ga0068871_100026498 | Ga0068871_1000264981 | 253 |
| 658 | 3300009551 | Ga0105238_10009551 | Ga0105238_100095515 | 253 |
| 659 | 3300013306 | Ga0163162_10075011 | Ga0163162_100750112 | 253 |
| 660 | 3300013308 | Ga0157375_10144787 | Ga0157375_101447872 | 253 |
| 661 | 3300017792 | Ga0163161_10065478 | Ga0163161_100654783 | 253 |
| 662 | 3300025245 | Ga0207425_1034144 | Ga0207425_10341442 | 253 |
| 663 | 3300025263 | Ga0209565_1000025 | Ga0209565_1000025165 | 253 |
| 664 | 3300025263 | Ga0209565_1010809 | Ga0209565_10108093 | 253 |
| 665 | 3300025273 | Ga0209673_1000077 | Ga0209673_1000077210 | 253 |
| 666 | 3300025273 | Ga0209673_1001615 | Ga0209673_100161519 | 253 |
| 667 | 3300025291 | Ga0209675_1000017 | Ga0209675_1000017209 | 253 |
| 668 | 3300025294 | Ga0209025_1035923 | Ga0209025_10359231 | 253 |
| 669 | 3300025315 | Ga0207697_10155989 | Ga0207697_101559891 | 253 |
| 670 | 3300025893 | Ga0207682_10000318 | Ga0207682_1000031819 | 253 |
| 671 | 3300025903 | Ga0207680_10115550 | Ga0207680_101155503 | 253 |
| 672 | 3300025923 | Ga0207681_10001999 | Ga0207681_1000199910 | 253 |
| 673 | 3300025924 | Ga0207694_10014155 | Ga0207694_100141555 | 253 |
| 674 | 3300025925 | Ga0207650_10000435 | Ga0207650_100004355 | 253 |
| 675 | 3300025926 | Ga0207659_10000301 | Ga0207659_1000030113 | 253 |
| 676 | 3300025931 | Ga0207644_10037348 | Ga0207644_100373483 | 253 |
| 677 | 3300025937 | Ga0207669_10000291 | Ga0207669_100002914 | 253 |
| 678 | 3300025940 | Ga0207691_10000148 | Ga0207691_1000014842 | 253 |
| 679 | 3300025960 | Ga0207651_10093246 | Ga0207651_100932463 | 253 |
| 680 | 3300025986 | Ga0207658_10211584 | Ga0207658_102115841 | 253 |
| 681 | 3300026041 | Ga0207639_10353577 | Ga0207639_103535772 | 253 |
| 682 | 3300026089 | Ga0207648_10001569 | Ga0207648_100015699 | 253 |
| 683 | 3300026095 | Ga0207676_10005361 | Ga0207676_100053618 | 253 |
| 684 | 3300026095 | Ga0207676_10703245 | Ga0207676_107032451 | 253 |
| 685 | 3300026121 | Ga0207683_10027159 | Ga0207683_100271597 | 253 |
| 686 | 3300028794 | Ga0307515_10002672 | Ga0307515_1000267215 | 253 |
| 687 | 3300028794 | Ga0307515_10003631 | Ga0307515_1000363125 | 253 |
| 688 | 3300030733 | Ga0314311_1170870 | Ga0314311_11708702 | 253 |
| 689 | 3300031548 | Ga0307408_100087023 | Ga0307408_1000870233 | 253 |
| 690 | 3300031649 | Ga0307514_10230827 | Ga0307514_102308272 | 253 |
| 691 | 3300031730 | Ga0307516_10005479 | Ga0307516_100054793 | 253 |
| 692 | 3300031730 | Ga0307516_10009294 | Ga0307516_100092949 | 253 |
| 693 | 3300031731 | Ga0307405_10059202 | Ga0307405_100592023 | 253 |
| 694 | 3300031901 | Ga0307406_10000356 | Ga0307406_100003569 | 253 |
| 695 | 3300031901 | Ga0307406_10000418 | Ga0307406_1000041814 | 253 |
| 696 | 3300032005 | Ga0307411_10151779 | Ga0307411_101517792 | 253 |
| 697 | 3300041413 | Ga0439465_0040571 | Ga0439465_0040571_564_1361 | 253 |
| 698 | 3300041452 | Ga0451793_1414310 | Ga0451793_1414310_130_921 | 253 |
| 699 | 3300041512 | Ga0451853_0547373 | Ga0451853_0547373_629_1420 | 253 |
| 700 | 3300042134 | Ga0450898_010536 | Ga0450898_010536_189_977 | 253 |
| 701 | 3300042147 | Ga0450910_013718 | Ga0450910_013718_353_1150 | 253 |
| 702 | 3300042184 | Ga0450908_006003 | Ga0450908_006003_611_1408 | 253 |
| 703 | 3300042435 | Ga0439434_0026513 | Ga0439434_0026513_19_816 | 253 |
| 704 | 3300042531 | Ga0450918_006895 | Ga0450918_006895_1029_1826 | 253 |
| 705 | 3300044683 | Ga0466965_0086719 | Ga0466965_0086719_505_1287 | 253 |
| 706 | 3300044719 | Ga0466971_0234295 | Ga0466971_0234295_74_856 | 253 |
| 707 | 3300044765 | Ga0466970_0075878 | Ga0466970_0075878_500_1282 | 253 |
| 708 | 3300044842 | Ga0466957_0074081 | Ga0466957_0074081_348_1133 | 253 |
| 709 | 3300046525 | Ga0495663_0044485 | Ga0495663_0044485_330_1121 | 253 |
| 710 | 3300046615 | Ga0495656_0001230 | Ga0495656_0001230_1432_2223 | 253 |
| 711 | 3300046660 | Ga0495625_0000638 | Ga0495625_0000638_18702_19499 | 253 |
| 712 | 3300046660 | Ga0495625_0024281 | Ga0495625_0024281_2216_3004 | 253 |
| 713 | 3300049743 | Ga0501081_0312261 | Ga0501081_0312261_195_983 | 253 |
| 714 | 3300050489 | nmdc:mga03683_54099_c1 | nmdc:mga03683_54099_c1_415_1212 | 253 |
| 715 | 3300050489 | nmdc:mga03683_6512_c1 | nmdc:mga03683_6512_c1_1776_2573 | 253 |
| 716 | 3300050490 | nmdc:mga03n38_7168_c1 | nmdc:mga03n38_7168_c1_2366_3163 | 253 |
| 717 | 3300050491 | nmdc:mga00v17_36229_c1 | nmdc:mga00v17_36229_c1_465_1262 | 253 |
| 718 | 3300050492 | nmdc:mga0yw44_13764_c1 | nmdc:mga0yw44_13764_c1_1684_2481 | 253 |
| 719 | 3300050493 | nmdc:mga0k408_22684_c1 | nmdc:mga0k408_22684_c1_1813_2610 | 253 |
| 720 | 3300053086 | Ga0500578_0001187 | Ga0500578_0001187_2118_2888 | 253 |
| 721 | 3300053122 | Ga0500608_009545 | Ga0500608_009545_1114_1908 | 253 |
| 722 | 3300053151 | Ga0500604_0005928 | Ga0500604_0005928_348_1118 | 253 |
| 723 | 3300061719 | Ga0466962_0012160 | Ga0466962_0012160_1577_2362 | 253 |
| 724 | 3300003781 | Ga0055536_1007581 | Ga0055536_10075814 | 254 |
| 725 | 3300005289 | Ga0065704_10071167 | Ga0065704_100711673 | 254 |
| 726 | 3300025292 | Ga0209676_1000034 | Ga0209676_100003480 | 254 |
| 727 | 3300031911 | Ga0307412_10413423 | Ga0307412_104134232 | 254 |
| 728 | 3300048920 | Ga0496117_0004897 | Ga0496117_0004897_10410_11240 | 254 |
| 729 | 3300049571 | Ga0501034_0000898 | Ga0501034_0000898_17919_18683 | 254 |
| 730 | 3300049741 | Ga0501079_0425576 | Ga0501079_0425576_105_935 | 255 |
| 731 | 3300050492 | nmdc:mga0yw44_147998_c1 | nmdc:mga0yw44_147998_c1_129_911 | 256 |
| 732 | 3300013104 | Ga0157370_10001585 | Ga0157370_1000158526 | 257 |
| 733 | 3300013308 | Ga0157375_10303401 | Ga0157375_103034012 | 257 |
| 734 | 3300015261 | Ga0182006_1092354 | Ga0182006_10923541 | 257 |
| 735 | 3300050508 | nmdc:mga09592_5902_c1 | nmdc:mga09592_5902_c1_5292_6098 | 257 |
| 736 | 3300050510 | nmdc:mga06r32_35242_c1 | nmdc:mga06r32_35242_c1_535_1341 | 257 |
| 737 | 3300037471 | Ga0395905_0001288 | Ga0395905_0001288_2095_2922 | 260 |
| 738 | 3300037471 | Ga0395905_0405666 | Ga0395905_0405666_219_1061 | 261 |
| 739 | 3300005288 | Ga0065714_10098198 | Ga0065714_100981982 | 262 |
| 740 | 3300006948 | Ga0099826_10062906 | Ga0099826_100629063 | 262 |
| 741 | 3300027666 | Ga0209282_1000229 | Ga0209282_10002293 | 262 |
| 742 | 3300046543 | Ga0495645_0343906 | Ga0495645_0343906_12_851 | 262 |
| 743 | 3300050489 | nmdc:mga03683_6403_c1 | nmdc:mga03683_6403_c1_914_1804 | 262 |
| 744 | 3300050508 | nmdc:mga09592_859_c1 | nmdc:mga09592_859_c1_6207_7025 | 262 |
| 745 | 3300050509 | nmdc:mga0qj67_4193_c1 | nmdc:mga0qj67_4193_c1_7600_8418 | 262 |
| 746 | 3300053154 | Ga0500619_000183 | Ga0500619_000183_4952_5842 | 264 |
| 747 | 3300005339 | Ga0070660_100115501 | Ga0070660_1001155012 | 265 |
| 748 | 3300050496 | nmdc:mga07m45_527_c1 | nmdc:mga07m45_527_c1_13460_14359 | 265 |
| 749 | 3300003790 | Ga0055528_1000377 | Ga0055528_10003778 | 268 |
| 750 | 2162886007 | SwRhRL2b_contig_2058914 | SwRhRL2b_0078.00006360 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bpf-assembly1.cif.gz_B | crystal structure of adp complexed d-alanine-d-alanine ligase(ddl) from yersinia pestis | 0.8151 | 193 | 215 |
| 5epf-assembly1.cif.gz_A | crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis | 0.764 | 61 | 222 |
| 2yjh-assembly1.cif.gz_A-2 | thiol peroxidase from yersinia psuedotuberculosis, inactive mutant c61s | 0.7538 | 68 | 216 |
| 3d3l-assembly1.cif.gz_A | the 2.6 a crystal structure of the lipoxygenase domain of human arachidonate 12-lipoxygenase, 12s-type | 0.7438 | 189 | 215 |
| 4xih-assembly1.cif.gz_B-2 | crystal structure of the r116a mutant ahpe from mycobacterium tuberculosis | 0.7339 | 61 | 218 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5d8dD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.8168 | 193 | 216 | 3.30.470.20 |
| 5bpfD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.7872 | 193 | 216 | 3.30.470.20 |
| af_P21264_187_380_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.7702 | 189 | 215 | 3.30.470.20 |
| af_Q9D1A0_27_140_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7682 | 69 | 156 | 3.40.30.10 |
| 5epfA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.7639 | 61 | 222 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6KS03-F1-model_v4 | DUF899 domain-containing protein | 0.986 | 40 | 254 |
|
| AF-A0A2V6G796-F1-model_v4 | DUF899 domain-containing protein | 0.9859 | 23 | 254 |
|
| AF-A0A538SV51-F1-model_v4 | DUF899 domain-containing protein | 0.9845 | 63 | 254 |
|
| AF-A0A2S6R5Q2-F1-model_v4 | Thioredoxin domain-containing protein | 0.9824 | 23 | 203 |
|
| AF-A0A2R8B491-F1-model_v4 | Thioredoxin domain-containing protein | 0.9822 | 25 | 255 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar