F478919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 747 | 392 | 747 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10353035|Ga0265325_103530351 |
| Length | 117 |
| Sequence | LGTSNQKPKPRNHPGVLSRMIRIVLPAHLRKLAHVDREVALEVAAPVTQCAVLDALEARYPMLCGTIRDHVTKRRRPYVRFFACEEDLSHEPPDTPLPDAVASGTEPFLIVGAMAGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 110 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 111 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 112 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 113 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 114 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 115 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 116 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 117 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 138 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 139 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 140 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 209 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 214 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 219 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 229 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 264 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 265 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 266 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 267 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 268 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 269 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 270 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 273 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 278 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 330 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 331 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 332 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 373 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.8 |
| Metatranscriptomes | 1.2 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.74 |
| Nodule | 0 |
| Rhizoplane | 3.75 |
| Rhizosphere | 93.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10075979 | 3300003203 | Bacteria | 1041 |
| 2 | JGI25407J50210_10027374 | 3300003373 | Bacteria | 1478 |
| 3 | Ga0058862_12018065 | 3300004803 | Bacteria | 556 |
| 4 | Ga0070658_11653618 | 3300005327 | Bacteria | 554 |
| 5 | Ga0070683_100047912 | 3300005329 | Bacteria | 3950 |
| 6 | Ga0070690_100337367 | 3300005330 | Bacteria | 1091 |
| 7 | Ga0070690_100532474 | 3300005330 | Bacteria | 883 |
| 8 | Ga0070690_100835381 | 3300005330 | Bacteria | 717 |
| 9 | Ga0070677_10650010 | 3300005333 | Bacteria | 589 |
| 10 | Ga0068869_100018892 | 3300005334 | Bacteria | 4699 |
| 11 | Ga0068869_100113757 | 3300005334 | Bacteria | 2062 |
| 12 | Ga0068869_100555449 | 3300005334 | Bacteria | 965 |
| 13 | Ga0070666_10078455 | 3300005335 | Bacteria | 2254 |
| 14 | Ga0070666_10399349 | 3300005335 | Bacteria | 988 |
| 15 | Ga0070666_10555314 | 3300005335 | Unclassified | 835 |
| 16 | Ga0070680_100068624 | 3300005336 | Bacteria | 2910 |
| 17 | Ga0070680_100407166 | 3300005336 | Bacteria | 1160 |
| 18 | Ga0070682_100423416 | 3300005337 | Bacteria | 1012 |
| 19 | Ga0068868_100057907 | 3300005338 | Bacteria | 3062 |
| 20 | Ga0068868_100595569 | 3300005338 | Bacteria | 979 |
| 21 | Ga0070660_100150544 | 3300005339 | Bacteria | 1870 |
| 22 | Ga0070660_100373963 | 3300005339 | Bacteria | 1176 |
| 23 | Ga0070689_100051129 | 3300005340 | Bacteria | 3194 |
| 24 | Ga0070689_100059453 | 3300005340 | Bacteria | 2971 |
| 25 | Ga0070689_100890077 | 3300005340 | Bacteria | 787 |
| 26 | Ga0070689_100969010 | 3300005340 | Bacteria | 755 |
| 27 | Ga0070691_10516839 | 3300005341 | Bacteria | 693 |
| 28 | Ga0070691_11075777 | 3300005341 | Bacteria | 506 |
| 29 | Ga0070687_100029280 | 3300005343 | Bacteria | 2679 |
| 30 | Ga0070687_101378880 | 3300005343 | Bacteria | 526 |
| 31 | Ga0070692_10033655 | 3300005345 | Bacteria | 2583 |
| 32 | Ga0070692_10584411 | 3300005345 | Bacteria | 737 |
| 33 | Ga0070668_100767351 | 3300005347 | Bacteria | 854 |
| 34 | Ga0070668_100881089 | 3300005347 | Bacteria | 799 |
| 35 | Ga0070669_100072401 | 3300005353 | Bacteria | 2551 |
| 36 | Ga0070669_101858442 | 3300005353 | Bacteria | 526 |
| 37 | Ga0070675_100812546 | 3300005354 | Bacteria | 855 |
| 38 | Ga0070671_101525621 | 3300005355 | Bacteria | 591 |
| 39 | Ga0070674_100015560 | 3300005356 | Bacteria | 4751 |
| 40 | Ga0070674_100435832 | 3300005356 | Bacteria | 1079 |
| 41 | Ga0070673_100087869 | 3300005364 | Bacteria | 2534 |
| 42 | Ga0070673_100297542 | 3300005364 | Bacteria | 1420 |
| 43 | Ga0070673_101003114 | 3300005364 | Unclassified | 777 |
| 44 | Ga0070673_101591364 | 3300005364 | Unclassified | 617 |
| 45 | Ga0070688_100043817 | 3300005365 | Bacteria | 2759 |
| 46 | Ga0070659_100067384 | 3300005366 | Bacteria | 2839 |
| 47 | Ga0070659_100420793 | 3300005366 | Bacteria | 1130 |
| 48 | Ga0070659_100971426 | 3300005366 | Bacteria | 745 |
| 49 | Ga0070659_101040552 | 3300005366 | Bacteria | 720 |
| 50 | Ga0070667_100062122 | 3300005367 | Bacteria | 3164 |
| 51 | Ga0070667_100770141 | 3300005367 | Bacteria | 893 |
| 52 | Ga0070667_101635510 | 3300005367 | Unclassified | 605 |
| 53 | Ga0070703_10280199 | 3300005406 | Bacteria | 688 |
| 54 | Ga0070709_10343032 | 3300005434 | Bacteria | 1102 |
| 55 | Ga0070709_10370451 | 3300005434 | Bacteria | 1062 |
| 56 | Ga0070714_100602137 | 3300005435 | Bacteria | 1055 |
| 57 | Ga0070713_100717188 | 3300005436 | Bacteria | 955 |
| 58 | Ga0070701_10259489 | 3300005438 | Bacteria | 1053 |
| 59 | Ga0070701_10322017 | 3300005438 | Bacteria | 957 |
| 60 | Ga0070705_100103125 | 3300005440 | Bacteria | 1806 |
| 61 | Ga0070700_100142337 | 3300005441 | Bacteria | 1631 |
| 62 | Ga0070700_100899397 | 3300005441 | Bacteria | 721 |
| 63 | Ga0070700_101078231 | 3300005441 | Bacteria | 665 |
| 64 | Ga0070694_100114193 | 3300005444 | Bacteria | 1928 |
| 65 | Ga0070694_100262806 | 3300005444 | Bacteria | 1310 |
| 66 | Ga0070694_101558899 | 3300005444 | Bacteria | 560 |
| 67 | Ga0070708_100034155 | 3300005445 | Bacteria | 4423 |
| 68 | Ga0070708_100234236 | 3300005445 | Bacteria | 1723 |
| 69 | Ga0070708_101917463 | 3300005445 | Bacteria | 549 |
| 70 | Ga0070663_100040086 | 3300005455 | Bacteria | 3277 |
| 71 | Ga0070663_101231440 | 3300005455 | Bacteria | 658 |
| 72 | Ga0070678_100168479 | 3300005456 | Bacteria | 1781 |
| 73 | Ga0070678_100202372 | 3300005456 | Bacteria | 1640 |
| 74 | Ga0070678_100432739 | 3300005456 | Bacteria | 1149 |
| 75 | Ga0070678_100930560 | 3300005456 | Bacteria | 796 |
| 76 | Ga0070678_100974825 | 3300005456 | Bacteria | 778 |
| 77 | Ga0070662_100720922 | 3300005457 | Bacteria | 844 |
| 78 | Ga0070681_10361376 | 3300005458 | Bacteria | 1362 |
| 79 | Ga0070681_10875172 | 3300005458 | Bacteria | 816 |
| 80 | Ga0068867_100108454 | 3300005459 | Bacteria | 2129 |
| 81 | Ga0068867_101046177 | 3300005459 | Bacteria | 742 |
| 82 | Ga0070685_10218033 | 3300005466 | Bacteria | 1249 |
| 83 | Ga0070706_100252468 | 3300005467 | Bacteria | 1646 |
| 84 | Ga0070706_100326300 | 3300005467 | Bacteria | 1431 |
| 85 | Ga0070707_100200634 | 3300005468 | Bacteria | 1944 |
| 86 | Ga0070707_100255373 | 3300005468 | Bacteria | 1706 |
| 87 | Ga0070707_100333729 | 3300005468 | Bacteria | 1473 |
| 88 | Ga0070707_101081871 | 3300005468 | Bacteria | 768 |
| 89 | Ga0070698_100076682 | 3300005471 | Bacteria | 3344 |
| 90 | Ga0070698_100096058 | 3300005471 | Bacteria | 2940 |
| 91 | Ga0070698_100586290 | 3300005471 | Bacteria | 1055 |
| 92 | Ga0070698_100913883 | 3300005471 | Bacteria | 823 |
| 93 | Ga0070698_101252050 | 3300005471 | Bacteria | 692 |
| 94 | Ga0070699_100000430 | 3300005518 | Bacteria | 40310 |
| 95 | Ga0070699_101493485 | 3300005518 | Bacteria | 620 |
| 96 | Ga0070679_100501595 | 3300005530 | Bacteria | 1158 |
| 97 | Ga0070684_100226725 | 3300005535 | Bacteria | 1705 |
| 98 | Ga0070684_100294699 | 3300005535 | Bacteria | 1488 |
| 99 | Ga0070697_100175009 | 3300005536 | Bacteria | 1818 |
| 100 | Ga0070697_100316271 | 3300005536 | Bacteria | 1344 |
| 101 | Ga0070697_100527028 | 3300005536 | Bacteria | 1035 |
| 102 | Ga0070697_101879045 | 3300005536 | Unclassified | 536 |
| 103 | Ga0070672_101582558 | 3300005543 | Bacteria | 588 |
| 104 | Ga0070686_100026390 | 3300005544 | Bacteria | 3506 |
| 105 | Ga0070686_100154777 | 3300005544 | Bacteria | 1609 |
| 106 | Ga0070686_101076133 | 3300005544 | Bacteria | 663 |
| 107 | Ga0070686_101376255 | 3300005544 | Unclassified | 591 |
| 108 | Ga0070695_100364242 | 3300005545 | Bacteria | 1086 |
| 109 | Ga0070695_100573694 | 3300005545 | Bacteria | 882 |
| 110 | Ga0070695_100729012 | 3300005545 | Bacteria | 789 |
| 111 | Ga0070696_100076940 | 3300005546 | Bacteria | 2357 |
| 112 | Ga0070696_100084323 | 3300005546 | Bacteria | 2254 |
| 113 | Ga0070693_100114322 | 3300005547 | Bacteria | 1665 |
| 114 | Ga0070693_100376107 | 3300005547 | Bacteria | 978 |
| 115 | Ga0070693_100678182 | 3300005547 | Bacteria | 752 |
| 116 | Ga0070665_100110862 | 3300005548 | Bacteria | 2746 |
| 117 | Ga0070665_100270778 | 3300005548 | Bacteria | 1700 |
| 118 | Ga0070665_100352147 | 3300005548 | Unclassified | 1478 |
| 119 | Ga0070665_101243394 | 3300005548 | Bacteria | 755 |
| 120 | Ga0070704_100434803 | 3300005549 | Bacteria | 1126 |
| 121 | Ga0068855_100294244 | 3300005563 | Bacteria | 1799 |
| 122 | Ga0070664_100580401 | 3300005564 | Bacteria | 1039 |
| 123 | Ga0070664_101232296 | 3300005564 | Bacteria | 706 |
| 124 | Ga0068857_100050616 | 3300005577 | Bacteria | 3684 |
| 125 | Ga0068857_100260412 | 3300005577 | Bacteria | 1592 |
| 126 | Ga0068854_100151760 | 3300005578 | Bacteria | 1787 |
| 127 | Ga0068854_101739402 | 3300005578 | Bacteria | 571 |
| 128 | Ga0070702_100019763 | 3300005615 | Bacteria | 3520 |
| 129 | Ga0070702_100050912 | 3300005615 | Bacteria | 2368 |
| 130 | Ga0070702_100248584 | 3300005615 | Bacteria | 1204 |
| 131 | Ga0070702_100518801 | 3300005615 | Unclassified | 878 |
| 132 | Ga0068852_100771446 | 3300005616 | Bacteria | 974 |
| 133 | Ga0068852_102074813 | 3300005616 | Bacteria | 590 |
| 134 | Ga0068859_100062593 | 3300005617 | Bacteria | 3751 |
| 135 | Ga0068859_100083297 | 3300005617 | Bacteria | 3241 |
| 136 | Ga0068864_100040791 | 3300005618 | Bacteria | 3969 |
| 137 | Ga0068864_100098562 | 3300005618 | Bacteria | 2589 |
| 138 | Ga0068864_101058101 | 3300005618 | Bacteria | 806 |
| 139 | Ga0068866_10046246 | 3300005718 | Bacteria | 2187 |
| 140 | Ga0068866_10311574 | 3300005718 | Unclassified | 987 |
| 141 | Ga0068861_100433729 | 3300005719 | Bacteria | 1173 |
| 142 | Ga0068861_101233154 | 3300005719 | Bacteria | 724 |
| 143 | Ga0068851_10537432 | 3300005834 | Bacteria | 705 |
| 144 | Ga0068870_10051373 | 3300005840 | Bacteria | 2182 |
| 145 | Ga0068863_100011064 | 3300005841 | Bacteria | 8751 |
| 146 | Ga0068863_100132718 | 3300005841 | Bacteria | 2378 |
| 147 | Ga0068863_100396373 | 3300005841 | Bacteria | 1349 |
| 148 | Ga0068858_100071919 | 3300005842 | Bacteria | 3208 |
| 149 | Ga0068858_100831434 | 3300005842 | Bacteria | 901 |
| 150 | Ga0068860_100105181 | 3300005843 | Bacteria | 2695 |
| 151 | Ga0068860_100264454 | 3300005843 | Bacteria | 1677 |
| 152 | Ga0068860_100930565 | 3300005843 | Bacteria | 886 |
| 153 | Ga0068862_100005233 | 3300005844 | Bacteria | 10886 |
| 154 | Ga0068862_100110044 | 3300005844 | Bacteria | 2417 |
| 155 | Ga0068862_100381382 | 3300005844 | Bacteria | 1315 |
| 156 | Ga0068862_101454712 | 3300005844 | Bacteria | 690 |
| 157 | Ga0081455_10044558 | 3300005937 | Bacteria | 3868 |
| 158 | Ga0081538_10006544 | 3300005981 | Bacteria | 10233 |
| 159 | Ga0081539_10071881 | 3300005985 | Bacteria | 1851 |
| 160 | Ga0075368_10015259 | 3300006042 | Bacteria | 2848 |
| 161 | Ga0075363_100172374 | 3300006048 | Bacteria | 1229 |
| 162 | Ga0075364_10129731 | 3300006051 | Bacteria | 1691 |
| 163 | Ga0075364_10173128 | 3300006051 | Bacteria | 1459 |
| 164 | Ga0075364_10499032 | 3300006051 | Bacteria | 832 |
| 165 | Ga0070715_10065779 | 3300006163 | Bacteria | 1605 |
| 166 | Ga0070715_10352860 | 3300006163 | Bacteria | 804 |
| 167 | Ga0070712_100573964 | 3300006175 | Bacteria | 952 |
| 168 | Ga0070712_101249769 | 3300006175 | Bacteria | 646 |
| 169 | Ga0097621_101396939 | 3300006237 | Bacteria | 663 |
| 170 | Ga0068871_100209078 | 3300006358 | Bacteria | 1687 |
| 171 | Ga0068871_101051095 | 3300006358 | Bacteria | 760 |
| 172 | Ga0075428_100099399 | 3300006844 | Bacteria | 3172 |
| 173 | Ga0075428_100344566 | 3300006844 | Bacteria | 1600 |
| 174 | Ga0075428_100723981 | 3300006844 | Bacteria | 1059 |
| 175 | Ga0075430_100336253 | 3300006846 | Bacteria | 1248 |
| 176 | Ga0075430_100336749 | 3300006846 | Bacteria | 1247 |
| 177 | Ga0075431_100009287 | 3300006847 | Bacteria | 9865 |
| 178 | Ga0075431_100375312 | 3300006847 | Bacteria | 1427 |
| 179 | Ga0075431_101173413 | 3300006847 | Bacteria | 731 |
| 180 | Ga0075431_101343425 | 3300006847 | Unclassified | 675 |
| 181 | Ga0075433_10002569 | 3300006852 | Bacteria | 13824 |
| 182 | Ga0075433_10036320 | 3300006852 | Bacteria | 4244 |
| 183 | Ga0075433_10042835 | 3300006852 | Bacteria | 3929 |
| 184 | Ga0075433_10330015 | 3300006852 | Bacteria | 1349 |
| 185 | Ga0075433_10590948 | 3300006852 | Bacteria | 975 |
| 186 | Ga0075433_10977575 | 3300006852 | Bacteria | 738 |
| 187 | Ga0075434_100002609 | 3300006871 | Bacteria | 15896 |
| 188 | Ga0075434_100056895 | 3300006871 | Bacteria | 3886 |
| 189 | Ga0075434_100071338 | 3300006871 | Bacteria | 3465 |
| 190 | Ga0075434_100141283 | 3300006871 | Bacteria | 2428 |
| 191 | Ga0075434_100460369 | 3300006871 | Bacteria | 1293 |
| 192 | Ga0075434_100904324 | 3300006871 | Unclassified | 897 |
| 193 | Ga0075434_102001061 | 3300006871 | Bacteria | 585 |
| 194 | Ga0075429_100238276 | 3300006880 | Bacteria | 1594 |
| 195 | Ga0075429_100777582 | 3300006880 | Bacteria | 839 |
| 196 | Ga0068865_100056759 | 3300006881 | Bacteria | 2729 |
| 197 | Ga0068865_100076261 | 3300006881 | Bacteria | 2392 |
| 198 | Ga0075436_100088038 | 3300006914 | Unclassified | 2157 |
| 199 | Ga0075436_100804826 | 3300006914 | Unclassified | 700 |
| 200 | Ga0075436_100907250 | 3300006914 | Bacteria | 659 |
| 201 | Ga0075436_101147613 | 3300006914 | Bacteria | 586 |
| 202 | Ga0097620_100062588 | 3300006931 | Bacteria | 3751 |
| 203 | Ga0097620_100083293 | 3300006931 | Bacteria | 3241 |
| 204 | Ga0075435_100029936 | 3300007076 | Bacteria | 4277 |
| 205 | Ga0075435_100051448 | 3300007076 | Bacteria | 3318 |
| 206 | Ga0099795_10073275 | 3300007788 | Bacteria | 1296 |
| 207 | Ga0105251_10065033 | 3300009011 | Bacteria | 1708 |
| 208 | Ga0105250_10097186 | 3300009092 | Bacteria | 1201 |
| 209 | Ga0105240_10706397 | 3300009093 | Bacteria | 1100 |
| 210 | Ga0105240_11127665 | 3300009093 | Bacteria | 833 |
| 211 | Ga0111539_10000194 | 3300009094 | Bacteria | 71319 |
| 212 | Ga0111539_10001498 | 3300009094 | Bacteria | 31188 |
| 213 | Ga0111539_10061439 | 3300009094 | Bacteria | 4451 |
| 214 | Ga0111539_10122025 | 3300009094 | Bacteria | 3053 |
| 215 | Ga0111539_10126261 | 3300009094 | Unclassified | 2997 |
| 216 | Ga0111539_10683240 | 3300009094 | Bacteria | 1195 |
| 217 | Ga0105245_10483902 | 3300009098 | Bacteria | 1251 |
| 218 | Ga0105247_10051200 | 3300009101 | Bacteria | 2542 |
| 219 | Ga0105247_10485458 | 3300009101 | Bacteria | 897 |
| 220 | Ga0114129_10000202 | 3300009147 | Bacteria | 66203 |
| 221 | Ga0114129_10013693 | 3300009147 | Bacteria | 11557 |
| 222 | Ga0114129_10408655 | 3300009147 | Bacteria | 1788 |
| 223 | Ga0114129_10775013 | 3300009147 | Bacteria | 1226 |
| 224 | Ga0105243_10565673 | 3300009148 | Bacteria | 1089 |
| 225 | Ga0105241_10500545 | 3300009174 | Bacteria | 1083 |
| 226 | Ga0105241_10778113 | 3300009174 | Bacteria | 880 |
| 227 | Ga0105242_10066717 | 3300009176 | Bacteria | 2973 |
| 228 | Ga0105242_10112225 | 3300009176 | Bacteria | 2326 |
| 229 | Ga0105248_10022143 | 3300009177 | Bacteria | 7044 |
| 230 | Ga0105248_10870995 | 3300009177 | Bacteria | 1017 |
| 231 | Ga0105248_13082926 | 3300009177 | Unclassified | 530 |
| 232 | Ga0105238_11823960 | 3300009551 | Bacteria | 640 |
| 233 | Ga0105249_10091821 | 3300009553 | Bacteria | 2841 |
| 234 | Ga0105249_11223703 | 3300009553 | Bacteria | 822 |
| 235 | Ga0105249_11300191 | 3300009553 | Bacteria | 799 |
| 236 | Ga0105249_12275866 | 3300009553 | Bacteria | 615 |
| 237 | Ga0099796_10074199 | 3300010159 | Bacteria | 1235 |
| 238 | Ga0105239_11488790 | 3300010375 | Bacteria | 782 |
| 239 | Ga0105239_13120003 | 3300010375 | Bacteria | 540 |
| 240 | Ga0105246_10068645 | 3300011119 | Bacteria | 2487 |
| 241 | Ga0105246_10534256 | 3300011119 | Bacteria | 1002 |
| 242 | Ga0105246_11842778 | 3300011119 | Bacteria | 579 |
| 243 | Ga0157344_1007132 | 3300012476 | Bacteria | 739 |
| 244 | Ga0157320_1003499 | 3300012481 | Bacteria | 954 |
| 245 | Ga0157318_1011096 | 3300012482 | Bacteria | 677 |
| 246 | Ga0157321_1007550 | 3300012487 | Bacteria | 768 |
| 247 | Ga0157343_1009691 | 3300012488 | Bacteria | 716 |
| 248 | Ga0157329_1035464 | 3300012491 | Bacteria | 537 |
| 249 | Ga0157335_1005386 | 3300012492 | Bacteria | 894 |
| 250 | Ga0157339_1002495 | 3300012505 | Bacteria | 1247 |
| 251 | Ga0157324_1008976 | 3300012506 | Bacteria | 817 |
| 252 | Ga0157373_10159155 | 3300013100 | Bacteria | 1589 |
| 253 | Ga0157371_10135320 | 3300013102 | Bacteria | 1754 |
| 254 | Ga0157370_10099706 | 3300013104 | Bacteria | 2722 |
| 255 | Ga0157369_12600543 | 3300013105 | Bacteria | 511 |
| 256 | Ga0157374_10064651 | 3300013296 | Bacteria | 3434 |
| 257 | Ga0157378_10178196 | 3300013297 | Bacteria | 1998 |
| 258 | Ga0157378_10488819 | 3300013297 | Bacteria | 1228 |
| 259 | Ga0157378_11523665 | 3300013297 | Bacteria | 713 |
| 260 | Ga0163162_10096906 | 3300013306 | Bacteria | 3038 |
| 261 | Ga0163162_11245502 | 3300013306 | Bacteria | 845 |
| 262 | Ga0157372_10820770 | 3300013307 | Bacteria | 1080 |
| 263 | Ga0157375_10000044 | 3300013308 | Bacteria | 155953 |
| 264 | Ga0157380_10044642 | 3300014326 | Bacteria | 3475 |
| 265 | Ga0157380_10198141 | 3300014326 | Bacteria | 1779 |
| 266 | Ga0157380_11334317 | 3300014326 | Unclassified | 766 |
| 267 | Ga0157377_10076803 | 3300014745 | Bacteria | 1943 |
| 268 | Ga0157377_10127396 | 3300014745 | Bacteria | 1550 |
| 269 | Ga0157377_10711597 | 3300014745 | Bacteria | 730 |
| 270 | Ga0157376_11766137 | 3300014969 | Bacteria | 654 |
| 271 | Ga0163161_10074649 | 3300017792 | Bacteria | 2487 |
| 272 | Ga0163161_10801867 | 3300017792 | Bacteria | 791 |
| 273 | Ga0197907_10320278 | 3300020069 | Bacteria | 1556 |
| 274 | Ga0206356_11696130 | 3300020070 | Bacteria | 1627 |
| 275 | Ga0206349_1872280 | 3300020075 | Bacteria | 533 |
| 276 | Ga0206351_10603668 | 3300020077 | Unclassified | 846 |
| 277 | Ga0206354_11405769 | 3300020081 | Bacteria | 922 |
| 278 | Ga0206353_11280459 | 3300020082 | Bacteria | 1308 |
| 279 | Ga0213873_10034414 | 3300021358 | Bacteria | 1277 |
| 280 | Ga0213872_10007568 | 3300021361 | Bacteria | 5334 |
| 281 | Ga0213872_10374246 | 3300021361 | Bacteria | 581 |
| 282 | Ga0213875_10085213 | 3300021388 | Bacteria | 1474 |
| 283 | Ga0213875_10141540 | 3300021388 | Bacteria | 1126 |
| 284 | Ga0213871_10072137 | 3300021441 | Unclassified | 977 |
| 285 | Ga0224712_10130454 | 3300022467 | Bacteria | 1097 |
| 286 | Ga0207656_10159519 | 3300025321 | Bacteria | 1073 |
| 287 | Ga0207653_10035294 | 3300025885 | Bacteria | 1626 |
| 288 | Ga0207682_10099631 | 3300025893 | Bacteria | 1269 |
| 289 | Ga0207692_10208637 | 3300025898 | Bacteria | 1152 |
| 290 | Ga0207692_10486570 | 3300025898 | Bacteria | 781 |
| 291 | Ga0207692_10495148 | 3300025898 | Bacteria | 775 |
| 292 | Ga0207642_10140512 | 3300025899 | Bacteria | 1273 |
| 293 | Ga0207642_10775982 | 3300025899 | Bacteria | 608 |
| 294 | Ga0207710_10298885 | 3300025900 | Bacteria | 813 |
| 295 | Ga0207688_10089634 | 3300025901 | Bacteria | 1765 |
| 296 | Ga0207680_10363727 | 3300025903 | Bacteria | 1018 |
| 297 | Ga0207647_10189250 | 3300025904 | Bacteria | 1193 |
| 298 | Ga0207685_10258203 | 3300025905 | Bacteria | 845 |
| 299 | Ga0207685_10311915 | 3300025905 | Bacteria | 782 |
| 300 | Ga0207699_10296241 | 3300025906 | Bacteria | 1128 |
| 301 | Ga0207699_11200852 | 3300025906 | Bacteria | 562 |
| 302 | Ga0207645_10029872 | 3300025907 | Bacteria | 3513 |
| 303 | Ga0207645_10148170 | 3300025907 | Bacteria | 1531 |
| 304 | Ga0207643_10012368 | 3300025908 | Bacteria | 4613 |
| 305 | Ga0207643_10181470 | 3300025908 | Bacteria | 1274 |
| 306 | Ga0207705_10855526 | 3300025909 | Bacteria | 705 |
| 307 | Ga0207705_10956206 | 3300025909 | Bacteria | 663 |
| 308 | Ga0207684_10032484 | 3300025910 | Bacteria | 4438 |
| 309 | Ga0207684_10274759 | 3300025910 | Bacteria | 1453 |
| 310 | Ga0207684_10954132 | 3300025910 | Bacteria | 719 |
| 311 | Ga0207684_11739296 | 3300025910 | Bacteria | 501 |
| 312 | Ga0207654_10677488 | 3300025911 | Bacteria | 740 |
| 313 | Ga0207707_11099979 | 3300025912 | Bacteria | 648 |
| 314 | Ga0207707_11262127 | 3300025912 | Bacteria | 595 |
| 315 | Ga0207695_11355160 | 3300025913 | Bacteria | 592 |
| 316 | Ga0207671_11020117 | 3300025914 | Bacteria | 652 |
| 317 | Ga0207693_10062680 | 3300025915 | Bacteria | 2913 |
| 318 | Ga0207693_10516800 | 3300025915 | Bacteria | 932 |
| 319 | Ga0207663_10515818 | 3300025916 | Bacteria | 930 |
| 320 | Ga0207660_11189277 | 3300025917 | Bacteria | 620 |
| 321 | Ga0207662_10011179 | 3300025918 | Bacteria | 4969 |
| 322 | Ga0207662_10380031 | 3300025918 | Bacteria | 954 |
| 323 | Ga0207662_10683174 | 3300025918 | Bacteria | 719 |
| 324 | Ga0207657_10036867 | 3300025919 | Bacteria | 4374 |
| 325 | Ga0207657_10341548 | 3300025919 | Bacteria | 1182 |
| 326 | Ga0207649_10546472 | 3300025920 | Bacteria | 886 |
| 327 | Ga0207649_10598831 | 3300025920 | Bacteria | 847 |
| 328 | Ga0207646_10022911 | 3300025922 | Bacteria | 5742 |
| 329 | Ga0207646_10039940 | 3300025922 | Bacteria | 4223 |
| 330 | Ga0207646_10136340 | 3300025922 | Bacteria | 2210 |
| 331 | Ga0207646_10177937 | 3300025922 | Bacteria | 1921 |
| 332 | Ga0207646_10297630 | 3300025922 | Bacteria | 1458 |
| 333 | Ga0207646_11451591 | 3300025922 | Unclassified | 595 |
| 334 | Ga0207681_10784289 | 3300025923 | Bacteria | 796 |
| 335 | Ga0207681_11552385 | 3300025923 | Bacteria | 555 |
| 336 | Ga0207659_10099495 | 3300025926 | Bacteria | 2189 |
| 337 | Ga0207659_10225682 | 3300025926 | Bacteria | 1508 |
| 338 | Ga0207687_10638805 | 3300025927 | Bacteria | 900 |
| 339 | Ga0207664_10001895 | 3300025929 | Bacteria | 13748 |
| 340 | Ga0207664_10130655 | 3300025929 | Bacteria | 2114 |
| 341 | Ga0207664_11537640 | 3300025929 | Bacteria | 587 |
| 342 | Ga0207690_10205107 | 3300025932 | Bacteria | 1500 |
| 343 | Ga0207690_10301812 | 3300025932 | Bacteria | 1253 |
| 344 | Ga0207690_11044095 | 3300025932 | Bacteria | 680 |
| 345 | Ga0207706_10032639 | 3300025933 | Bacteria | 4635 |
| 346 | Ga0207709_10075384 | 3300025935 | Bacteria | 2156 |
| 347 | Ga0207670_10239006 | 3300025936 | Bacteria | 1398 |
| 348 | Ga0207670_10540067 | 3300025936 | Bacteria | 951 |
| 349 | Ga0207669_10054530 | 3300025937 | Bacteria | 2415 |
| 350 | Ga0207669_10139490 | 3300025937 | Bacteria | 1680 |
| 351 | Ga0207704_10100222 | 3300025938 | Bacteria | 1929 |
| 352 | Ga0207704_11345930 | 3300025938 | Bacteria | 611 |
| 353 | Ga0207665_10279602 | 3300025939 | Bacteria | 1242 |
| 354 | Ga0207691_10258894 | 3300025940 | Bacteria | 1500 |
| 355 | Ga0207711_10366635 | 3300025941 | Bacteria | 1335 |
| 356 | Ga0207711_11437841 | 3300025941 | Bacteria | 632 |
| 357 | Ga0207689_10017369 | 3300025942 | Bacteria | 6089 |
| 358 | Ga0207689_10029324 | 3300025942 | Bacteria | 4596 |
| 359 | Ga0207689_10365124 | 3300025942 | Bacteria | 1201 |
| 360 | Ga0207679_10700298 | 3300025945 | Bacteria | 919 |
| 361 | Ga0207679_11336867 | 3300025945 | Bacteria | 658 |
| 362 | Ga0207667_10629307 | 3300025949 | Bacteria | 1080 |
| 363 | Ga0207651_10947804 | 3300025960 | Bacteria | 768 |
| 364 | Ga0207668_10475637 | 3300025972 | Bacteria | 1071 |
| 365 | Ga0207668_10483634 | 3300025972 | Bacteria | 1062 |
| 366 | Ga0207640_10991597 | 3300025981 | Bacteria | 738 |
| 367 | Ga0207658_10141206 | 3300025986 | Bacteria | 1949 |
| 368 | Ga0207658_10513212 | 3300025986 | Bacteria | 1069 |
| 369 | Ga0207658_10657272 | 3300025986 | Bacteria | 945 |
| 370 | Ga0207658_11102893 | 3300025986 | Bacteria | 725 |
| 371 | Ga0207677_10336713 | 3300026023 | Bacteria | 1259 |
| 372 | Ga0207703_10665861 | 3300026035 | Bacteria | 988 |
| 373 | Ga0207703_11128102 | 3300026035 | Bacteria | 753 |
| 374 | Ga0207678_10023885 | 3300026067 | Bacteria | 5346 |
| 375 | Ga0207678_10113678 | 3300026067 | Bacteria | 2310 |
| 376 | Ga0207708_10032856 | 3300026075 | Bacteria | 3940 |
| 377 | Ga0207708_10204788 | 3300026075 | Bacteria | 1575 |
| 378 | Ga0207702_10084142 | 3300026078 | Bacteria | 2769 |
| 379 | Ga0207702_10171984 | 3300026078 | Bacteria | 1987 |
| 380 | Ga0207641_10277686 | 3300026088 | Bacteria | 1574 |
| 381 | Ga0207641_10681171 | 3300026088 | Bacteria | 1011 |
| 382 | Ga0207648_10001929 | 3300026089 | Bacteria | 22670 |
| 383 | Ga0207648_10622104 | 3300026089 | Bacteria | 996 |
| 384 | Ga0207676_10018645 | 3300026095 | Bacteria | 5051 |
| 385 | Ga0207676_10258056 | 3300026095 | Bacteria | 1572 |
| 386 | Ga0207676_11162440 | 3300026095 | Bacteria | 764 |
| 387 | Ga0207674_10045402 | 3300026116 | Bacteria | 4520 |
| 388 | Ga0207674_10125035 | 3300026116 | Unclassified | 2538 |
| 389 | Ga0207675_100026059 | 3300026118 | Bacteria | 5442 |
| 390 | Ga0207675_100071149 | 3300026118 | Bacteria | 3251 |
| 391 | Ga0207683_10022689 | 3300026121 | Bacteria | 5390 |
| 392 | Ga0207683_10065647 | 3300026121 | Bacteria | 3200 |
| 393 | Ga0207683_10147535 | 3300026121 | Bacteria | 2122 |
| 394 | Ga0207683_10919424 | 3300026121 | Bacteria | 812 |
| 395 | Ga0207683_10972843 | 3300026121 | Bacteria | 788 |
| 396 | Ga0207428_10000365 | 3300027907 | Bacteria | 58330 |
| 397 | Ga0207428_10006355 | 3300027907 | Bacteria | 10929 |
| 398 | Ga0207428_10239132 | 3300027907 | Bacteria | 1357 |
| 399 | Ga0207428_10372554 | 3300027907 | Unclassified | 1048 |
| 400 | Ga0268266_10965884 | 3300028379 | Bacteria | 824 |
| 401 | Ga0268266_11257199 | 3300028379 | Bacteria | 715 |
| 402 | Ga0268266_11585754 | 3300028379 | Bacteria | 630 |
| 403 | Ga0268265_10022401 | 3300028380 | Bacteria | 4438 |
| 404 | Ga0268265_10082547 | 3300028380 | Bacteria | 2542 |
| 405 | Ga0268265_10113603 | 3300028380 | Bacteria | 2216 |
| 406 | Ga0268264_10205579 | 3300028381 | Bacteria | 1804 |
| 407 | Ga0268264_11310715 | 3300028381 | Bacteria | 734 |
| 408 | Ga0265338_10136743 | 3300028800 | Bacteria | 1925 |
| 409 | Ga0265330_10009451 | 3300031235 | Bacteria | 4632 |
| 410 | Ga0265330_10269737 | 3300031235 | Bacteria | 717 |
| 411 | Ga0265332_10000044 | 3300031238 | Bacteria | 114444 |
| 412 | Ga0265328_10002340 | 3300031239 | Bacteria | 8544 |
| 413 | Ga0265320_10274588 | 3300031240 | Unclassified | 746 |
| 414 | Ga0265325_10152569 | 3300031241 | Bacteria | 1092 |
| 415 | Ga0265325_10353035 | 3300031241 | Unclassified | 649 |
| 416 | Ga0265329_10013927 | 3300031242 | Bacteria | 2853 |
| 417 | Ga0265340_10087798 | 3300031247 | Unclassified | 1457 |
| 418 | Ga0265339_10163001 | 3300031249 | Bacteria | 1121 |
| 419 | Ga0265331_10000076 | 3300031250 | Bacteria | 145884 |
| 420 | Ga0265327_10084672 | 3300031251 | Unclassified | 1558 |
| 421 | Ga0265316_10000006 | 3300031344 | Bacteria | 289686 |
| 422 | Ga0265316_10212482 | 3300031344 | Bacteria | 1430 |
| 423 | Ga0265316_10256745 | 3300031344 | Bacteria | 1282 |
| 424 | Ga0307408_100474096 | 3300031548 | Unclassified | 1090 |
| 425 | Ga0265314_10000056 | 3300031711 | Bacteria | 171647 |
| 426 | Ga0265314_10020912 | 3300031711 | Bacteria | 5044 |
| 427 | Ga0265342_10003118 | 3300031712 | Bacteria | 13851 |
| 428 | Ga0265342_10014410 | 3300031712 | Bacteria | 5249 |
| 429 | Ga0265342_10040407 | 3300031712 | Bacteria | 2829 |
| 430 | Ga0316576_10035276 | 3300031727 | Bacteria | 3570 |
| 431 | Ga0316578_10849739 | 3300031728 | Bacteria | 528 |
| 432 | Ga0307405_12046167 | 3300031731 | Unclassified | 513 |
| 433 | Ga0316577_10562014 | 3300031733 | Bacteria | 649 |
| 434 | Ga0307407_10146717 | 3300031903 | Bacteria | 1529 |
| 435 | Ga0307416_103097136 | 3300032002 | Bacteria | 556 |
| 436 | Ga0316592_1149623 | 3300033524 | Unclassified | 550 |
| 437 | Ga0373930_0035367 | 3300034816 | Bacteria | 1045 |
| 438 | Ga0373959_0062089 | 3300034820 | Bacteria | 829 |
| 439 | Ga0373926_0173394 | 3300035083 | Bacteria | 826 |
| 440 | Ga0373929_0213774 | 3300035085 | Bacteria | 546 |
| 441 | Ga0373934_0438086 | 3300035086 | Bacteria | 547 |
| 442 | Ga0373944_0029762 | 3300035089 | Bacteria | 1634 |
| 443 | Ga0373951_0061629 | 3300035091 | Bacteria | 940 |
| 444 | Ga0373923_0257853 | 3300035111 | Bacteria | 817 |
| 445 | Ga0373932_0065659 | 3300035112 | Bacteria | 1113 |
| 446 | Ga0373936_0000641 | 3300035113 | Bacteria | 12087 |
| 447 | Ga0373936_0072518 | 3300035113 | Bacteria | 1422 |
| 448 | Ga0373936_0635535 | 3300035113 | Bacteria | 502 |
| 449 | Ga0373939_0011143 | 3300035114 | Bacteria | 2262 |
| 450 | Ga0373939_0336595 | 3300035114 | Bacteria | 611 |
| 451 | Ga0373945_0035869 | 3300035116 | Bacteria | 1774 |
| 452 | Ga0373953_0007993 | 3300035117 | Bacteria | 3571 |
| 453 | Ga0373954_0026950 | 3300035118 | Bacteria | 2636 |
| 454 | Ga0373957_0038512 | 3300035120 | Bacteria | 1790 |
| 455 | Ga0373957_0526068 | 3300035120 | Bacteria | 516 |
| 456 | Ga0373960_0040444 | 3300035121 | Bacteria | 1346 |
| 457 | Ga0373943_0009965 | 3300035170 | Bacteria | 4259 |
| 458 | Ga0373943_0218876 | 3300035170 | Bacteria | 1060 |
| 459 | Ga0373946_0192679 | 3300035171 | Bacteria | 973 |
| 460 | Ga0373946_0341019 | 3300035171 | Bacteria | 747 |
| 461 | Ga0373955_0097009 | 3300035172 | Bacteria | 1687 |
| 462 | Ga0373961_0055565 | 3300035241 | Bacteria | 1187 |
| 463 | Ga0373924_0017999 | 3300035410 | Bacteria | 2718 |
| 464 | Ga0373924_0496965 | 3300035410 | Bacteria | 548 |
| 465 | Ga0373931_0067194 | 3300035691 | Bacteria | 1947 |
| 466 | Ga0373935_0040709 | 3300035692 | Bacteria | 2916 |
| 467 | Ga0373935_0131306 | 3300035692 | Bacteria | 1683 |
| 468 | Ga0373935_0326388 | 3300035692 | Bacteria | 1090 |
| 469 | Ga0373927_0021329 | 3300035695 | Bacteria | 4246 |
| 470 | Ga0373927_0052566 | 3300035695 | Bacteria | 2635 |
| 471 | Ga0373933_0009791 | 3300035724 | Bacteria | 5245 |
| 472 | Ga0373933_0018208 | 3300035724 | Bacteria | 3948 |
| 473 | Ga0373947_0005413 | 3300035725 | Bacteria | 7453 |
| 474 | Ga0373947_0035367 | 3300035725 | Bacteria | 2957 |
| 475 | Ga0373937_0077831 | 3300036401 | Bacteria | 3064 |
| 476 | Ga0373937_0236233 | 3300036401 | Bacteria | 1721 |
| 477 | Ga0373937_0260448 | 3300036401 | Bacteria | 1635 |
| 478 | Ga0373937_0830029 | 3300036401 | Bacteria | 872 |
| 479 | Ga0373925_0041169 | 3300037068 | Bacteria | 3423 |
| 480 | Ga0395905_0071815 | 3300037471 | Bacteria | 3245 |
| 481 | Ga0395905_0135282 | 3300037471 | Bacteria | 2318 |
| 482 | Ga0436364_0656649 | 3300037853 | Unclassified | 731 |
| 483 | Ga0436364_0773908 | 3300037853 | Bacteria | 6045 |
| 484 | Ga0436364_0939520 | 3300037853 | Bacteria | 1240 |
| 485 | Ga0436364_1429122 | 3300037853 | Bacteria | 1269 |
| 486 | Ga0436365_0824878 | 3300039437 | Bacteria | 1402 |
| 487 | Ga0436360_0072264 | 3300039438 | Bacteria | 511 |
| 488 | Ga0436360_0083095 | 3300039438 | Unclassified | 730 |
| 489 | Ga0436360_0172421 | 3300039438 | Bacteria | 2991 |
| 490 | Ga0436360_0497875 | 3300039438 | Bacteria | 1466 |
| 491 | Ga0436360_0720818 | 3300039438 | Bacteria | 657 |
| 492 | Ga0436360_0869944 | 3300039438 | Bacteria | 525 |
| 493 | Ga0436361_0554849 | 3300039447 | Bacteria | 34806 |
| 494 | Ga0436361_0805706 | 3300039447 | Bacteria | 2809 |
| 495 | Ga0436361_0891320 | 3300039447 | Unclassified | 502 |
| 496 | Ga0436361_0945716 | 3300039447 | Bacteria | 703 |
| 497 | Ga0436363_0255660 | 3300039450 | Bacteria | 1467 |
| 498 | Ga0436362_0104738 | 3300039453 | Bacteria | 2138 |
| 499 | Ga0436362_0621761 | 3300039453 | Bacteria | 821 |
| 500 | Ga0436362_0735501 | 3300039453 | Bacteria | 1945 |
| 501 | Ga0451807_2499475 | 3300041486 | Bacteria | 564 |
| 502 | Ga0451849_1286789 | 3300041505 | Bacteria | 558 |
| 503 | Ga0451853_1584074 | 3300041512 | Bacteria | 827 |
| 504 | Ga0439441_022517 | 3300042001 | Bacteria | 1172 |
| 505 | Ga0450921_010801 | 3300042123 | Bacteria | 772 |
| 506 | Ga0450923_060066 | 3300042125 | Bacteria | 828 |
| 507 | Ga0450894_005576 | 3300042131 | Bacteria | 1628 |
| 508 | Ga0450896_006073 | 3300042133 | Bacteria | 1652 |
| 509 | Ga0450899_010744 | 3300042135 | Bacteria | 1017 |
| 510 | Ga0439434_0245645 | 3300042435 | Unclassified | 611 |
| 511 | Ga0450918_002582 | 3300042531 | Bacteria | 3425 |
| 512 | Ga0451577_0014229 | 3300042876 | Bacteria | 7416 |
| 513 | Ga0451577_0109967 | 3300042876 | Bacteria | 2465 |
| 514 | Ga0451577_0127802 | 3300042876 | Bacteria | 2278 |
| 515 | Ga0451577_0456119 | 3300042876 | Bacteria | 1161 |
| 516 | Ga0451577_0856898 | 3300042876 | Unclassified | 819 |
| 517 | Ga0439440_0176197 | 3300042993 | Unclassified | 624 |
| 518 | Ga0453683_0394365 | 3300044673 | Bacteria | 892 |
| 519 | Ga0466963_0963742 | 3300044694 | Bacteria | 601 |
| 520 | Ga0466964_0452890 | 3300044706 | Bacteria | 681 |
| 521 | Ga0453684_0007847 | 3300044712 | Bacteria | 19434 |
| 522 | Ga0453684_0567381 | 3300044712 | Bacteria | 1248 |
| 523 | Ga0466968_0104654 | 3300044735 | Bacteria | 1267 |
| 524 | Ga0451576_0010179 | 3300045051 | Bacteria | 10813 |
| 525 | Ga0451576_2369635 | 3300045051 | Unclassified | 543 |
| 526 | Ga0451576_2608165 | 3300045051 | Unclassified | 515 |
| 527 | Ga0466967_0525786 | 3300045976 | Bacteria | 1163 |
| 528 | Ga0495592_0030815 | 3300046454 | Bacteria | 4057 |
| 529 | Ga0495592_0282763 | 3300046454 | Bacteria | 1084 |
| 530 | Ga0495603_0025782 | 3300046455 | Bacteria | 3554 |
| 531 | Ga0495641_0022240 | 3300046461 | Bacteria | 3175 |
| 532 | Ga0495651_0072227 | 3300046462 | Bacteria | 2621 |
| 533 | Ga0495651_0686263 | 3300046462 | Bacteria | 639 |
| 534 | Ga0495651_1003004 | 3300046462 | Bacteria | 506 |
| 535 | Ga0495653_0457652 | 3300046463 | Bacteria | 801 |
| 536 | Ga0495580_0173771 | 3300046472 | Bacteria | 1488 |
| 537 | Ga0495580_0482001 | 3300046472 | Bacteria | 829 |
| 538 | Ga0495582_0005954 | 3300046473 | Bacteria | 6800 |
| 539 | Ga0495639_0003444 | 3300046475 | Bacteria | 6851 |
| 540 | Ga0495639_0369476 | 3300046475 | Bacteria | 722 |
| 541 | Ga0495662_0196737 | 3300046476 | Bacteria | 994 |
| 542 | Ga0495664_0015894 | 3300046477 | Bacteria | 4283 |
| 543 | Ga0495664_0500602 | 3300046477 | Bacteria | 725 |
| 544 | Ga0495594_0170797 | 3300046499 | Bacteria | 1237 |
| 545 | Ga0495608_0020357 | 3300046511 | Bacteria | 4559 |
| 546 | Ga0495608_0101336 | 3300046511 | Bacteria | 1856 |
| 547 | Ga0495618_0014606 | 3300046514 | Bacteria | 4786 |
| 548 | Ga0495628_0168857 | 3300046516 | Bacteria | 1659 |
| 549 | Ga0495628_0192257 | 3300046516 | Bacteria | 1540 |
| 550 | Ga0495630_0083288 | 3300046517 | Bacteria | 2414 |
| 551 | Ga0495666_0004676 | 3300046526 | Bacteria | 6926 |
| 552 | Ga0495652_0044698 | 3300046529 | Bacteria | 3812 |
| 553 | Ga0495652_0478035 | 3300046529 | Bacteria | 868 |
| 554 | Ga0495652_0685820 | 3300046529 | Bacteria | 690 |
| 555 | Ga0495652_0839711 | 3300046529 | Bacteria | 609 |
| 556 | Ga0495665_0007757 | 3300046531 | Bacteria | 5806 |
| 557 | Ga0495640_0230638 | 3300046533 | Bacteria | 1164 |
| 558 | Ga0495586_0073868 | 3300046535 | Bacteria | 1865 |
| 559 | Ga0495587_0023688 | 3300046536 | Bacteria | 3771 |
| 560 | Ga0495609_0152922 | 3300046538 | Unclassified | 981 |
| 561 | Ga0495645_0020867 | 3300046543 | Bacteria | 4733 |
| 562 | Ga0495645_0093098 | 3300046543 | Bacteria | 2151 |
| 563 | Ga0495645_0366851 | 3300046543 | Bacteria | 924 |
| 564 | Ga0495667_0014969 | 3300046559 | Bacteria | 5240 |
| 565 | Ga0495667_0894605 | 3300046559 | Bacteria | 544 |
| 566 | Ga0495656_0087739 | 3300046615 | Bacteria | 1417 |
| 567 | Ga0495634_0072746 | 3300046642 | Bacteria | 2260 |
| 568 | Ga0495635_0007103 | 3300046663 | Bacteria | 7829 |
| 569 | Ga0495635_0397659 | 3300046663 | Bacteria | 915 |
| 570 | Ga0495635_0853845 | 3300046663 | Bacteria | 585 |
| 571 | Ga0495657_0026472 | 3300046675 | Bacteria | 4106 |
| 572 | Ga0495657_0067938 | 3300046675 | Bacteria | 2337 |
| 573 | Ga0495599_0022147 | 3300046678 | Bacteria | 3965 |
| 574 | Ga0495599_0423780 | 3300046678 | Bacteria | 790 |
| 575 | Ga0495599_0822723 | 3300046678 | Bacteria | 530 |
| 576 | Ga0495623_0140733 | 3300046679 | Bacteria | 1435 |
| 577 | Ga0495646_0022907 | 3300046680 | Bacteria | 3934 |
| 578 | Ga0495646_0134533 | 3300046680 | Bacteria | 1388 |
| 579 | Ga0495647_0016034 | 3300046681 | Bacteria | 2634 |
| 580 | Ga0495658_0004533 | 3300046683 | Bacteria | 6829 |
| 581 | Ga0495669_0008295 | 3300046684 | Bacteria | 4363 |
| 582 | Ga0495669_0130111 | 3300046684 | Bacteria | 1184 |
| 583 | Ga0495624_0009644 | 3300046690 | Bacteria | 6683 |
| 584 | Ga0495589_0205411 | 3300046794 | Bacteria | 929 |
| 585 | Ga0495600_0080838 | 3300046809 | Bacteria | 2121 |
| 586 | Ga0495600_0423012 | 3300046809 | Bacteria | 826 |
| 587 | Ga0495581_0006948 | 3300047315 | Bacteria | 6555 |
| 588 | Ga0495581_0151436 | 3300047315 | Bacteria | 1354 |
| 589 | Ga0495604_0031488 | 3300047317 | Bacteria | 4206 |
| 590 | Ga0495674_0068827 | 3300047319 | Bacteria | 3062 |
| 591 | Ga0495674_0358515 | 3300047319 | Bacteria | 1183 |
| 592 | Ga0495676_0069839 | 3300047321 | Bacteria | 2708 |
| 593 | Ga0495680_0010283 | 3300047322 | Bacteria | 8346 |
| 594 | Ga0495680_0730761 | 3300047322 | Bacteria | 651 |
| 595 | Ga0495675_0023875 | 3300047444 | Bacteria | 3896 |
| 596 | Ga0495684_0018890 | 3300047471 | Bacteria | 5307 |
| 597 | Ga0495593_0015149 | 3300047673 | Bacteria | 4376 |
| 598 | Ga0495602_0164195 | 3300048088 | Bacteria | 1730 |
| 599 | Ga0495602_0247129 | 3300048088 | Bacteria | 1331 |
| 600 | Ga0495614_0032217 | 3300048089 | Bacteria | 2256 |
| 601 | Ga0496100_0265894 | 3300048903 | Bacteria | 1273 |
| 602 | Ga0496100_0890682 | 3300048903 | Unclassified | 699 |
| 603 | Ga0496100_1014808 | 3300048903 | Bacteria | 653 |
| 604 | Ga0496101_0044842 | 3300048904 | Bacteria | 3165 |
| 605 | Ga0496101_0262555 | 3300048904 | Bacteria | 1347 |
| 606 | Ga0496102_1165143 | 3300048905 | Bacteria | 690 |
| 607 | Ga0496103_0099101 | 3300048906 | Bacteria | 1843 |
| 608 | Ga0496103_1051753 | 3300048906 | Unclassified | 505 |
| 609 | Ga0496104_0347717 | 3300048907 | Bacteria | 1395 |
| 610 | Ga0496104_0686244 | 3300048907 | Bacteria | 932 |
| 611 | Ga0496105_0874230 | 3300048908 | Bacteria | 679 |
| 612 | Ga0496106_0367548 | 3300048909 | Bacteria | 1156 |
| 613 | Ga0496106_1198555 | 3300048909 | Bacteria | 592 |
| 614 | Ga0496107_0537707 | 3300048910 | Unclassified | 866 |
| 615 | Ga0496107_0620213 | 3300048910 | Bacteria | 798 |
| 616 | Ga0496108_0165900 | 3300048911 | Bacteria | 1909 |
| 617 | Ga0496108_0272670 | 3300048911 | Bacteria | 1473 |
| 618 | Ga0496108_0648841 | 3300048911 | Bacteria | 918 |
| 619 | Ga0496109_0614317 | 3300048912 | Bacteria | 1023 |
| 620 | Ga0496110_0346338 | 3300048913 | Bacteria | 1353 |
| 621 | Ga0496110_0748035 | 3300048913 | Bacteria | 881 |
| 622 | Ga0496111_0505231 | 3300048914 | Bacteria | 889 |
| 623 | Ga0496112_0034784 | 3300048915 | Bacteria | 4903 |
| 624 | Ga0496112_0195410 | 3300048915 | Bacteria | 1984 |
| 625 | Ga0496114_0541721 | 3300048917 | Bacteria | 1029 |
| 626 | Ga0496115_0080503 | 3300048918 | Bacteria | 2652 |
| 627 | Ga0496115_0512695 | 3300048918 | Bacteria | 962 |
| 628 | Ga0501031_0203034 | 3300049568 | Bacteria | 1293 |
| 629 | Ga0501031_0336846 | 3300049568 | Bacteria | 977 |
| 630 | Ga0501031_0912585 | 3300049568 | Bacteria | 562 |
| 631 | Ga0501033_0987069 | 3300049570 | Unclassified | 563 |
| 632 | Ga0501036_0543986 | 3300049572 | Bacteria | 965 |
| 633 | Ga0501037_0746570 | 3300049573 | Bacteria | 649 |
| 634 | Ga0501038_0379574 | 3300049574 | Bacteria | 1097 |
| 635 | Ga0501039_0402963 | 3300049575 | Bacteria | 1074 |
| 636 | Ga0501039_1578220 | 3300049575 | Bacteria | 504 |
| 637 | Ga0501040_0203845 | 3300049576 | Bacteria | 1405 |
| 638 | Ga0501040_0322749 | 3300049576 | Bacteria | 1104 |
| 639 | Ga0501040_0375398 | 3300049576 | Bacteria | 1020 |
| 640 | Ga0501041_0269418 | 3300049577 | Bacteria | 1071 |
| 641 | Ga0501042_0688382 | 3300049578 | Bacteria | 743 |
| 642 | Ga0501046_0051976 | 3300049580 | Bacteria | 3232 |
| 643 | Ga0501046_0501839 | 3300049580 | Bacteria | 869 |
| 644 | Ga0501046_0619116 | 3300049580 | Bacteria | 767 |
| 645 | Ga0501048_0827439 | 3300049582 | Bacteria | 665 |
| 646 | Ga0501068_0782388 | 3300049584 | Bacteria | 625 |
| 647 | Ga0501070_1213978 | 3300049586 | Bacteria | 578 |
| 648 | Ga0501070_1477082 | 3300049586 | Bacteria | 515 |
| 649 | Ga0501071_0625311 | 3300049587 | Bacteria | 828 |
| 650 | Ga0501071_1187832 | 3300049587 | Bacteria | 589 |
| 651 | Ga0501072_0003022 | 3300049588 | Bacteria | 12690 |
| 652 | Ga0501072_0176020 | 3300049588 | Bacteria | 1707 |
| 653 | Ga0501072_0431751 | 3300049588 | Bacteria | 1044 |
| 654 | Ga0501073_0428038 | 3300049589 | Bacteria | 915 |
| 655 | Ga0501073_0589459 | 3300049589 | Bacteria | 768 |
| 656 | Ga0501074_0040599 | 3300049590 | Bacteria | 3370 |
| 657 | Ga0501074_0116369 | 3300049590 | Bacteria | 1913 |
| 658 | Ga0501074_0640465 | 3300049590 | Bacteria | 751 |
| 659 | Ga0501075_0016028 | 3300049591 | Bacteria | 5392 |
| 660 | Ga0501075_0344685 | 3300049591 | Bacteria | 1135 |
| 661 | Ga0501076_0015432 | 3300049592 | Bacteria | 5772 |
| 662 | Ga0501076_0147829 | 3300049592 | Bacteria | 1911 |
| 663 | Ga0501076_1064558 | 3300049592 | Bacteria | 666 |
| 664 | Ga0501077_0432384 | 3300049593 | Bacteria | 842 |
| 665 | Ga0501077_0475093 | 3300049593 | Bacteria | 801 |
| 666 | Ga0501079_0004245 | 3300049741 | Bacteria | 10628 |
| 667 | Ga0501079_0221810 | 3300049741 | Bacteria | 1477 |
| 668 | Ga0501080_0446479 | 3300049742 | Bacteria | 1160 |
| 669 | Ga0501081_0019917 | 3300049743 | Bacteria | 4469 |
| 670 | Ga0501081_0739137 | 3300049743 | Bacteria | 739 |
| 671 | Ga0501083_0712409 | 3300049744 | Bacteria | 653 |
| 672 | Ga0501035_0253175 | 3300049822 | Bacteria | 1495 |
| 673 | Ga0501045_0100239 | 3300049824 | Bacteria | 2144 |
| 674 | Ga0501045_0705794 | 3300049824 | Bacteria | 744 |
| 675 | nmdc:mga03683_254731_c1 | 3300050489 | Bacteria | 816 |
| 676 | nmdc:mga03n38_14316_c1 | 3300050490 | Bacteria | 3036 |
| 677 | nmdc:mga00v17_408162_c1 | 3300050491 | Bacteria | 883 |
| 678 | nmdc:mga00v17_52966_c1 | 3300050491 | Bacteria | 2472 |
| 679 | nmdc:mga0yw44_10402_c1 | 3300050492 | Bacteria | 4752 |
| 680 | nmdc:mga0k408_3942_c1 | 3300050493 | Bacteria | 7870 |
| 681 | nmdc:mga06z11_9299_c1 | 3300050494 | Bacteria | 4136 |
| 682 | nmdc:mga07m45_57780_c2 | 3300050496 | Bacteria | 658 |
| 683 | nmdc:mga05p37_105024_c1 | 3300050507 | Bacteria | 3475 |
| 684 | nmdc:mga05p37_1087913_c1 | 3300050507 | Bacteria | 839 |
| 685 | nmdc:mga05p37_1110428_c1 | 3300050507 | Bacteria | 827 |
| 686 | nmdc:mga05p37_1278851_c1 | 3300050507 | Bacteria | 750 |
| 687 | nmdc:mga05p37_2092021_c1 | 3300050507 | Bacteria | 531 |
| 688 | nmdc:mga05p37_38560_c1 | 3300050507 | Bacteria | 5861 |
| 689 | nmdc:mga05p37_726382_c1 | 3300050507 | Bacteria | 1099 |
| 690 | nmdc:mga05p37_8774_c1 | 3300050507 | Bacteria | 11941 |
| 691 | nmdc:mga09592_239313_c1 | 3300050508 | Bacteria | 1573 |
| 692 | nmdc:mga09592_577724_c1 | 3300050508 | Bacteria | 964 |
| 693 | nmdc:mga0qj67_1492090_c1 | 3300050509 | Unclassified | 520 |
| 694 | nmdc:mga0qj67_394374_c1 | 3300050509 | Bacteria | 1117 |
| 695 | nmdc:mga06r32_15456_c1 | 3300050510 | Bacteria | 6929 |
| 696 | nmdc:mga06r32_542477_c1 | 3300050510 | Bacteria | 1137 |
| 697 | nmdc:mga06r32_8449_c1 | 3300050510 | Bacteria | 9280 |
| 698 | nmdc:mga08y16_1299_c1 | 3300050511 | Bacteria | 24801 |
| 699 | nmdc:mga08y16_47842_c1 | 3300050511 | Unclassified | 4476 |
| 700 | nmdc:mga08y16_63226_c1 | 3300050511 | Bacteria | 3865 |
| 701 | nmdc:mga08y16_763654_c1 | 3300050511 | Unclassified | 962 |
| 702 | nmdc:mga08y16_96614_c1 | 3300050511 | Bacteria | 3077 |
| 703 | nmdc:mga0n895_139937_c1 | 3300050512 | Bacteria | 2448 |
| 704 | nmdc:mga0n895_141171_c1 | 3300050512 | Unclassified | 2437 |
| 705 | nmdc:mga0n895_1549890_c1 | 3300050512 | Bacteria | 628 |
| 706 | nmdc:mga0n895_160226_c1 | 3300050512 | Bacteria | 2282 |
| 707 | nmdc:mga0n895_283321_c1 | 3300050512 | Bacteria | 1680 |
| 708 | nmdc:mga0n895_3543_c1 | 3300050512 | Bacteria | 12629 |
| 709 | nmdc:mga0n895_91689_c1 | 3300050512 | Bacteria | 3041 |
| 710 | nmdc:mga0rr50_155431_c1 | 3300050513 | Unclassified | 1852 |
| 711 | nmdc:mga0rr50_15951_c1 | 3300050513 | Bacteria | 4974 |
| 712 | nmdc:mga0rr50_32554_c1 | 3300050513 | Bacteria | 3715 |
| 713 | nmdc:mga0rr50_476643_c1 | 3300050513 | Bacteria | 1059 |
| 714 | nmdc:mga0rr50_857397_c1 | 3300050513 | Bacteria | 775 |
| 715 | nmdc:mga0rr50_90925_c1 | 3300050513 | Bacteria | 2376 |
| 716 | nmdc:mga08x19_444253_c1 | 3300050514 | Bacteria | 912 |
| 717 | nmdc:mga08x19_67079_c1 | 3300050514 | Bacteria | 1867 |
| 718 | nmdc:mga08x19_80877_c1 | 3300050514 | Unclassified | 2133 |
| 719 | nmdc:mga08x19_816822_c1 | 3300050514 | Unclassified | 662 |
| 720 | nmdc:mga0a205_11026_c1 | 3300050515 | Bacteria | 8319 |
| 721 | nmdc:mga0a205_270453_c2 | 3300050515 | Unclassified | 1229 |
| 722 | nmdc:mga0a205_35606_c2 | 3300050515 | Bacteria | 3731 |
| 723 | nmdc:mga0a205_632037_c1 | 3300050515 | Bacteria | 922 |
| 724 | nmdc:mga0a205_6938_c1 | 3300050515 | Bacteria | 10241 |
| 725 | nmdc:mga0a205_694_c1 | 3300050515 | Bacteria | 18029 |
| 726 | nmdc:mga0a205_94824_c1 | 3300050515 | Unclassified | 2883 |
| 727 | Ga0495601_0000713 | 3300053077 | Bacteria | 17851 |
| 728 | Ga0495601_0032225 | 3300053077 | Bacteria | 3261 |
| 729 | Ga0495601_0184262 | 3300053077 | Bacteria | 1364 |
| 730 | Ga0495612_0017245 | 3300053078 | Bacteria | 2892 |
| 731 | Ga0495612_0071902 | 3300053078 | Bacteria | 1443 |
| 732 | Ga0495595_0067770 | 3300053084 | Bacteria | 1682 |
| 733 | Ga0495595_0187165 | 3300053084 | Bacteria | 1028 |
| 734 | Ga0495595_0681918 | 3300053084 | Bacteria | 526 |
| 735 | Ga0495619_0029947 | 3300053085 | Bacteria | 3520 |
| 736 | Ga0495619_0643511 | 3300053085 | Bacteria | 723 |
| 737 | Ga0501084_0018114 | 3300054114 | Bacteria | 5865 |
| 738 | Ga0501084_0261346 | 3300054114 | Bacteria | 1461 |
| 739 | Ga0501084_0492221 | 3300054114 | Bacteria | 1036 |
| 740 | Ga0501084_1730254 | 3300054114 | Bacteria | 522 |
| 741 | Ga0590071_028216 | 3300059421 | Bacteria | 1333 |
| 742 | Ga0590071_119618 | 3300059421 | Bacteria | 672 |
| 743 | Ga0590074_043974 | 3300059423 | Bacteria | 808 |
| 744 | Ga0501082_0195728 | 3300060353 | Bacteria | 1758 |
| 745 | Ga0501082_0242248 | 3300060353 | Bacteria | 1569 |
| 746 | Ga0501082_0434965 | 3300060353 | Bacteria | 1146 |
| 747 | Ga0530510_1474843 | 3300061734 | Bacteria | 522 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050509 | nmdc:mga0qj67_1492090_c1 | nmdc:mga0qj67_1492090_c1_165_449 | 94 |
| 2 | 3300041512 | Ga0451853_1584074 | Ga0451853_1584074_383_670 | 95 |
| 3 | 3300042876 | Ga0451577_0127802 | Ga0451577_0127802_825_1112 | 95 |
| 4 | 3300044712 | Ga0453684_0567381 | Ga0453684_0567381_453_740 | 95 |
| 5 | 3300049575 | Ga0501039_1578220 | Ga0501039_1578220_173_460 | 95 |
| 6 | 3300049576 | Ga0501040_0375398 | Ga0501040_0375398_444_731 | 95 |
| 7 | 3300049578 | Ga0501042_0688382 | Ga0501042_0688382_310_597 | 95 |
| 8 | 3300049586 | Ga0501070_1213978 | Ga0501070_1213978_85_372 | 95 |
| 9 | 3300049588 | Ga0501072_0431751 | Ga0501072_0431751_111_398 | 95 |
| 10 | 3300049592 | Ga0501076_0147829 | Ga0501076_0147829_388_675 | 95 |
| 11 | 3300049593 | Ga0501077_0475093 | Ga0501077_0475093_432_719 | 95 |
| 12 | 3300049741 | Ga0501079_0221810 | Ga0501079_0221810_507_794 | 95 |
| 13 | 3300049742 | Ga0501080_0446479 | Ga0501080_0446479_577_864 | 95 |
| 14 | 3300049824 | Ga0501045_0705794 | Ga0501045_0705794_53_340 | 95 |
| 15 | 3300054114 | Ga0501084_0492221 | Ga0501084_0492221_522_809 | 95 |
| 16 | 3300060353 | Ga0501082_0242248 | Ga0501082_0242248_366_653 | 95 |
| 17 | 3300005471 | Ga0070698_100076682 | Ga0070698_1000766824 | 97 |
| 18 | 3300003373 | JGI25407J50210_10027374 | JGI25407J50210_100273742 | 98 |
| 19 | 3300004803 | Ga0058862_12018065 | Ga0058862_120180652 | 98 |
| 20 | 3300005327 | Ga0070658_11653618 | Ga0070658_116536182 | 98 |
| 21 | 3300005329 | Ga0070683_100047912 | Ga0070683_1000479124 | 98 |
| 22 | 3300005330 | Ga0070690_100337367 | Ga0070690_1003373671 | 98 |
| 23 | 3300005330 | Ga0070690_100532474 | Ga0070690_1005324742 | 98 |
| 24 | 3300005330 | Ga0070690_100835381 | Ga0070690_1008353811 | 98 |
| 25 | 3300005333 | Ga0070677_10650010 | Ga0070677_106500102 | 98 |
| 26 | 3300005334 | Ga0068869_100018892 | Ga0068869_1000188922 | 98 |
| 27 | 3300005334 | Ga0068869_100113757 | Ga0068869_1001137571 | 98 |
| 28 | 3300005334 | Ga0068869_100555449 | Ga0068869_1005554493 | 98 |
| 29 | 3300005335 | Ga0070666_10078455 | Ga0070666_100784554 | 98 |
| 30 | 3300005335 | Ga0070666_10399349 | Ga0070666_103993492 | 98 |
| 31 | 3300005335 | Ga0070666_10555314 | Ga0070666_105553142 | 98 |
| 32 | 3300005336 | Ga0070680_100068624 | Ga0070680_1000686244 | 98 |
| 33 | 3300005336 | Ga0070680_100407166 | Ga0070680_1004071662 | 98 |
| 34 | 3300005337 | Ga0070682_100423416 | Ga0070682_1004234162 | 98 |
| 35 | 3300005338 | Ga0068868_100057907 | Ga0068868_1000579074 | 98 |
| 36 | 3300005338 | Ga0068868_100595569 | Ga0068868_1005955692 | 98 |
| 37 | 3300005339 | Ga0070660_100150544 | Ga0070660_1001505442 | 98 |
| 38 | 3300005339 | Ga0070660_100373963 | Ga0070660_1003739632 | 98 |
| 39 | 3300005340 | Ga0070689_100051129 | Ga0070689_1000511292 | 98 |
| 40 | 3300005340 | Ga0070689_100059453 | Ga0070689_1000594532 | 98 |
| 41 | 3300005340 | Ga0070689_100890077 | Ga0070689_1008900772 | 98 |
| 42 | 3300005340 | Ga0070689_100969010 | Ga0070689_1009690101 | 98 |
| 43 | 3300005341 | Ga0070691_10516839 | Ga0070691_105168391 | 98 |
| 44 | 3300005341 | Ga0070691_11075777 | Ga0070691_110757771 | 98 |
| 45 | 3300005343 | Ga0070687_100029280 | Ga0070687_1000292803 | 98 |
| 46 | 3300005343 | Ga0070687_101378880 | Ga0070687_1013788801 | 98 |
| 47 | 3300005345 | Ga0070692_10033655 | Ga0070692_100336553 | 98 |
| 48 | 3300005345 | Ga0070692_10584411 | Ga0070692_105844112 | 98 |
| 49 | 3300005347 | Ga0070668_100767351 | Ga0070668_1007673512 | 98 |
| 50 | 3300005347 | Ga0070668_100881089 | Ga0070668_1008810892 | 98 |
| 51 | 3300005353 | Ga0070669_100072401 | Ga0070669_1000724013 | 98 |
| 52 | 3300005353 | Ga0070669_101858442 | Ga0070669_1018584421 | 98 |
| 53 | 3300005354 | Ga0070675_100812546 | Ga0070675_1008125461 | 98 |
| 54 | 3300005355 | Ga0070671_101525621 | Ga0070671_1015256211 | 98 |
| 55 | 3300005356 | Ga0070674_100015560 | Ga0070674_1000155604 | 98 |
| 56 | 3300005356 | Ga0070674_100435832 | Ga0070674_1004358322 | 98 |
| 57 | 3300005364 | Ga0070673_100087869 | Ga0070673_1000878693 | 98 |
| 58 | 3300005364 | Ga0070673_100297542 | Ga0070673_1002975423 | 98 |
| 59 | 3300005364 | Ga0070673_101003114 | Ga0070673_1010031141 | 98 |
| 60 | 3300005364 | Ga0070673_101591364 | Ga0070673_1015913641 | 98 |
| 61 | 3300005365 | Ga0070688_100043817 | Ga0070688_1000438173 | 98 |
| 62 | 3300005366 | Ga0070659_100067384 | Ga0070659_1000673842 | 98 |
| 63 | 3300005366 | Ga0070659_100420793 | Ga0070659_1004207931 | 98 |
| 64 | 3300005366 | Ga0070659_100971426 | Ga0070659_1009714262 | 98 |
| 65 | 3300005366 | Ga0070659_101040552 | Ga0070659_1010405522 | 98 |
| 66 | 3300005367 | Ga0070667_100062122 | Ga0070667_1000621221 | 98 |
| 67 | 3300005367 | Ga0070667_100770141 | Ga0070667_1007701411 | 98 |
| 68 | 3300005367 | Ga0070667_101635510 | Ga0070667_1016355102 | 98 |
| 69 | 3300005406 | Ga0070703_10280199 | Ga0070703_102801992 | 98 |
| 70 | 3300005434 | Ga0070709_10343032 | Ga0070709_103430323 | 98 |
| 71 | 3300005434 | Ga0070709_10370451 | Ga0070709_103704511 | 98 |
| 72 | 3300005435 | Ga0070714_100602137 | Ga0070714_1006021372 | 98 |
| 73 | 3300005436 | Ga0070713_100717188 | Ga0070713_1007171882 | 98 |
| 74 | 3300005438 | Ga0070701_10259489 | Ga0070701_102594892 | 98 |
| 75 | 3300005438 | Ga0070701_10322017 | Ga0070701_103220172 | 98 |
| 76 | 3300005440 | Ga0070705_100103125 | Ga0070705_1001031252 | 98 |
| 77 | 3300005441 | Ga0070700_100142337 | Ga0070700_1001423372 | 98 |
| 78 | 3300005441 | Ga0070700_100899397 | Ga0070700_1008993972 | 98 |
| 79 | 3300005441 | Ga0070700_101078231 | Ga0070700_1010782312 | 98 |
| 80 | 3300005444 | Ga0070694_100114193 | Ga0070694_1001141932 | 98 |
| 81 | 3300005444 | Ga0070694_100262806 | Ga0070694_1002628062 | 98 |
| 82 | 3300005444 | Ga0070694_101558899 | Ga0070694_1015588991 | 98 |
| 83 | 3300005445 | Ga0070708_100034155 | Ga0070708_1000341555 | 98 |
| 84 | 3300005445 | Ga0070708_100234236 | Ga0070708_1002342362 | 98 |
| 85 | 3300005445 | Ga0070708_101917463 | Ga0070708_1019174631 | 98 |
| 86 | 3300005455 | Ga0070663_100040086 | Ga0070663_1000400864 | 98 |
| 87 | 3300005455 | Ga0070663_101231440 | Ga0070663_1012314402 | 98 |
| 88 | 3300005456 | Ga0070678_100168479 | Ga0070678_1001684792 | 98 |
| 89 | 3300005456 | Ga0070678_100202372 | Ga0070678_1002023722 | 98 |
| 90 | 3300005456 | Ga0070678_100432739 | Ga0070678_1004327392 | 98 |
| 91 | 3300005456 | Ga0070678_100974825 | Ga0070678_1009748252 | 98 |
| 92 | 3300005457 | Ga0070662_100720922 | Ga0070662_1007209221 | 98 |
| 93 | 3300005458 | Ga0070681_10361376 | Ga0070681_103613762 | 98 |
| 94 | 3300005458 | Ga0070681_10875172 | Ga0070681_108751722 | 98 |
| 95 | 3300005459 | Ga0068867_100108454 | Ga0068867_1001084543 | 98 |
| 96 | 3300005459 | Ga0068867_101046177 | Ga0068867_1010461771 | 98 |
| 97 | 3300005466 | Ga0070685_10218033 | Ga0070685_102180333 | 98 |
| 98 | 3300005467 | Ga0070706_100252468 | Ga0070706_1002524682 | 98 |
| 99 | 3300005467 | Ga0070706_100326300 | Ga0070706_1003263002 | 98 |
| 100 | 3300005468 | Ga0070707_100200634 | Ga0070707_1002006343 | 98 |
| 101 | 3300005468 | Ga0070707_100255373 | Ga0070707_1002553732 | 98 |
| 102 | 3300005468 | Ga0070707_100333729 | Ga0070707_1003337292 | 98 |
| 103 | 3300005468 | Ga0070707_101081871 | Ga0070707_1010818712 | 98 |
| 104 | 3300005471 | Ga0070698_100096058 | Ga0070698_1000960584 | 98 |
| 105 | 3300005471 | Ga0070698_100586290 | Ga0070698_1005862901 | 98 |
| 106 | 3300005471 | Ga0070698_100913883 | Ga0070698_1009138831 | 98 |
| 107 | 3300005471 | Ga0070698_101252050 | Ga0070698_1012520501 | 98 |
| 108 | 3300005518 | Ga0070699_100000430 | Ga0070699_10000043013 | 98 |
| 109 | 3300005518 | Ga0070699_101493485 | Ga0070699_1014934851 | 98 |
| 110 | 3300005530 | Ga0070679_100501595 | Ga0070679_1005015952 | 98 |
| 111 | 3300005535 | Ga0070684_100226725 | Ga0070684_1002267252 | 98 |
| 112 | 3300005535 | Ga0070684_100294699 | Ga0070684_1002946992 | 98 |
| 113 | 3300005536 | Ga0070697_100175009 | Ga0070697_1001750093 | 98 |
| 114 | 3300005536 | Ga0070697_100316271 | Ga0070697_1003162712 | 98 |
| 115 | 3300005536 | Ga0070697_100527028 | Ga0070697_1005270282 | 98 |
| 116 | 3300005536 | Ga0070697_101879045 | Ga0070697_1018790451 | 98 |
| 117 | 3300005543 | Ga0070672_101582558 | Ga0070672_1015825582 | 98 |
| 118 | 3300005544 | Ga0070686_100026390 | Ga0070686_1000263901 | 98 |
| 119 | 3300005544 | Ga0070686_100154777 | Ga0070686_1001547772 | 98 |
| 120 | 3300005544 | Ga0070686_101076133 | Ga0070686_1010761331 | 98 |
| 121 | 3300005544 | Ga0070686_101376255 | Ga0070686_1013762551 | 98 |
| 122 | 3300005545 | Ga0070695_100364242 | Ga0070695_1003642422 | 98 |
| 123 | 3300005545 | Ga0070695_100573694 | Ga0070695_1005736942 | 98 |
| 124 | 3300005545 | Ga0070695_100729012 | Ga0070695_1007290122 | 98 |
| 125 | 3300005546 | Ga0070696_100076940 | Ga0070696_1000769402 | 98 |
| 126 | 3300005546 | Ga0070696_100084323 | Ga0070696_1000843232 | 98 |
| 127 | 3300005547 | Ga0070693_100114322 | Ga0070693_1001143222 | 98 |
| 128 | 3300005547 | Ga0070693_100376107 | Ga0070693_1003761072 | 98 |
| 129 | 3300005547 | Ga0070693_100678182 | Ga0070693_1006781821 | 98 |
| 130 | 3300005548 | Ga0070665_100110862 | Ga0070665_1001108622 | 98 |
| 131 | 3300005548 | Ga0070665_100270778 | Ga0070665_1002707782 | 98 |
| 132 | 3300005548 | Ga0070665_100352147 | Ga0070665_1003521473 | 98 |
| 133 | 3300005548 | Ga0070665_101243394 | Ga0070665_1012433942 | 98 |
| 134 | 3300005549 | Ga0070704_100434803 | Ga0070704_1004348032 | 98 |
| 135 | 3300005563 | Ga0068855_100294244 | Ga0068855_1002942442 | 98 |
| 136 | 3300005564 | Ga0070664_100580401 | Ga0070664_1005804012 | 98 |
| 137 | 3300005564 | Ga0070664_101232296 | Ga0070664_1012322961 | 98 |
| 138 | 3300005577 | Ga0068857_100050616 | Ga0068857_1000506162 | 98 |
| 139 | 3300005577 | Ga0068857_100260412 | Ga0068857_1002604122 | 98 |
| 140 | 3300005578 | Ga0068854_100151760 | Ga0068854_1001517602 | 98 |
| 141 | 3300005578 | Ga0068854_101739402 | Ga0068854_1017394021 | 98 |
| 142 | 3300005615 | Ga0070702_100019763 | Ga0070702_1000197633 | 98 |
| 143 | 3300005615 | Ga0070702_100050912 | Ga0070702_1000509122 | 98 |
| 144 | 3300005615 | Ga0070702_100248584 | Ga0070702_1002485842 | 98 |
| 145 | 3300005615 | Ga0070702_100518801 | Ga0070702_1005188012 | 98 |
| 146 | 3300005616 | Ga0068852_100771446 | Ga0068852_1007714462 | 98 |
| 147 | 3300005616 | Ga0068852_102074813 | Ga0068852_1020748132 | 98 |
| 148 | 3300005617 | Ga0068859_100062593 | Ga0068859_1000625933 | 98 |
| 149 | 3300005617 | Ga0068859_100083297 | Ga0068859_1000832974 | 98 |
| 150 | 3300005618 | Ga0068864_100040791 | Ga0068864_1000407912 | 98 |
| 151 | 3300005618 | Ga0068864_100098562 | Ga0068864_1000985624 | 98 |
| 152 | 3300005618 | Ga0068864_101058101 | Ga0068864_1010581012 | 98 |
| 153 | 3300005718 | Ga0068866_10046246 | Ga0068866_100462462 | 98 |
| 154 | 3300005718 | Ga0068866_10311574 | Ga0068866_103115743 | 98 |
| 155 | 3300005719 | Ga0068861_100433729 | Ga0068861_1004337292 | 98 |
| 156 | 3300005719 | Ga0068861_101233154 | Ga0068861_1012331542 | 98 |
| 157 | 3300005834 | Ga0068851_10537432 | Ga0068851_105374322 | 98 |
| 158 | 3300005840 | Ga0068870_10051373 | Ga0068870_100513733 | 98 |
| 159 | 3300005841 | Ga0068863_100011064 | Ga0068863_1000110641 | 98 |
| 160 | 3300005841 | Ga0068863_100132718 | Ga0068863_1001327184 | 98 |
| 161 | 3300005841 | Ga0068863_100396373 | Ga0068863_1003963732 | 98 |
| 162 | 3300005842 | Ga0068858_100071919 | Ga0068858_1000719193 | 98 |
| 163 | 3300005842 | Ga0068858_100831434 | Ga0068858_1008314343 | 98 |
| 164 | 3300005843 | Ga0068860_100105181 | Ga0068860_1001051812 | 98 |
| 165 | 3300005843 | Ga0068860_100264454 | Ga0068860_1002644542 | 98 |
| 166 | 3300005843 | Ga0068860_100930565 | Ga0068860_1009305651 | 98 |
| 167 | 3300005844 | Ga0068862_100005233 | Ga0068862_1000052335 | 98 |
| 168 | 3300005844 | Ga0068862_100110044 | Ga0068862_1001100444 | 98 |
| 169 | 3300005844 | Ga0068862_100381382 | Ga0068862_1003813822 | 98 |
| 170 | 3300005844 | Ga0068862_101454712 | Ga0068862_1014547122 | 98 |
| 171 | 3300005937 | Ga0081455_10044558 | Ga0081455_100445582 | 98 |
| 172 | 3300005981 | Ga0081538_10006544 | Ga0081538_100065444 | 98 |
| 173 | 3300006042 | Ga0075368_10015259 | Ga0075368_100152592 | 98 |
| 174 | 3300006048 | Ga0075363_100172374 | Ga0075363_1001723742 | 98 |
| 175 | 3300006051 | Ga0075364_10129731 | Ga0075364_101297314 | 98 |
| 176 | 3300006051 | Ga0075364_10173128 | Ga0075364_101731282 | 98 |
| 177 | 3300006051 | Ga0075364_10499032 | Ga0075364_104990322 | 98 |
| 178 | 3300006163 | Ga0070715_10065779 | Ga0070715_100657792 | 98 |
| 179 | 3300006163 | Ga0070715_10352860 | Ga0070715_103528602 | 98 |
| 180 | 3300006175 | Ga0070712_100573964 | Ga0070712_1005739642 | 98 |
| 181 | 3300006175 | Ga0070712_101249769 | Ga0070712_1012497692 | 98 |
| 182 | 3300006237 | Ga0097621_101396939 | Ga0097621_1013969391 | 98 |
| 183 | 3300006358 | Ga0068871_100209078 | Ga0068871_1002090783 | 98 |
| 184 | 3300006358 | Ga0068871_101051095 | Ga0068871_1010510952 | 98 |
| 185 | 3300006844 | Ga0075428_100099399 | Ga0075428_1000993992 | 98 |
| 186 | 3300006844 | Ga0075428_100344566 | Ga0075428_1003445662 | 98 |
| 187 | 3300006844 | Ga0075428_100723981 | Ga0075428_1007239812 | 98 |
| 188 | 3300006846 | Ga0075430_100336253 | Ga0075430_1003362532 | 98 |
| 189 | 3300006846 | Ga0075430_100336749 | Ga0075430_1003367492 | 98 |
| 190 | 3300006847 | Ga0075431_100009287 | Ga0075431_1000092875 | 98 |
| 191 | 3300006847 | Ga0075431_100375312 | Ga0075431_1003753122 | 98 |
| 192 | 3300006847 | Ga0075431_101173413 | Ga0075431_1011734132 | 98 |
| 193 | 3300006847 | Ga0075431_101343425 | Ga0075431_1013434252 | 98 |
| 194 | 3300006852 | Ga0075433_10002569 | Ga0075433_100025693 | 98 |
| 195 | 3300006852 | Ga0075433_10036320 | Ga0075433_100363202 | 98 |
| 196 | 3300006852 | Ga0075433_10042835 | Ga0075433_100428354 | 98 |
| 197 | 3300006852 | Ga0075433_10330015 | Ga0075433_103300152 | 98 |
| 198 | 3300006852 | Ga0075433_10590948 | Ga0075433_105909482 | 98 |
| 199 | 3300006852 | Ga0075433_10977575 | Ga0075433_109775752 | 98 |
| 200 | 3300006871 | Ga0075434_100002609 | Ga0075434_10000260912 | 98 |
| 201 | 3300006871 | Ga0075434_100056895 | Ga0075434_1000568953 | 98 |
| 202 | 3300006871 | Ga0075434_100071338 | Ga0075434_1000713385 | 98 |
| 203 | 3300006871 | Ga0075434_100141283 | Ga0075434_1001412832 | 98 |
| 204 | 3300006871 | Ga0075434_100460369 | Ga0075434_1004603693 | 98 |
| 205 | 3300006871 | Ga0075434_100904324 | Ga0075434_1009043242 | 98 |
| 206 | 3300006871 | Ga0075434_102001061 | Ga0075434_1020010612 | 98 |
| 207 | 3300006880 | Ga0075429_100238276 | Ga0075429_1002382763 | 98 |
| 208 | 3300006880 | Ga0075429_100777582 | Ga0075429_1007775822 | 98 |
| 209 | 3300006881 | Ga0068865_100056759 | Ga0068865_1000567592 | 98 |
| 210 | 3300006881 | Ga0068865_100076261 | Ga0068865_1000762612 | 98 |
| 211 | 3300006914 | Ga0075436_100088038 | Ga0075436_1000880382 | 98 |
| 212 | 3300006914 | Ga0075436_100804826 | Ga0075436_1008048262 | 98 |
| 213 | 3300006914 | Ga0075436_100907250 | Ga0075436_1009072502 | 98 |
| 214 | 3300006914 | Ga0075436_101147613 | Ga0075436_1011476131 | 98 |
| 215 | 3300006931 | Ga0097620_100062588 | Ga0097620_1000625883 | 98 |
| 216 | 3300006931 | Ga0097620_100083293 | Ga0097620_1000832932 | 98 |
| 217 | 3300007076 | Ga0075435_100029936 | Ga0075435_1000299365 | 98 |
| 218 | 3300007076 | Ga0075435_100051448 | Ga0075435_1000514482 | 98 |
| 219 | 3300007788 | Ga0099795_10073275 | Ga0099795_100732752 | 98 |
| 220 | 3300009011 | Ga0105251_10065033 | Ga0105251_100650332 | 98 |
| 221 | 3300009092 | Ga0105250_10097186 | Ga0105250_100971862 | 98 |
| 222 | 3300009093 | Ga0105240_10706397 | Ga0105240_107063972 | 98 |
| 223 | 3300009093 | Ga0105240_11127665 | Ga0105240_111276652 | 98 |
| 224 | 3300009094 | Ga0111539_10000194 | Ga0111539_1000019439 | 98 |
| 225 | 3300009094 | Ga0111539_10001498 | Ga0111539_1000149817 | 98 |
| 226 | 3300009094 | Ga0111539_10061439 | Ga0111539_100614393 | 98 |
| 227 | 3300009094 | Ga0111539_10122025 | Ga0111539_101220254 | 98 |
| 228 | 3300009094 | Ga0111539_10126261 | Ga0111539_101262613 | 98 |
| 229 | 3300009094 | Ga0111539_10683240 | Ga0111539_106832402 | 98 |
| 230 | 3300009098 | Ga0105245_10483902 | Ga0105245_104839021 | 98 |
| 231 | 3300009101 | Ga0105247_10051200 | Ga0105247_100512005 | 98 |
| 232 | 3300009101 | Ga0105247_10485458 | Ga0105247_104854582 | 98 |
| 233 | 3300009147 | Ga0114129_10000202 | Ga0114129_1000020221 | 98 |
| 234 | 3300009147 | Ga0114129_10013693 | Ga0114129_100136934 | 98 |
| 235 | 3300009147 | Ga0114129_10408655 | Ga0114129_104086553 | 98 |
| 236 | 3300009147 | Ga0114129_10775013 | Ga0114129_107750132 | 98 |
| 237 | 3300009148 | Ga0105243_10565673 | Ga0105243_105656732 | 98 |
| 238 | 3300009174 | Ga0105241_10500545 | Ga0105241_105005452 | 98 |
| 239 | 3300009174 | Ga0105241_10778113 | Ga0105241_107781132 | 98 |
| 240 | 3300009176 | Ga0105242_10066717 | Ga0105242_100667171 | 98 |
| 241 | 3300009176 | Ga0105242_10112225 | Ga0105242_101122252 | 98 |
| 242 | 3300009177 | Ga0105248_10022143 | Ga0105248_100221432 | 98 |
| 243 | 3300009177 | Ga0105248_10870995 | Ga0105248_108709952 | 98 |
| 244 | 3300009177 | Ga0105248_13082926 | Ga0105248_130829261 | 98 |
| 245 | 3300009551 | Ga0105238_11823960 | Ga0105238_118239602 | 98 |
| 246 | 3300009553 | Ga0105249_10091821 | Ga0105249_100918213 | 98 |
| 247 | 3300009553 | Ga0105249_11223703 | Ga0105249_112237032 | 98 |
| 248 | 3300009553 | Ga0105249_11300191 | Ga0105249_113001912 | 98 |
| 249 | 3300009553 | Ga0105249_12275866 | Ga0105249_122758662 | 98 |
| 250 | 3300010159 | Ga0099796_10074199 | Ga0099796_100741991 | 98 |
| 251 | 3300010375 | Ga0105239_11488790 | Ga0105239_114887902 | 98 |
| 252 | 3300010375 | Ga0105239_13120003 | Ga0105239_131200032 | 98 |
| 253 | 3300011119 | Ga0105246_10068645 | Ga0105246_100686453 | 98 |
| 254 | 3300011119 | Ga0105246_10534256 | Ga0105246_105342562 | 98 |
| 255 | 3300011119 | Ga0105246_11842778 | Ga0105246_118427782 | 98 |
| 256 | 3300012476 | Ga0157344_1007132 | Ga0157344_10071322 | 98 |
| 257 | 3300012481 | Ga0157320_1003499 | Ga0157320_10034992 | 98 |
| 258 | 3300012482 | Ga0157318_1011096 | Ga0157318_10110962 | 98 |
| 259 | 3300012487 | Ga0157321_1007550 | Ga0157321_10075502 | 98 |
| 260 | 3300012488 | Ga0157343_1009691 | Ga0157343_10096912 | 98 |
| 261 | 3300012491 | Ga0157329_1035464 | Ga0157329_10354642 | 98 |
| 262 | 3300012492 | Ga0157335_1005386 | Ga0157335_10053862 | 98 |
| 263 | 3300012505 | Ga0157339_1002495 | Ga0157339_10024952 | 98 |
| 264 | 3300012506 | Ga0157324_1008976 | Ga0157324_10089762 | 98 |
| 265 | 3300013100 | Ga0157373_10159155 | Ga0157373_101591552 | 98 |
| 266 | 3300013102 | Ga0157371_10135320 | Ga0157371_101353202 | 98 |
| 267 | 3300013104 | Ga0157370_10099706 | Ga0157370_100997063 | 98 |
| 268 | 3300013105 | Ga0157369_12600543 | Ga0157369_126005432 | 98 |
| 269 | 3300013296 | Ga0157374_10064651 | Ga0157374_100646512 | 98 |
| 270 | 3300013297 | Ga0157378_10178196 | Ga0157378_101781963 | 98 |
| 271 | 3300013297 | Ga0157378_10488819 | Ga0157378_104888191 | 98 |
| 272 | 3300013297 | Ga0157378_11523665 | Ga0157378_115236652 | 98 |
| 273 | 3300013306 | Ga0163162_10096906 | Ga0163162_100969063 | 98 |
| 274 | 3300013306 | Ga0163162_11245502 | Ga0163162_112455022 | 98 |
| 275 | 3300013307 | Ga0157372_10820770 | Ga0157372_108207702 | 98 |
| 276 | 3300013308 | Ga0157375_10000044 | Ga0157375_1000004410 | 98 |
| 277 | 3300014326 | Ga0157380_10044642 | Ga0157380_100446422 | 98 |
| 278 | 3300014326 | Ga0157380_10198141 | Ga0157380_101981412 | 98 |
| 279 | 3300014326 | Ga0157380_11334317 | Ga0157380_113343172 | 98 |
| 280 | 3300014745 | Ga0157377_10076803 | Ga0157377_100768032 | 98 |
| 281 | 3300014745 | Ga0157377_10127396 | Ga0157377_101273962 | 98 |
| 282 | 3300014745 | Ga0157377_10711597 | Ga0157377_107115972 | 98 |
| 283 | 3300014969 | Ga0157376_11766137 | Ga0157376_117661372 | 98 |
| 284 | 3300017792 | Ga0163161_10074649 | Ga0163161_100746492 | 98 |
| 285 | 3300017792 | Ga0163161_10801867 | Ga0163161_108018672 | 98 |
| 286 | 3300020069 | Ga0197907_10320278 | Ga0197907_103202782 | 98 |
| 287 | 3300020070 | Ga0206356_11696130 | Ga0206356_116961302 | 98 |
| 288 | 3300020075 | Ga0206349_1872280 | Ga0206349_18722802 | 98 |
| 289 | 3300020077 | Ga0206351_10603668 | Ga0206351_106036682 | 98 |
| 290 | 3300020081 | Ga0206354_11405769 | Ga0206354_114057692 | 98 |
| 291 | 3300020082 | Ga0206353_11280459 | Ga0206353_112804593 | 98 |
| 292 | 3300021358 | Ga0213873_10034414 | Ga0213873_100344142 | 98 |
| 293 | 3300021361 | Ga0213872_10007568 | Ga0213872_100075685 | 98 |
| 294 | 3300021361 | Ga0213872_10374246 | Ga0213872_103742462 | 98 |
| 295 | 3300021388 | Ga0213875_10085213 | Ga0213875_100852132 | 98 |
| 296 | 3300021388 | Ga0213875_10141540 | Ga0213875_101415402 | 98 |
| 297 | 3300021441 | Ga0213871_10072137 | Ga0213871_100721372 | 98 |
| 298 | 3300022467 | Ga0224712_10130454 | Ga0224712_101304542 | 98 |
| 299 | 3300025321 | Ga0207656_10159519 | Ga0207656_101595192 | 98 |
| 300 | 3300025885 | Ga0207653_10035294 | Ga0207653_100352942 | 98 |
| 301 | 3300025893 | Ga0207682_10099631 | Ga0207682_100996312 | 98 |
| 302 | 3300025898 | Ga0207692_10208637 | Ga0207692_102086372 | 98 |
| 303 | 3300025898 | Ga0207692_10486570 | Ga0207692_104865701 | 98 |
| 304 | 3300025898 | Ga0207692_10495148 | Ga0207692_104951482 | 98 |
| 305 | 3300025899 | Ga0207642_10140512 | Ga0207642_101405122 | 98 |
| 306 | 3300025899 | Ga0207642_10775982 | Ga0207642_107759821 | 98 |
| 307 | 3300025900 | Ga0207710_10298885 | Ga0207710_102988851 | 98 |
| 308 | 3300025901 | Ga0207688_10089634 | Ga0207688_100896342 | 98 |
| 309 | 3300025903 | Ga0207680_10363727 | Ga0207680_103637272 | 98 |
| 310 | 3300025904 | Ga0207647_10189250 | Ga0207647_101892503 | 98 |
| 311 | 3300025905 | Ga0207685_10258203 | Ga0207685_102582032 | 98 |
| 312 | 3300025905 | Ga0207685_10311915 | Ga0207685_103119152 | 98 |
| 313 | 3300025906 | Ga0207699_10296241 | Ga0207699_102962412 | 98 |
| 314 | 3300025906 | Ga0207699_11200852 | Ga0207699_112008522 | 98 |
| 315 | 3300025907 | Ga0207645_10029872 | Ga0207645_100298722 | 98 |
| 316 | 3300025907 | Ga0207645_10148170 | Ga0207645_101481703 | 98 |
| 317 | 3300025908 | Ga0207643_10012368 | Ga0207643_100123684 | 98 |
| 318 | 3300025908 | Ga0207643_10181470 | Ga0207643_101814703 | 98 |
| 319 | 3300025909 | Ga0207705_10855526 | Ga0207705_108555262 | 98 |
| 320 | 3300025909 | Ga0207705_10956206 | Ga0207705_109562062 | 98 |
| 321 | 3300025910 | Ga0207684_10032484 | Ga0207684_100324843 | 98 |
| 322 | 3300025910 | Ga0207684_10274759 | Ga0207684_102747592 | 98 |
| 323 | 3300025910 | Ga0207684_10954132 | Ga0207684_109541322 | 98 |
| 324 | 3300025910 | Ga0207684_11739296 | Ga0207684_117392961 | 98 |
| 325 | 3300025911 | Ga0207654_10677488 | Ga0207654_106774882 | 98 |
| 326 | 3300025912 | Ga0207707_11099979 | Ga0207707_110999792 | 98 |
| 327 | 3300025912 | Ga0207707_11262127 | Ga0207707_112621272 | 98 |
| 328 | 3300025913 | Ga0207695_11355160 | Ga0207695_113551601 | 98 |
| 329 | 3300025914 | Ga0207671_11020117 | Ga0207671_110201171 | 98 |
| 330 | 3300025915 | Ga0207693_10062680 | Ga0207693_100626802 | 98 |
| 331 | 3300025915 | Ga0207693_10516800 | Ga0207693_105168002 | 98 |
| 332 | 3300025916 | Ga0207663_10515818 | Ga0207663_105158182 | 98 |
| 333 | 3300025917 | Ga0207660_11189277 | Ga0207660_111892772 | 98 |
| 334 | 3300025918 | Ga0207662_10011179 | Ga0207662_100111794 | 98 |
| 335 | 3300025918 | Ga0207662_10380031 | Ga0207662_103800311 | 98 |
| 336 | 3300025918 | Ga0207662_10683174 | Ga0207662_106831742 | 98 |
| 337 | 3300025919 | Ga0207657_10036867 | Ga0207657_100368674 | 98 |
| 338 | 3300025919 | Ga0207657_10341548 | Ga0207657_103415482 | 98 |
| 339 | 3300025920 | Ga0207649_10546472 | Ga0207649_105464722 | 98 |
| 340 | 3300025920 | Ga0207649_10598831 | Ga0207649_105988311 | 98 |
| 341 | 3300025922 | Ga0207646_10022911 | Ga0207646_100229114 | 98 |
| 342 | 3300025922 | Ga0207646_10039940 | Ga0207646_100399402 | 98 |
| 343 | 3300025922 | Ga0207646_10136340 | Ga0207646_101363402 | 98 |
| 344 | 3300025922 | Ga0207646_10177937 | Ga0207646_101779372 | 98 |
| 345 | 3300025922 | Ga0207646_10297630 | Ga0207646_102976303 | 98 |
| 346 | 3300025922 | Ga0207646_11451591 | Ga0207646_114515912 | 98 |
| 347 | 3300025923 | Ga0207681_10784289 | Ga0207681_107842892 | 98 |
| 348 | 3300025923 | Ga0207681_11552385 | Ga0207681_115523851 | 98 |
| 349 | 3300025926 | Ga0207659_10099495 | Ga0207659_100994953 | 98 |
| 350 | 3300025926 | Ga0207659_10225682 | Ga0207659_102256822 | 98 |
| 351 | 3300025927 | Ga0207687_10638805 | Ga0207687_106388052 | 98 |
| 352 | 3300025929 | Ga0207664_10001895 | Ga0207664_100018958 | 98 |
| 353 | 3300025929 | Ga0207664_10130655 | Ga0207664_101306554 | 98 |
| 354 | 3300025929 | Ga0207664_11537640 | Ga0207664_115376401 | 98 |
| 355 | 3300025932 | Ga0207690_10205107 | Ga0207690_102051072 | 98 |
| 356 | 3300025932 | Ga0207690_10301812 | Ga0207690_103018122 | 98 |
| 357 | 3300025932 | Ga0207690_11044095 | Ga0207690_110440951 | 98 |
| 358 | 3300025933 | Ga0207706_10032639 | Ga0207706_100326396 | 98 |
| 359 | 3300025935 | Ga0207709_10075384 | Ga0207709_100753842 | 98 |
| 360 | 3300025936 | Ga0207670_10239006 | Ga0207670_102390062 | 98 |
| 361 | 3300025936 | Ga0207670_10540067 | Ga0207670_105400672 | 98 |
| 362 | 3300025937 | Ga0207669_10054530 | Ga0207669_100545302 | 98 |
| 363 | 3300025938 | Ga0207704_10100222 | Ga0207704_101002223 | 98 |
| 364 | 3300025938 | Ga0207704_11345930 | Ga0207704_113459302 | 98 |
| 365 | 3300025939 | Ga0207665_10279602 | Ga0207665_102796021 | 98 |
| 366 | 3300025940 | Ga0207691_10258894 | Ga0207691_102588942 | 98 |
| 367 | 3300025941 | Ga0207711_10366635 | Ga0207711_103666352 | 98 |
| 368 | 3300025941 | Ga0207711_11437841 | Ga0207711_114378412 | 98 |
| 369 | 3300025942 | Ga0207689_10017369 | Ga0207689_100173695 | 98 |
| 370 | 3300025942 | Ga0207689_10029324 | Ga0207689_100293245 | 98 |
| 371 | 3300025942 | Ga0207689_10365124 | Ga0207689_103651242 | 98 |
| 372 | 3300025945 | Ga0207679_10700298 | Ga0207679_107002982 | 98 |
| 373 | 3300025945 | Ga0207679_11336867 | Ga0207679_113368671 | 98 |
| 374 | 3300025949 | Ga0207667_10629307 | Ga0207667_106293072 | 98 |
| 375 | 3300025960 | Ga0207651_10947804 | Ga0207651_109478042 | 98 |
| 376 | 3300025972 | Ga0207668_10475637 | Ga0207668_104756372 | 98 |
| 377 | 3300025972 | Ga0207668_10483634 | Ga0207668_104836342 | 98 |
| 378 | 3300025981 | Ga0207640_10991597 | Ga0207640_109915972 | 98 |
| 379 | 3300025986 | Ga0207658_10141206 | Ga0207658_101412062 | 98 |
| 380 | 3300025986 | Ga0207658_10513212 | Ga0207658_105132122 | 98 |
| 381 | 3300025986 | Ga0207658_10657272 | Ga0207658_106572722 | 98 |
| 382 | 3300025986 | Ga0207658_11102893 | Ga0207658_111028932 | 98 |
| 383 | 3300026023 | Ga0207677_10336713 | Ga0207677_103367132 | 98 |
| 384 | 3300026035 | Ga0207703_10665861 | Ga0207703_106658612 | 98 |
| 385 | 3300026035 | Ga0207703_11128102 | Ga0207703_111281022 | 98 |
| 386 | 3300026067 | Ga0207678_10023885 | Ga0207678_100238855 | 98 |
| 387 | 3300026067 | Ga0207678_10113678 | Ga0207678_101136783 | 98 |
| 388 | 3300026075 | Ga0207708_10032856 | Ga0207708_100328565 | 98 |
| 389 | 3300026075 | Ga0207708_10204788 | Ga0207708_102047882 | 98 |
| 390 | 3300026078 | Ga0207702_10084142 | Ga0207702_100841424 | 98 |
| 391 | 3300026078 | Ga0207702_10171984 | Ga0207702_101719843 | 98 |
| 392 | 3300026088 | Ga0207641_10277686 | Ga0207641_102776863 | 98 |
| 393 | 3300026088 | Ga0207641_10681171 | Ga0207641_106811711 | 98 |
| 394 | 3300026089 | Ga0207648_10001929 | Ga0207648_100019292 | 98 |
| 395 | 3300026089 | Ga0207648_10622104 | Ga0207648_106221042 | 98 |
| 396 | 3300026095 | Ga0207676_10018645 | Ga0207676_100186454 | 98 |
| 397 | 3300026095 | Ga0207676_10258056 | Ga0207676_102580562 | 98 |
| 398 | 3300026095 | Ga0207676_11162440 | Ga0207676_111624402 | 98 |
| 399 | 3300026116 | Ga0207674_10045402 | Ga0207674_100454022 | 98 |
| 400 | 3300026116 | Ga0207674_10125035 | Ga0207674_101250352 | 98 |
| 401 | 3300026118 | Ga0207675_100026059 | Ga0207675_1000260593 | 98 |
| 402 | 3300026118 | Ga0207675_100071149 | Ga0207675_1000711493 | 98 |
| 403 | 3300026121 | Ga0207683_10022689 | Ga0207683_100226895 | 98 |
| 404 | 3300026121 | Ga0207683_10065647 | Ga0207683_100656472 | 98 |
| 405 | 3300026121 | Ga0207683_10147535 | Ga0207683_101475353 | 98 |
| 406 | 3300026121 | Ga0207683_10972843 | Ga0207683_109728432 | 98 |
| 407 | 3300027907 | Ga0207428_10000365 | Ga0207428_100003653 | 98 |
| 408 | 3300027907 | Ga0207428_10006355 | Ga0207428_1000635512 | 98 |
| 409 | 3300027907 | Ga0207428_10239132 | Ga0207428_102391322 | 98 |
| 410 | 3300027907 | Ga0207428_10372554 | Ga0207428_103725542 | 98 |
| 411 | 3300028379 | Ga0268266_10965884 | Ga0268266_109658842 | 98 |
| 412 | 3300028379 | Ga0268266_11257199 | Ga0268266_112571991 | 98 |
| 413 | 3300028379 | Ga0268266_11585754 | Ga0268266_115857541 | 98 |
| 414 | 3300028380 | Ga0268265_10022401 | Ga0268265_100224015 | 98 |
| 415 | 3300028380 | Ga0268265_10082547 | Ga0268265_100825473 | 98 |
| 416 | 3300028380 | Ga0268265_10113603 | Ga0268265_101136034 | 98 |
| 417 | 3300028381 | Ga0268264_10205579 | Ga0268264_102055793 | 98 |
| 418 | 3300028381 | Ga0268264_11310715 | Ga0268264_113107152 | 98 |
| 419 | 3300028800 | Ga0265338_10136743 | Ga0265338_101367432 | 98 |
| 420 | 3300031235 | Ga0265330_10009451 | Ga0265330_100094515 | 98 |
| 421 | 3300031235 | Ga0265330_10269737 | Ga0265330_102697371 | 98 |
| 422 | 3300031238 | Ga0265332_10000044 | Ga0265332_1000004450 | 98 |
| 423 | 3300031239 | Ga0265328_10002340 | Ga0265328_100023401 | 98 |
| 424 | 3300031240 | Ga0265320_10274588 | Ga0265320_102745881 | 98 |
| 425 | 3300031241 | Ga0265325_10152569 | Ga0265325_101525692 | 98 |
| 426 | 3300031241 | Ga0265325_10353035 | Ga0265325_103530351 | 98 |
| 427 | 3300031242 | Ga0265329_10013927 | Ga0265329_100139272 | 98 |
| 428 | 3300031247 | Ga0265340_10087798 | Ga0265340_100877982 | 98 |
| 429 | 3300031249 | Ga0265339_10163001 | Ga0265339_101630012 | 98 |
| 430 | 3300031250 | Ga0265331_10000076 | Ga0265331_10000076115 | 98 |
| 431 | 3300031251 | Ga0265327_10084672 | Ga0265327_100846723 | 98 |
| 432 | 3300031344 | Ga0265316_10000006 | Ga0265316_10000006131 | 98 |
| 433 | 3300031344 | Ga0265316_10212482 | Ga0265316_102124822 | 98 |
| 434 | 3300031344 | Ga0265316_10256745 | Ga0265316_102567451 | 98 |
| 435 | 3300031548 | Ga0307408_100474096 | Ga0307408_1004740962 | 98 |
| 436 | 3300031711 | Ga0265314_10000056 | Ga0265314_1000005679 | 98 |
| 437 | 3300031711 | Ga0265314_10020912 | Ga0265314_100209124 | 98 |
| 438 | 3300031712 | Ga0265342_10003118 | Ga0265342_100031183 | 98 |
| 439 | 3300031712 | Ga0265342_10014410 | Ga0265342_100144106 | 98 |
| 440 | 3300031712 | Ga0265342_10040407 | Ga0265342_100404073 | 98 |
| 441 | 3300031727 | Ga0316576_10035276 | Ga0316576_100352762 | 98 |
| 442 | 3300031728 | Ga0316578_10849739 | Ga0316578_108497391 | 98 |
| 443 | 3300031731 | Ga0307405_12046167 | Ga0307405_120461672 | 98 |
| 444 | 3300031733 | Ga0316577_10562014 | Ga0316577_105620142 | 98 |
| 445 | 3300031903 | Ga0307407_10146717 | Ga0307407_101467172 | 98 |
| 446 | 3300032002 | Ga0307416_103097136 | Ga0307416_1030971362 | 98 |
| 447 | 3300033524 | Ga0316592_1149623 | Ga0316592_11496231 | 98 |
| 448 | 3300034816 | Ga0373930_0035367 | Ga0373930_0035367_227_541 | 98 |
| 449 | 3300034820 | Ga0373959_0062089 | Ga0373959_0062089_32_346 | 98 |
| 450 | 3300035083 | Ga0373926_0173394 | Ga0373926_0173394_375_671 | 98 |
| 451 | 3300035085 | Ga0373929_0213774 | Ga0373929_0213774_223_522 | 98 |
| 452 | 3300035086 | Ga0373934_0438086 | Ga0373934_0438086_208_504 | 98 |
| 453 | 3300035089 | Ga0373944_0029762 | Ga0373944_0029762_801_1115 | 98 |
| 454 | 3300035091 | Ga0373951_0061629 | Ga0373951_0061629_195_509 | 98 |
| 455 | 3300035111 | Ga0373923_0257853 | Ga0373923_0257853_196_510 | 98 |
| 456 | 3300035112 | Ga0373932_0065659 | Ga0373932_0065659_103_417 | 98 |
| 457 | 3300035113 | Ga0373936_0000641 | Ga0373936_0000641_11198_11512 | 98 |
| 458 | 3300035113 | Ga0373936_0072518 | Ga0373936_0072518_211_507 | 98 |
| 459 | 3300035113 | Ga0373936_0635535 | Ga0373936_0635535_66_380 | 98 |
| 460 | 3300035114 | Ga0373939_0011143 | Ga0373939_0011143_128_442 | 98 |
| 461 | 3300035114 | Ga0373939_0336595 | Ga0373939_0336595_286_585 | 98 |
| 462 | 3300035116 | Ga0373945_0035869 | Ga0373945_0035869_1200_1514 | 98 |
| 463 | 3300035117 | Ga0373953_0007993 | Ga0373953_0007993_3235_3549 | 98 |
| 464 | 3300035118 | Ga0373954_0026950 | Ga0373954_0026950_1871_2185 | 98 |
| 465 | 3300035120 | Ga0373957_0038512 | Ga0373957_0038512_387_701 | 98 |
| 466 | 3300035120 | Ga0373957_0526068 | Ga0373957_0526068_55_369 | 98 |
| 467 | 3300035121 | Ga0373960_0040444 | Ga0373960_0040444_397_711 | 98 |
| 468 | 3300035170 | Ga0373943_0009965 | Ga0373943_0009965_984_1298 | 98 |
| 469 | 3300035170 | Ga0373943_0218876 | Ga0373943_0218876_676_972 | 98 |
| 470 | 3300035171 | Ga0373946_0192679 | Ga0373946_0192679_648_944 | 98 |
| 471 | 3300035171 | Ga0373946_0341019 | Ga0373946_0341019_86_400 | 98 |
| 472 | 3300035172 | Ga0373955_0097009 | Ga0373955_0097009_1112_1426 | 98 |
| 473 | 3300035241 | Ga0373961_0055565 | Ga0373961_0055565_642_956 | 98 |
| 474 | 3300035410 | Ga0373924_0017999 | Ga0373924_0017999_1125_1439 | 98 |
| 475 | 3300035410 | Ga0373924_0496965 | Ga0373924_0496965_158_454 | 98 |
| 476 | 3300035691 | Ga0373931_0067194 | Ga0373931_0067194_842_1156 | 98 |
| 477 | 3300035692 | Ga0373935_0040709 | Ga0373935_0040709_756_1070 | 98 |
| 478 | 3300035692 | Ga0373935_0131306 | Ga0373935_0131306_11_307 | 98 |
| 479 | 3300035692 | Ga0373935_0326388 | Ga0373935_0326388_601_897 | 98 |
| 480 | 3300035695 | Ga0373927_0021329 | Ga0373927_0021329_3847_4143 | 98 |
| 481 | 3300035695 | Ga0373927_0052566 | Ga0373927_0052566_129_443 | 98 |
| 482 | 3300035724 | Ga0373933_0009791 | Ga0373933_0009791_4424_4738 | 98 |
| 483 | 3300035724 | Ga0373933_0018208 | Ga0373933_0018208_285_581 | 98 |
| 484 | 3300035725 | Ga0373947_0005413 | Ga0373947_0005413_4464_4778 | 98 |
| 485 | 3300035725 | Ga0373947_0035367 | Ga0373947_0035367_804_1100 | 98 |
| 486 | 3300036401 | Ga0373937_0077831 | Ga0373937_0077831_1936_2250 | 98 |
| 487 | 3300036401 | Ga0373937_0236233 | Ga0373937_0236233_1155_1469 | 98 |
| 488 | 3300036401 | Ga0373937_0260448 | Ga0373937_0260448_55_351 | 98 |
| 489 | 3300036401 | Ga0373937_0830029 | Ga0373937_0830029_113_427 | 98 |
| 490 | 3300037068 | Ga0373925_0041169 | Ga0373925_0041169_1229_1543 | 98 |
| 491 | 3300037471 | Ga0395905_0071815 | Ga0395905_0071815_2428_2724 | 98 |
| 492 | 3300037471 | Ga0395905_0135282 | Ga0395905_0135282_1401_1697 | 98 |
| 493 | 3300037853 | Ga0436364_0656649 | Ga0436364_0656649_326_679 | 98 |
| 494 | 3300037853 | Ga0436364_0773908 | Ga0436364_0773908_670_966 | 98 |
| 495 | 3300037853 | Ga0436364_0939520 | Ga0436364_0939520_40_336 | 98 |
| 496 | 3300037853 | Ga0436364_1429122 | Ga0436364_1429122_473_769 | 98 |
| 497 | 3300039437 | Ga0436365_0824878 | Ga0436365_0824878_902_1198 | 98 |
| 498 | 3300039438 | Ga0436360_0072264 | Ga0436360_0072264_198_494 | 98 |
| 499 | 3300039438 | Ga0436360_0083095 | Ga0436360_0083095_66_362 | 98 |
| 500 | 3300039438 | Ga0436360_0172421 | Ga0436360_0172421_1965_2261 | 98 |
| 501 | 3300039438 | Ga0436360_0497875 | Ga0436360_0497875_650_946 | 98 |
| 502 | 3300039438 | Ga0436360_0720818 | Ga0436360_0720818_93_389 | 98 |
| 503 | 3300039438 | Ga0436360_0869944 | Ga0436360_0869944_155_457 | 98 |
| 504 | 3300039447 | Ga0436361_0554849 | Ga0436361_0554849_25233_25529 | 98 |
| 505 | 3300039447 | Ga0436361_0805706 | Ga0436361_0805706_2475_2771 | 98 |
| 506 | 3300039447 | Ga0436361_0891320 | Ga0436361_0891320_173_469 | 98 |
| 507 | 3300039447 | Ga0436361_0945716 | Ga0436361_0945716_174_470 | 98 |
| 508 | 3300039450 | Ga0436363_0255660 | Ga0436363_0255660_804_1100 | 98 |
| 509 | 3300039453 | Ga0436362_0104738 | Ga0436362_0104738_459_755 | 98 |
| 510 | 3300039453 | Ga0436362_0621761 | Ga0436362_0621761_151_447 | 98 |
| 511 | 3300039453 | Ga0436362_0735501 | Ga0436362_0735501_865_1167 | 98 |
| 512 | 3300041486 | Ga0451807_2499475 | Ga0451807_2499475_203_517 | 98 |
| 513 | 3300041505 | Ga0451849_1286789 | Ga0451849_1286789_226_540 | 98 |
| 514 | 3300042001 | Ga0439441_022517 | Ga0439441_022517_754_1050 | 98 |
| 515 | 3300042123 | Ga0450921_010801 | Ga0450921_010801_110_406 | 98 |
| 516 | 3300042125 | Ga0450923_060066 | Ga0450923_060066_159_455 | 98 |
| 517 | 3300042131 | Ga0450894_005576 | Ga0450894_005576_987_1283 | 98 |
| 518 | 3300042133 | Ga0450896_006073 | Ga0450896_006073_945_1241 | 98 |
| 519 | 3300042135 | Ga0450899_010744 | Ga0450899_010744_337_633 | 98 |
| 520 | 3300042435 | Ga0439434_0245645 | Ga0439434_0245645_201_497 | 98 |
| 521 | 3300042531 | Ga0450918_002582 | Ga0450918_002582_2823_3119 | 98 |
| 522 | 3300042876 | Ga0451577_0014229 | Ga0451577_0014229_1741_2037 | 98 |
| 523 | 3300042876 | Ga0451577_0109967 | Ga0451577_0109967_744_1043 | 98 |
| 524 | 3300042876 | Ga0451577_0456119 | Ga0451577_0456119_644_940 | 98 |
| 525 | 3300042876 | Ga0451577_0856898 | Ga0451577_0856898_429_725 | 98 |
| 526 | 3300042993 | Ga0439440_0176197 | Ga0439440_0176197_121_417 | 98 |
| 527 | 3300044673 | Ga0453683_0394365 | Ga0453683_0394365_393_689 | 98 |
| 528 | 3300044694 | Ga0466963_0963742 | Ga0466963_0963742_76_375 | 98 |
| 529 | 3300044706 | Ga0466964_0452890 | Ga0466964_0452890_280_594 | 98 |
| 530 | 3300044712 | Ga0453684_0007847 | Ga0453684_0007847_8952_9248 | 98 |
| 531 | 3300044735 | Ga0466968_0104654 | Ga0466968_0104654_517_813 | 98 |
| 532 | 3300045051 | Ga0451576_0010179 | Ga0451576_0010179_7837_8133 | 98 |
| 533 | 3300045051 | Ga0451576_2369635 | Ga0451576_2369635_207_503 | 98 |
| 534 | 3300045051 | Ga0451576_2608165 | Ga0451576_2608165_79_375 | 98 |
| 535 | 3300045976 | Ga0466967_0525786 | Ga0466967_0525786_250_564 | 98 |
| 536 | 3300046454 | Ga0495592_0030815 | Ga0495592_0030815_1090_1404 | 98 |
| 537 | 3300046454 | Ga0495592_0282763 | Ga0495592_0282763_578_892 | 98 |
| 538 | 3300046455 | Ga0495603_0025782 | Ga0495603_0025782_30_344 | 98 |
| 539 | 3300046461 | Ga0495641_0022240 | Ga0495641_0022240_80_394 | 98 |
| 540 | 3300046462 | Ga0495651_0072227 | Ga0495651_0072227_1824_2138 | 98 |
| 541 | 3300046462 | Ga0495651_0686263 | Ga0495651_0686263_168_464 | 98 |
| 542 | 3300046462 | Ga0495651_1003004 | Ga0495651_1003004_19_333 | 98 |
| 543 | 3300046463 | Ga0495653_0457652 | Ga0495653_0457652_95_409 | 98 |
| 544 | 3300046472 | Ga0495580_0173771 | Ga0495580_0173771_1096_1410 | 98 |
| 545 | 3300046472 | Ga0495580_0482001 | Ga0495580_0482001_484_798 | 98 |
| 546 | 3300046473 | Ga0495582_0005954 | Ga0495582_0005954_27_341 | 98 |
| 547 | 3300046475 | Ga0495639_0003444 | Ga0495639_0003444_4709_5023 | 98 |
| 548 | 3300046475 | Ga0495639_0369476 | Ga0495639_0369476_265_564 | 98 |
| 549 | 3300046476 | Ga0495662_0196737 | Ga0495662_0196737_56_370 | 98 |
| 550 | 3300046477 | Ga0495664_0015894 | Ga0495664_0015894_1638_1952 | 98 |
| 551 | 3300046477 | Ga0495664_0500602 | Ga0495664_0500602_117_431 | 98 |
| 552 | 3300046499 | Ga0495594_0170797 | Ga0495594_0170797_732_1046 | 98 |
| 553 | 3300046511 | Ga0495608_0020357 | Ga0495608_0020357_1011_1325 | 98 |
| 554 | 3300046511 | Ga0495608_0101336 | Ga0495608_0101336_1463_1777 | 98 |
| 555 | 3300046514 | Ga0495618_0014606 | Ga0495618_0014606_3312_3626 | 98 |
| 556 | 3300046516 | Ga0495628_0168857 | Ga0495628_0168857_1154_1468 | 98 |
| 557 | 3300046516 | Ga0495628_0192257 | Ga0495628_0192257_963_1277 | 98 |
| 558 | 3300046517 | Ga0495630_0083288 | Ga0495630_0083288_1090_1404 | 98 |
| 559 | 3300046526 | Ga0495666_0004676 | Ga0495666_0004676_6596_6910 | 98 |
| 560 | 3300046529 | Ga0495652_0044698 | Ga0495652_0044698_1822_2136 | 98 |
| 561 | 3300046529 | Ga0495652_0478035 | Ga0495652_0478035_190_486 | 98 |
| 562 | 3300046529 | Ga0495652_0685820 | Ga0495652_0685820_284_598 | 98 |
| 563 | 3300046529 | Ga0495652_0839711 | Ga0495652_0839711_203_517 | 98 |
| 564 | 3300046531 | Ga0495665_0007757 | Ga0495665_0007757_4212_4526 | 98 |
| 565 | 3300046533 | Ga0495640_0230638 | Ga0495640_0230638_756_1070 | 98 |
| 566 | 3300046535 | Ga0495586_0073868 | Ga0495586_0073868_796_1110 | 98 |
| 567 | 3300046536 | Ga0495587_0023688 | Ga0495587_0023688_248_562 | 98 |
| 568 | 3300046538 | Ga0495609_0152922 | Ga0495609_0152922_110_409 | 98 |
| 569 | 3300046543 | Ga0495645_0020867 | Ga0495645_0020867_1766_2080 | 98 |
| 570 | 3300046543 | Ga0495645_0093098 | Ga0495645_0093098_1439_1753 | 98 |
| 571 | 3300046543 | Ga0495645_0366851 | Ga0495645_0366851_146_460 | 98 |
| 572 | 3300046559 | Ga0495667_0014969 | Ga0495667_0014969_4171_4485 | 98 |
| 573 | 3300046559 | Ga0495667_0894605 | Ga0495667_0894605_37_351 | 98 |
| 574 | 3300046615 | Ga0495656_0087739 | Ga0495656_0087739_573_872 | 98 |
| 575 | 3300046642 | Ga0495634_0072746 | Ga0495634_0072746_1139_1453 | 98 |
| 576 | 3300046663 | Ga0495635_0007103 | Ga0495635_0007103_669_983 | 98 |
| 577 | 3300046663 | Ga0495635_0397659 | Ga0495635_0397659_67_381 | 98 |
| 578 | 3300046663 | Ga0495635_0853845 | Ga0495635_0853845_250_555 | 98 |
| 579 | 3300046675 | Ga0495657_0026472 | Ga0495657_0026472_1011_1325 | 98 |
| 580 | 3300046675 | Ga0495657_0067938 | Ga0495657_0067938_1832_2146 | 98 |
| 581 | 3300046678 | Ga0495599_0022147 | Ga0495599_0022147_193_507 | 98 |
| 582 | 3300046678 | Ga0495599_0423780 | Ga0495599_0423780_364_660 | 98 |
| 583 | 3300046678 | Ga0495599_0822723 | Ga0495599_0822723_163_477 | 98 |
| 584 | 3300046679 | Ga0495623_0140733 | Ga0495623_0140733_1090_1404 | 98 |
| 585 | 3300046680 | Ga0495646_0022907 | Ga0495646_0022907_1936_2250 | 98 |
| 586 | 3300046680 | Ga0495646_0134533 | Ga0495646_0134533_256_570 | 98 |
| 587 | 3300046681 | Ga0495647_0016034 | Ga0495647_0016034_118_432 | 98 |
| 588 | 3300046683 | Ga0495658_0004533 | Ga0495658_0004533_3367_3681 | 98 |
| 589 | 3300046684 | Ga0495669_0008295 | Ga0495669_0008295_2845_3141 | 98 |
| 590 | 3300046684 | Ga0495669_0130111 | Ga0495669_0130111_252_551 | 98 |
| 591 | 3300046690 | Ga0495624_0009644 | Ga0495624_0009644_3408_3722 | 98 |
| 592 | 3300046794 | Ga0495589_0205411 | Ga0495589_0205411_30_329 | 98 |
| 593 | 3300046809 | Ga0495600_0080838 | Ga0495600_0080838_797_1111 | 98 |
| 594 | 3300046809 | Ga0495600_0423012 | Ga0495600_0423012_320_634 | 98 |
| 595 | 3300047315 | Ga0495581_0006948 | Ga0495581_0006948_6219_6533 | 98 |
| 596 | 3300047315 | Ga0495581_0151436 | Ga0495581_0151436_30_344 | 98 |
| 597 | 3300047317 | Ga0495604_0031488 | Ga0495604_0031488_1592_1906 | 98 |
| 598 | 3300047319 | Ga0495674_0068827 | Ga0495674_0068827_95_409 | 98 |
| 599 | 3300047319 | Ga0495674_0358515 | Ga0495674_0358515_324_638 | 98 |
| 600 | 3300047321 | Ga0495676_0069839 | Ga0495676_0069839_38_352 | 98 |
| 601 | 3300047322 | Ga0495680_0010283 | Ga0495680_0010283_6894_7208 | 98 |
| 602 | 3300047322 | Ga0495680_0730761 | Ga0495680_0730761_193_507 | 98 |
| 603 | 3300047444 | Ga0495675_0023875 | Ga0495675_0023875_255_569 | 98 |
| 604 | 3300047471 | Ga0495684_0018890 | Ga0495684_0018890_3356_3670 | 98 |
| 605 | 3300047673 | Ga0495593_0015149 | Ga0495593_0015149_2782_3096 | 98 |
| 606 | 3300048088 | Ga0495602_0164195 | Ga0495602_0164195_262_576 | 98 |
| 607 | 3300048088 | Ga0495602_0247129 | Ga0495602_0247129_262_576 | 98 |
| 608 | 3300048089 | Ga0495614_0032217 | Ga0495614_0032217_1253_1567 | 98 |
| 609 | 3300048903 | Ga0496100_0265894 | Ga0496100_0265894_714_1028 | 98 |
| 610 | 3300048903 | Ga0496100_0890682 | Ga0496100_0890682_303_599 | 98 |
| 611 | 3300048903 | Ga0496100_1014808 | Ga0496100_1014808_66_365 | 98 |
| 612 | 3300048904 | Ga0496101_0044842 | Ga0496101_0044842_137_451 | 98 |
| 613 | 3300048904 | Ga0496101_0262555 | Ga0496101_0262555_677_973 | 98 |
| 614 | 3300048905 | Ga0496102_1165143 | Ga0496102_1165143_218_514 | 98 |
| 615 | 3300048906 | Ga0496103_0099101 | Ga0496103_0099101_523_837 | 98 |
| 616 | 3300048906 | Ga0496103_1051753 | Ga0496103_1051753_48_344 | 98 |
| 617 | 3300048907 | Ga0496104_0347717 | Ga0496104_0347717_132_446 | 98 |
| 618 | 3300048907 | Ga0496104_0686244 | Ga0496104_0686244_613_909 | 98 |
| 619 | 3300048908 | Ga0496105_0874230 | Ga0496105_0874230_304_600 | 98 |
| 620 | 3300048909 | Ga0496106_0367548 | Ga0496106_0367548_336_632 | 98 |
| 621 | 3300048909 | Ga0496106_1198555 | Ga0496106_1198555_29_325 | 98 |
| 622 | 3300048910 | Ga0496107_0537707 | Ga0496107_0537707_100_396 | 98 |
| 623 | 3300048910 | Ga0496107_0620213 | Ga0496107_0620213_136_450 | 98 |
| 624 | 3300048911 | Ga0496108_0165900 | Ga0496108_0165900_509_823 | 98 |
| 625 | 3300048911 | Ga0496108_0272670 | Ga0496108_0272670_1066_1362 | 98 |
| 626 | 3300048911 | Ga0496108_0648841 | Ga0496108_0648841_276_590 | 98 |
| 627 | 3300048912 | Ga0496109_0614317 | Ga0496109_0614317_109_423 | 98 |
| 628 | 3300048913 | Ga0496110_0346338 | Ga0496110_0346338_234_548 | 98 |
| 629 | 3300048913 | Ga0496110_0748035 | Ga0496110_0748035_364_660 | 98 |
| 630 | 3300048914 | Ga0496111_0505231 | Ga0496111_0505231_549_863 | 98 |
| 631 | 3300048915 | Ga0496112_0034784 | Ga0496112_0034784_4143_4439 | 98 |
| 632 | 3300048915 | Ga0496112_0195410 | Ga0496112_0195410_56_352 | 98 |
| 633 | 3300048917 | Ga0496114_0541721 | Ga0496114_0541721_238_537 | 98 |
| 634 | 3300048918 | Ga0496115_0080503 | Ga0496115_0080503_608_904 | 98 |
| 635 | 3300048918 | Ga0496115_0512695 | Ga0496115_0512695_375_689 | 98 |
| 636 | 3300049568 | Ga0501031_0203034 | Ga0501031_0203034_349_645 | 98 |
| 637 | 3300049568 | Ga0501031_0336846 | Ga0501031_0336846_559_855 | 98 |
| 638 | 3300049568 | Ga0501031_0912585 | Ga0501031_0912585_231_536 | 98 |
| 639 | 3300049570 | Ga0501033_0987069 | Ga0501033_0987069_90_392 | 98 |
| 640 | 3300049572 | Ga0501036_0543986 | Ga0501036_0543986_282_581 | 98 |
| 641 | 3300049573 | Ga0501037_0746570 | Ga0501037_0746570_244_543 | 98 |
| 642 | 3300049574 | Ga0501038_0379574 | Ga0501038_0379574_321_617 | 98 |
| 643 | 3300049575 | Ga0501039_0402963 | Ga0501039_0402963_529_828 | 98 |
| 644 | 3300049576 | Ga0501040_0203845 | Ga0501040_0203845_1068_1364 | 98 |
| 645 | 3300049576 | Ga0501040_0322749 | Ga0501040_0322749_286_585 | 98 |
| 646 | 3300049577 | Ga0501041_0269418 | Ga0501041_0269418_116_415 | 98 |
| 647 | 3300049580 | Ga0501046_0051976 | Ga0501046_0051976_2859_3158 | 98 |
| 648 | 3300049580 | Ga0501046_0501839 | Ga0501046_0501839_454_750 | 98 |
| 649 | 3300049580 | Ga0501046_0619116 | Ga0501046_0619116_211_507 | 98 |
| 650 | 3300049582 | Ga0501048_0827439 | Ga0501048_0827439_241_540 | 98 |
| 651 | 3300049584 | Ga0501068_0782388 | Ga0501068_0782388_143_442 | 98 |
| 652 | 3300049586 | Ga0501070_1477082 | Ga0501070_1477082_38_352 | 98 |
| 653 | 3300049587 | Ga0501071_0625311 | Ga0501071_0625311_349_654 | 98 |
| 654 | 3300049587 | Ga0501071_1187832 | Ga0501071_1187832_89_388 | 98 |
| 655 | 3300049588 | Ga0501072_0003022 | Ga0501072_0003022_4695_4994 | 98 |
| 656 | 3300049588 | Ga0501072_0176020 | Ga0501072_0176020_1077_1382 | 98 |
| 657 | 3300049589 | Ga0501073_0428038 | Ga0501073_0428038_131_427 | 98 |
| 658 | 3300049589 | Ga0501073_0589459 | Ga0501073_0589459_271_567 | 98 |
| 659 | 3300049590 | Ga0501074_0040599 | Ga0501074_0040599_2561_2860 | 98 |
| 660 | 3300049590 | Ga0501074_0116369 | Ga0501074_0116369_233_529 | 98 |
| 661 | 3300049590 | Ga0501074_0640465 | Ga0501074_0640465_280_585 | 98 |
| 662 | 3300049591 | Ga0501075_0016028 | Ga0501075_0016028_4414_4713 | 98 |
| 663 | 3300049591 | Ga0501075_0344685 | Ga0501075_0344685_767_1063 | 98 |
| 664 | 3300049592 | Ga0501076_0015432 | Ga0501076_0015432_5366_5665 | 98 |
| 665 | 3300049592 | Ga0501076_1064558 | Ga0501076_1064558_58_354 | 98 |
| 666 | 3300049593 | Ga0501077_0432384 | Ga0501077_0432384_333_632 | 98 |
| 667 | 3300049741 | Ga0501079_0004245 | Ga0501079_0004245_266_565 | 98 |
| 668 | 3300049743 | Ga0501081_0019917 | Ga0501081_0019917_3558_3857 | 98 |
| 669 | 3300049743 | Ga0501081_0739137 | Ga0501081_0739137_59_355 | 98 |
| 670 | 3300049744 | Ga0501083_0712409 | Ga0501083_0712409_149_445 | 98 |
| 671 | 3300049822 | Ga0501035_0253175 | Ga0501035_0253175_517_813 | 98 |
| 672 | 3300049824 | Ga0501045_0100239 | Ga0501045_0100239_129_428 | 98 |
| 673 | 3300050489 | nmdc:mga03683_254731_c1 | nmdc:mga03683_254731_c1_496_795 | 98 |
| 674 | 3300050490 | nmdc:mga03n38_14316_c1 | nmdc:mga03n38_14316_c1_1819_2118 | 98 |
| 675 | 3300050491 | nmdc:mga00v17_408162_c1 | nmdc:mga00v17_408162_c1_240_539 | 98 |
| 676 | 3300050491 | nmdc:mga00v17_52966_c1 | nmdc:mga00v17_52966_c1_118_417 | 98 |
| 677 | 3300050492 | nmdc:mga0yw44_10402_c1 | nmdc:mga0yw44_10402_c1_4221_4520 | 98 |
| 678 | 3300050493 | nmdc:mga0k408_3942_c1 | nmdc:mga0k408_3942_c1_944_1243 | 98 |
| 679 | 3300050494 | nmdc:mga06z11_9299_c1 | nmdc:mga06z11_9299_c1_2894_3193 | 98 |
| 680 | 3300050496 | nmdc:mga07m45_57780_c2 | nmdc:mga07m45_57780_c2_40_339 | 98 |
| 681 | 3300050507 | nmdc:mga05p37_105024_c1 | nmdc:mga05p37_105024_c1_598_894 | 98 |
| 682 | 3300050507 | nmdc:mga05p37_1087913_c1 | nmdc:mga05p37_1087913_c1_389_688 | 98 |
| 683 | 3300050507 | nmdc:mga05p37_1110428_c1 | nmdc:mga05p37_1110428_c1_206_502 | 98 |
| 684 | 3300050507 | nmdc:mga05p37_1278851_c1 | nmdc:mga05p37_1278851_c1_122_418 | 98 |
| 685 | 3300050507 | nmdc:mga05p37_2092021_c1 | nmdc:mga05p37_2092021_c1_77_376 | 98 |
| 686 | 3300050507 | nmdc:mga05p37_38560_c1 | nmdc:mga05p37_38560_c1_4273_4569 | 98 |
| 687 | 3300050507 | nmdc:mga05p37_726382_c1 | nmdc:mga05p37_726382_c1_117_413 | 98 |
| 688 | 3300050507 | nmdc:mga05p37_8774_c1 | nmdc:mga05p37_8774_c1_10017_10313 | 98 |
| 689 | 3300050508 | nmdc:mga09592_239313_c1 | nmdc:mga09592_239313_c1_542_841 | 98 |
| 690 | 3300050508 | nmdc:mga09592_577724_c1 | nmdc:mga09592_577724_c1_350_649 | 98 |
| 691 | 3300050509 | nmdc:mga0qj67_394374_c1 | nmdc:mga0qj67_394374_c1_594_893 | 98 |
| 692 | 3300050510 | nmdc:mga06r32_15456_c1 | nmdc:mga06r32_15456_c1_6256_6552 | 98 |
| 693 | 3300050510 | nmdc:mga06r32_542477_c1 | nmdc:mga06r32_542477_c1_417_713 | 98 |
| 694 | 3300050510 | nmdc:mga06r32_8449_c1 | nmdc:mga06r32_8449_c1_359_655 | 98 |
| 695 | 3300050511 | nmdc:mga08y16_1299_c1 | nmdc:mga08y16_1299_c1_2168_2467 | 98 |
| 696 | 3300050511 | nmdc:mga08y16_47842_c1 | nmdc:mga08y16_47842_c1_3315_3614 | 98 |
| 697 | 3300050511 | nmdc:mga08y16_63226_c1 | nmdc:mga08y16_63226_c1_1765_2061 | 98 |
| 698 | 3300050511 | nmdc:mga08y16_763654_c1 | nmdc:mga08y16_763654_c1_492_788 | 98 |
| 699 | 3300050511 | nmdc:mga08y16_96614_c1 | nmdc:mga08y16_96614_c1_2339_2635 | 98 |
| 700 | 3300050512 | nmdc:mga0n895_139937_c1 | nmdc:mga0n895_139937_c1_774_1073 | 98 |
| 701 | 3300050512 | nmdc:mga0n895_141171_c1 | nmdc:mga0n895_141171_c1_653_952 | 98 |
| 702 | 3300050512 | nmdc:mga0n895_1549890_c1 | nmdc:mga0n895_1549890_c1_53_349 | 98 |
| 703 | 3300050512 | nmdc:mga0n895_160226_c1 | nmdc:mga0n895_160226_c1_1184_1480 | 98 |
| 704 | 3300050512 | nmdc:mga0n895_283321_c1 | nmdc:mga0n895_283321_c1_786_1085 | 98 |
| 705 | 3300050512 | nmdc:mga0n895_3543_c1 | nmdc:mga0n895_3543_c1_1758_2054 | 98 |
| 706 | 3300050512 | nmdc:mga0n895_91689_c1 | nmdc:mga0n895_91689_c1_1817_2131 | 98 |
| 707 | 3300050513 | nmdc:mga0rr50_155431_c1 | nmdc:mga0rr50_155431_c1_556_855 | 98 |
| 708 | 3300050513 | nmdc:mga0rr50_15951_c1 | nmdc:mga0rr50_15951_c1_2985_3284 | 98 |
| 709 | 3300050513 | nmdc:mga0rr50_32554_c1 | nmdc:mga0rr50_32554_c1_934_1230 | 98 |
| 710 | 3300050513 | nmdc:mga0rr50_476643_c1 | nmdc:mga0rr50_476643_c1_714_1010 | 98 |
| 711 | 3300050513 | nmdc:mga0rr50_857397_c1 | nmdc:mga0rr50_857397_c1_215_529 | 98 |
| 712 | 3300050513 | nmdc:mga0rr50_90925_c1 | nmdc:mga0rr50_90925_c1_442_738 | 98 |
| 713 | 3300050514 | nmdc:mga08x19_444253_c1 | nmdc:mga08x19_444253_c1_204_500 | 98 |
| 714 | 3300050514 | nmdc:mga08x19_67079_c1 | nmdc:mga08x19_67079_c1_1213_1527 | 98 |
| 715 | 3300050514 | nmdc:mga08x19_80877_c1 | nmdc:mga08x19_80877_c1_314_610 | 98 |
| 716 | 3300050514 | nmdc:mga08x19_816822_c1 | nmdc:mga08x19_816822_c1_201_500 | 98 |
| 717 | 3300050515 | nmdc:mga0a205_11026_c1 | nmdc:mga0a205_11026_c1_5903_6199 | 98 |
| 718 | 3300050515 | nmdc:mga0a205_270453_c2 | nmdc:mga0a205_270453_c2_351_650 | 98 |
| 719 | 3300050515 | nmdc:mga0a205_35606_c2 | nmdc:mga0a205_35606_c2_2705_3004 | 98 |
| 720 | 3300050515 | nmdc:mga0a205_632037_c1 | nmdc:mga0a205_632037_c1_38_337 | 98 |
| 721 | 3300050515 | nmdc:mga0a205_6938_c1 | nmdc:mga0a205_6938_c1_3734_4030 | 98 |
| 722 | 3300050515 | nmdc:mga0a205_694_c1 | nmdc:mga0a205_694_c1_10822_11118 | 98 |
| 723 | 3300050515 | nmdc:mga0a205_94824_c1 | nmdc:mga0a205_94824_c1_1000_1296 | 98 |
| 724 | 3300053077 | Ga0495601_0000713 | Ga0495601_0000713_937_1233 | 98 |
| 725 | 3300053077 | Ga0495601_0032225 | Ga0495601_0032225_95_409 | 98 |
| 726 | 3300053077 | Ga0495601_0184262 | Ga0495601_0184262_40_354 | 98 |
| 727 | 3300053078 | Ga0495612_0017245 | Ga0495612_0017245_1163_1477 | 98 |
| 728 | 3300053078 | Ga0495612_0071902 | Ga0495612_0071902_1063_1377 | 98 |
| 729 | 3300053084 | Ga0495595_0067770 | Ga0495595_0067770_1336_1650 | 98 |
| 730 | 3300053084 | Ga0495595_0187165 | Ga0495595_0187165_10_306 | 98 |
| 731 | 3300053084 | Ga0495595_0681918 | Ga0495595_0681918_63_377 | 98 |
| 732 | 3300053085 | Ga0495619_0029947 | Ga0495619_0029947_2564_2878 | 98 |
| 733 | 3300053085 | Ga0495619_0643511 | Ga0495619_0643511_94_408 | 98 |
| 734 | 3300054114 | Ga0501084_0018114 | Ga0501084_0018114_2933_3232 | 98 |
| 735 | 3300054114 | Ga0501084_0261346 | Ga0501084_0261346_259_555 | 98 |
| 736 | 3300054114 | Ga0501084_1730254 | Ga0501084_1730254_159_455 | 98 |
| 737 | 3300059421 | Ga0590071_028216 | Ga0590071_028216_368_664 | 98 |
| 738 | 3300059421 | Ga0590071_119618 | Ga0590071_119618_160_456 | 98 |
| 739 | 3300059423 | Ga0590074_043974 | Ga0590074_043974_497_793 | 98 |
| 740 | 3300060353 | Ga0501082_0195728 | Ga0501082_0195728_165_464 | 98 |
| 741 | 3300060353 | Ga0501082_0434965 | Ga0501082_0434965_456_752 | 98 |
| 742 | 3300061734 | Ga0530510_1474843 | Ga0530510_1474843_18_317 | 98 |
| 743 | 3300003203 | JGI25406J46586_10075979 | JGI25406J46586_100759792 | 102 |
| 744 | 3300005456 | Ga0070678_100930560 | Ga0070678_1009305602 | 102 |
| 745 | 3300005985 | Ga0081539_10071881 | Ga0081539_100718812 | 102 |
| 746 | 3300025937 | Ga0207669_10139490 | Ga0207669_101394902 | 102 |
| 747 | 3300026121 | Ga0207683_10919424 | Ga0207683_109194241 | 102 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8565 | 3 | 99 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8442 | 3 | 102 |
| 1v8c-assembly3.cif.gz_B | crystal structure of moad related protein from thermus thermophilus hb8 | 0.8153 | 3 | 97 |
| 4hro-assembly1.cif.gz_A | crystal structure of h. volcanii small archaeal modifier protein 1 | 0.8128 | 3 | 99 |
| 3po0-assembly1.cif.gz_A | crystal structure of samp1 from haloferax volcanii | 0.8109 | 3 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8564 | 3 | 99 | 3.10.20.30 |
| 1v8cB01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8162 | 3 | 98 | 3.10.20.30 |
| 4hroA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8126 | 3 | 99 | 3.10.20.30 |
| af_Q54NM8_4_86_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8095 | 1 | 102 | 3.10.20.30 |
| 4n6eB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8062 | 1 | 102 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F8SIJ2-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9699 | 1 | 98 |
|
| AF-A0A1G0SXB6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9673 | 1 | 89 |
|
| AF-A0A7V9SE48-F1-model_v4 | MoaD/ThiS family protein | 0.9631 | 2 | 102 |
|
| AF-A0A534ZY62-F1-model_v4 | MoaD/ThiS family protein | 0.9617 | 1 | 88 |
|
| AF-A0A3N5LTQ9-F1-model_v4 | MoaD/ThiS family protein | 0.9567 | 19 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar