F478919

General Info

Members Datasets Scaffolds Average Seq Length
747 392 747 100

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10353035|Ga0265325_103530351
Length 117
Sequence LGTSNQKPKPRNHPGVLSRMIRIVLPAHLRKLAHVDREVALEVAAPVTQCAVLDALEARYPMLCGTIRDHVTKRRRPYVRFFACEEDLSHEPPDTPLPDAVASGTEPFLIVGAMAGG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
110 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
111 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
112 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
113 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
114 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
115 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
116 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
117 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
140 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
207 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
226 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
229 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
261 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
264 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
265 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
266 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
267 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
268 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
273 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
298 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
299 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
300 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
306 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
307 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
308 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
309 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
310 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
311 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
312 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
313 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
314 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
315 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
318 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
319 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
330 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
331 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
332 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
358 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
359 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
360 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
361 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
387 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 3.75
Rhizosphere 93.17
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10075979 3300003203 Bacteria 1041
2 JGI25407J50210_10027374 3300003373 Bacteria 1478
3 Ga0058862_12018065 3300004803 Bacteria 556
4 Ga0070658_11653618 3300005327 Bacteria 554
5 Ga0070683_100047912 3300005329 Bacteria 3950
6 Ga0070690_100337367 3300005330 Bacteria 1091
7 Ga0070690_100532474 3300005330 Bacteria 883
8 Ga0070690_100835381 3300005330 Bacteria 717
9 Ga0070677_10650010 3300005333 Bacteria 589
10 Ga0068869_100018892 3300005334 Bacteria 4699
11 Ga0068869_100113757 3300005334 Bacteria 2062
12 Ga0068869_100555449 3300005334 Bacteria 965
13 Ga0070666_10078455 3300005335 Bacteria 2254
14 Ga0070666_10399349 3300005335 Bacteria 988
15 Ga0070666_10555314 3300005335 Unclassified 835
16 Ga0070680_100068624 3300005336 Bacteria 2910
17 Ga0070680_100407166 3300005336 Bacteria 1160
18 Ga0070682_100423416 3300005337 Bacteria 1012
19 Ga0068868_100057907 3300005338 Bacteria 3062
20 Ga0068868_100595569 3300005338 Bacteria 979
21 Ga0070660_100150544 3300005339 Bacteria 1870
22 Ga0070660_100373963 3300005339 Bacteria 1176
23 Ga0070689_100051129 3300005340 Bacteria 3194
24 Ga0070689_100059453 3300005340 Bacteria 2971
25 Ga0070689_100890077 3300005340 Bacteria 787
26 Ga0070689_100969010 3300005340 Bacteria 755
27 Ga0070691_10516839 3300005341 Bacteria 693
28 Ga0070691_11075777 3300005341 Bacteria 506
29 Ga0070687_100029280 3300005343 Bacteria 2679
30 Ga0070687_101378880 3300005343 Bacteria 526
31 Ga0070692_10033655 3300005345 Bacteria 2583
32 Ga0070692_10584411 3300005345 Bacteria 737
33 Ga0070668_100767351 3300005347 Bacteria 854
34 Ga0070668_100881089 3300005347 Bacteria 799
35 Ga0070669_100072401 3300005353 Bacteria 2551
36 Ga0070669_101858442 3300005353 Bacteria 526
37 Ga0070675_100812546 3300005354 Bacteria 855
38 Ga0070671_101525621 3300005355 Bacteria 591
39 Ga0070674_100015560 3300005356 Bacteria 4751
40 Ga0070674_100435832 3300005356 Bacteria 1079
41 Ga0070673_100087869 3300005364 Bacteria 2534
42 Ga0070673_100297542 3300005364 Bacteria 1420
43 Ga0070673_101003114 3300005364 Unclassified 777
44 Ga0070673_101591364 3300005364 Unclassified 617
45 Ga0070688_100043817 3300005365 Bacteria 2759
46 Ga0070659_100067384 3300005366 Bacteria 2839
47 Ga0070659_100420793 3300005366 Bacteria 1130
48 Ga0070659_100971426 3300005366 Bacteria 745
49 Ga0070659_101040552 3300005366 Bacteria 720
50 Ga0070667_100062122 3300005367 Bacteria 3164
51 Ga0070667_100770141 3300005367 Bacteria 893
52 Ga0070667_101635510 3300005367 Unclassified 605
53 Ga0070703_10280199 3300005406 Bacteria 688
54 Ga0070709_10343032 3300005434 Bacteria 1102
55 Ga0070709_10370451 3300005434 Bacteria 1062
56 Ga0070714_100602137 3300005435 Bacteria 1055
57 Ga0070713_100717188 3300005436 Bacteria 955
58 Ga0070701_10259489 3300005438 Bacteria 1053
59 Ga0070701_10322017 3300005438 Bacteria 957
60 Ga0070705_100103125 3300005440 Bacteria 1806
61 Ga0070700_100142337 3300005441 Bacteria 1631
62 Ga0070700_100899397 3300005441 Bacteria 721
63 Ga0070700_101078231 3300005441 Bacteria 665
64 Ga0070694_100114193 3300005444 Bacteria 1928
65 Ga0070694_100262806 3300005444 Bacteria 1310
66 Ga0070694_101558899 3300005444 Bacteria 560
67 Ga0070708_100034155 3300005445 Bacteria 4423
68 Ga0070708_100234236 3300005445 Bacteria 1723
69 Ga0070708_101917463 3300005445 Bacteria 549
70 Ga0070663_100040086 3300005455 Bacteria 3277
71 Ga0070663_101231440 3300005455 Bacteria 658
72 Ga0070678_100168479 3300005456 Bacteria 1781
73 Ga0070678_100202372 3300005456 Bacteria 1640
74 Ga0070678_100432739 3300005456 Bacteria 1149
75 Ga0070678_100930560 3300005456 Bacteria 796
76 Ga0070678_100974825 3300005456 Bacteria 778
77 Ga0070662_100720922 3300005457 Bacteria 844
78 Ga0070681_10361376 3300005458 Bacteria 1362
79 Ga0070681_10875172 3300005458 Bacteria 816
80 Ga0068867_100108454 3300005459 Bacteria 2129
81 Ga0068867_101046177 3300005459 Bacteria 742
82 Ga0070685_10218033 3300005466 Bacteria 1249
83 Ga0070706_100252468 3300005467 Bacteria 1646
84 Ga0070706_100326300 3300005467 Bacteria 1431
85 Ga0070707_100200634 3300005468 Bacteria 1944
86 Ga0070707_100255373 3300005468 Bacteria 1706
87 Ga0070707_100333729 3300005468 Bacteria 1473
88 Ga0070707_101081871 3300005468 Bacteria 768
89 Ga0070698_100076682 3300005471 Bacteria 3344
90 Ga0070698_100096058 3300005471 Bacteria 2940
91 Ga0070698_100586290 3300005471 Bacteria 1055
92 Ga0070698_100913883 3300005471 Bacteria 823
93 Ga0070698_101252050 3300005471 Bacteria 692
94 Ga0070699_100000430 3300005518 Bacteria 40310
95 Ga0070699_101493485 3300005518 Bacteria 620
96 Ga0070679_100501595 3300005530 Bacteria 1158
97 Ga0070684_100226725 3300005535 Bacteria 1705
98 Ga0070684_100294699 3300005535 Bacteria 1488
99 Ga0070697_100175009 3300005536 Bacteria 1818
100 Ga0070697_100316271 3300005536 Bacteria 1344
101 Ga0070697_100527028 3300005536 Bacteria 1035
102 Ga0070697_101879045 3300005536 Unclassified 536
103 Ga0070672_101582558 3300005543 Bacteria 588
104 Ga0070686_100026390 3300005544 Bacteria 3506
105 Ga0070686_100154777 3300005544 Bacteria 1609
106 Ga0070686_101076133 3300005544 Bacteria 663
107 Ga0070686_101376255 3300005544 Unclassified 591
108 Ga0070695_100364242 3300005545 Bacteria 1086
109 Ga0070695_100573694 3300005545 Bacteria 882
110 Ga0070695_100729012 3300005545 Bacteria 789
111 Ga0070696_100076940 3300005546 Bacteria 2357
112 Ga0070696_100084323 3300005546 Bacteria 2254
113 Ga0070693_100114322 3300005547 Bacteria 1665
114 Ga0070693_100376107 3300005547 Bacteria 978
115 Ga0070693_100678182 3300005547 Bacteria 752
116 Ga0070665_100110862 3300005548 Bacteria 2746
117 Ga0070665_100270778 3300005548 Bacteria 1700
118 Ga0070665_100352147 3300005548 Unclassified 1478
119 Ga0070665_101243394 3300005548 Bacteria 755
120 Ga0070704_100434803 3300005549 Bacteria 1126
121 Ga0068855_100294244 3300005563 Bacteria 1799
122 Ga0070664_100580401 3300005564 Bacteria 1039
123 Ga0070664_101232296 3300005564 Bacteria 706
124 Ga0068857_100050616 3300005577 Bacteria 3684
125 Ga0068857_100260412 3300005577 Bacteria 1592
126 Ga0068854_100151760 3300005578 Bacteria 1787
127 Ga0068854_101739402 3300005578 Bacteria 571
128 Ga0070702_100019763 3300005615 Bacteria 3520
129 Ga0070702_100050912 3300005615 Bacteria 2368
130 Ga0070702_100248584 3300005615 Bacteria 1204
131 Ga0070702_100518801 3300005615 Unclassified 878
132 Ga0068852_100771446 3300005616 Bacteria 974
133 Ga0068852_102074813 3300005616 Bacteria 590
134 Ga0068859_100062593 3300005617 Bacteria 3751
135 Ga0068859_100083297 3300005617 Bacteria 3241
136 Ga0068864_100040791 3300005618 Bacteria 3969
137 Ga0068864_100098562 3300005618 Bacteria 2589
138 Ga0068864_101058101 3300005618 Bacteria 806
139 Ga0068866_10046246 3300005718 Bacteria 2187
140 Ga0068866_10311574 3300005718 Unclassified 987
141 Ga0068861_100433729 3300005719 Bacteria 1173
142 Ga0068861_101233154 3300005719 Bacteria 724
143 Ga0068851_10537432 3300005834 Bacteria 705
144 Ga0068870_10051373 3300005840 Bacteria 2182
145 Ga0068863_100011064 3300005841 Bacteria 8751
146 Ga0068863_100132718 3300005841 Bacteria 2378
147 Ga0068863_100396373 3300005841 Bacteria 1349
148 Ga0068858_100071919 3300005842 Bacteria 3208
149 Ga0068858_100831434 3300005842 Bacteria 901
150 Ga0068860_100105181 3300005843 Bacteria 2695
151 Ga0068860_100264454 3300005843 Bacteria 1677
152 Ga0068860_100930565 3300005843 Bacteria 886
153 Ga0068862_100005233 3300005844 Bacteria 10886
154 Ga0068862_100110044 3300005844 Bacteria 2417
155 Ga0068862_100381382 3300005844 Bacteria 1315
156 Ga0068862_101454712 3300005844 Bacteria 690
157 Ga0081455_10044558 3300005937 Bacteria 3868
158 Ga0081538_10006544 3300005981 Bacteria 10233
159 Ga0081539_10071881 3300005985 Bacteria 1851
160 Ga0075368_10015259 3300006042 Bacteria 2848
161 Ga0075363_100172374 3300006048 Bacteria 1229
162 Ga0075364_10129731 3300006051 Bacteria 1691
163 Ga0075364_10173128 3300006051 Bacteria 1459
164 Ga0075364_10499032 3300006051 Bacteria 832
165 Ga0070715_10065779 3300006163 Bacteria 1605
166 Ga0070715_10352860 3300006163 Bacteria 804
167 Ga0070712_100573964 3300006175 Bacteria 952
168 Ga0070712_101249769 3300006175 Bacteria 646
169 Ga0097621_101396939 3300006237 Bacteria 663
170 Ga0068871_100209078 3300006358 Bacteria 1687
171 Ga0068871_101051095 3300006358 Bacteria 760
172 Ga0075428_100099399 3300006844 Bacteria 3172
173 Ga0075428_100344566 3300006844 Bacteria 1600
174 Ga0075428_100723981 3300006844 Bacteria 1059
175 Ga0075430_100336253 3300006846 Bacteria 1248
176 Ga0075430_100336749 3300006846 Bacteria 1247
177 Ga0075431_100009287 3300006847 Bacteria 9865
178 Ga0075431_100375312 3300006847 Bacteria 1427
179 Ga0075431_101173413 3300006847 Bacteria 731
180 Ga0075431_101343425 3300006847 Unclassified 675
181 Ga0075433_10002569 3300006852 Bacteria 13824
182 Ga0075433_10036320 3300006852 Bacteria 4244
183 Ga0075433_10042835 3300006852 Bacteria 3929
184 Ga0075433_10330015 3300006852 Bacteria 1349
185 Ga0075433_10590948 3300006852 Bacteria 975
186 Ga0075433_10977575 3300006852 Bacteria 738
187 Ga0075434_100002609 3300006871 Bacteria 15896
188 Ga0075434_100056895 3300006871 Bacteria 3886
189 Ga0075434_100071338 3300006871 Bacteria 3465
190 Ga0075434_100141283 3300006871 Bacteria 2428
191 Ga0075434_100460369 3300006871 Bacteria 1293
192 Ga0075434_100904324 3300006871 Unclassified 897
193 Ga0075434_102001061 3300006871 Bacteria 585
194 Ga0075429_100238276 3300006880 Bacteria 1594
195 Ga0075429_100777582 3300006880 Bacteria 839
196 Ga0068865_100056759 3300006881 Bacteria 2729
197 Ga0068865_100076261 3300006881 Bacteria 2392
198 Ga0075436_100088038 3300006914 Unclassified 2157
199 Ga0075436_100804826 3300006914 Unclassified 700
200 Ga0075436_100907250 3300006914 Bacteria 659
201 Ga0075436_101147613 3300006914 Bacteria 586
202 Ga0097620_100062588 3300006931 Bacteria 3751
203 Ga0097620_100083293 3300006931 Bacteria 3241
204 Ga0075435_100029936 3300007076 Bacteria 4277
205 Ga0075435_100051448 3300007076 Bacteria 3318
206 Ga0099795_10073275 3300007788 Bacteria 1296
207 Ga0105251_10065033 3300009011 Bacteria 1708
208 Ga0105250_10097186 3300009092 Bacteria 1201
209 Ga0105240_10706397 3300009093 Bacteria 1100
210 Ga0105240_11127665 3300009093 Bacteria 833
211 Ga0111539_10000194 3300009094 Bacteria 71319
212 Ga0111539_10001498 3300009094 Bacteria 31188
213 Ga0111539_10061439 3300009094 Bacteria 4451
214 Ga0111539_10122025 3300009094 Bacteria 3053
215 Ga0111539_10126261 3300009094 Unclassified 2997
216 Ga0111539_10683240 3300009094 Bacteria 1195
217 Ga0105245_10483902 3300009098 Bacteria 1251
218 Ga0105247_10051200 3300009101 Bacteria 2542
219 Ga0105247_10485458 3300009101 Bacteria 897
220 Ga0114129_10000202 3300009147 Bacteria 66203
221 Ga0114129_10013693 3300009147 Bacteria 11557
222 Ga0114129_10408655 3300009147 Bacteria 1788
223 Ga0114129_10775013 3300009147 Bacteria 1226
224 Ga0105243_10565673 3300009148 Bacteria 1089
225 Ga0105241_10500545 3300009174 Bacteria 1083
226 Ga0105241_10778113 3300009174 Bacteria 880
227 Ga0105242_10066717 3300009176 Bacteria 2973
228 Ga0105242_10112225 3300009176 Bacteria 2326
229 Ga0105248_10022143 3300009177 Bacteria 7044
230 Ga0105248_10870995 3300009177 Bacteria 1017
231 Ga0105248_13082926 3300009177 Unclassified 530
232 Ga0105238_11823960 3300009551 Bacteria 640
233 Ga0105249_10091821 3300009553 Bacteria 2841
234 Ga0105249_11223703 3300009553 Bacteria 822
235 Ga0105249_11300191 3300009553 Bacteria 799
236 Ga0105249_12275866 3300009553 Bacteria 615
237 Ga0099796_10074199 3300010159 Bacteria 1235
238 Ga0105239_11488790 3300010375 Bacteria 782
239 Ga0105239_13120003 3300010375 Bacteria 540
240 Ga0105246_10068645 3300011119 Bacteria 2487
241 Ga0105246_10534256 3300011119 Bacteria 1002
242 Ga0105246_11842778 3300011119 Bacteria 579
243 Ga0157344_1007132 3300012476 Bacteria 739
244 Ga0157320_1003499 3300012481 Bacteria 954
245 Ga0157318_1011096 3300012482 Bacteria 677
246 Ga0157321_1007550 3300012487 Bacteria 768
247 Ga0157343_1009691 3300012488 Bacteria 716
248 Ga0157329_1035464 3300012491 Bacteria 537
249 Ga0157335_1005386 3300012492 Bacteria 894
250 Ga0157339_1002495 3300012505 Bacteria 1247
251 Ga0157324_1008976 3300012506 Bacteria 817
252 Ga0157373_10159155 3300013100 Bacteria 1589
253 Ga0157371_10135320 3300013102 Bacteria 1754
254 Ga0157370_10099706 3300013104 Bacteria 2722
255 Ga0157369_12600543 3300013105 Bacteria 511
256 Ga0157374_10064651 3300013296 Bacteria 3434
257 Ga0157378_10178196 3300013297 Bacteria 1998
258 Ga0157378_10488819 3300013297 Bacteria 1228
259 Ga0157378_11523665 3300013297 Bacteria 713
260 Ga0163162_10096906 3300013306 Bacteria 3038
261 Ga0163162_11245502 3300013306 Bacteria 845
262 Ga0157372_10820770 3300013307 Bacteria 1080
263 Ga0157375_10000044 3300013308 Bacteria 155953
264 Ga0157380_10044642 3300014326 Bacteria 3475
265 Ga0157380_10198141 3300014326 Bacteria 1779
266 Ga0157380_11334317 3300014326 Unclassified 766
267 Ga0157377_10076803 3300014745 Bacteria 1943
268 Ga0157377_10127396 3300014745 Bacteria 1550
269 Ga0157377_10711597 3300014745 Bacteria 730
270 Ga0157376_11766137 3300014969 Bacteria 654
271 Ga0163161_10074649 3300017792 Bacteria 2487
272 Ga0163161_10801867 3300017792 Bacteria 791
273 Ga0197907_10320278 3300020069 Bacteria 1556
274 Ga0206356_11696130 3300020070 Bacteria 1627
275 Ga0206349_1872280 3300020075 Bacteria 533
276 Ga0206351_10603668 3300020077 Unclassified 846
277 Ga0206354_11405769 3300020081 Bacteria 922
278 Ga0206353_11280459 3300020082 Bacteria 1308
279 Ga0213873_10034414 3300021358 Bacteria 1277
280 Ga0213872_10007568 3300021361 Bacteria 5334
281 Ga0213872_10374246 3300021361 Bacteria 581
282 Ga0213875_10085213 3300021388 Bacteria 1474
283 Ga0213875_10141540 3300021388 Bacteria 1126
284 Ga0213871_10072137 3300021441 Unclassified 977
285 Ga0224712_10130454 3300022467 Bacteria 1097
286 Ga0207656_10159519 3300025321 Bacteria 1073
287 Ga0207653_10035294 3300025885 Bacteria 1626
288 Ga0207682_10099631 3300025893 Bacteria 1269
289 Ga0207692_10208637 3300025898 Bacteria 1152
290 Ga0207692_10486570 3300025898 Bacteria 781
291 Ga0207692_10495148 3300025898 Bacteria 775
292 Ga0207642_10140512 3300025899 Bacteria 1273
293 Ga0207642_10775982 3300025899 Bacteria 608
294 Ga0207710_10298885 3300025900 Bacteria 813
295 Ga0207688_10089634 3300025901 Bacteria 1765
296 Ga0207680_10363727 3300025903 Bacteria 1018
297 Ga0207647_10189250 3300025904 Bacteria 1193
298 Ga0207685_10258203 3300025905 Bacteria 845
299 Ga0207685_10311915 3300025905 Bacteria 782
300 Ga0207699_10296241 3300025906 Bacteria 1128
301 Ga0207699_11200852 3300025906 Bacteria 562
302 Ga0207645_10029872 3300025907 Bacteria 3513
303 Ga0207645_10148170 3300025907 Bacteria 1531
304 Ga0207643_10012368 3300025908 Bacteria 4613
305 Ga0207643_10181470 3300025908 Bacteria 1274
306 Ga0207705_10855526 3300025909 Bacteria 705
307 Ga0207705_10956206 3300025909 Bacteria 663
308 Ga0207684_10032484 3300025910 Bacteria 4438
309 Ga0207684_10274759 3300025910 Bacteria 1453
310 Ga0207684_10954132 3300025910 Bacteria 719
311 Ga0207684_11739296 3300025910 Bacteria 501
312 Ga0207654_10677488 3300025911 Bacteria 740
313 Ga0207707_11099979 3300025912 Bacteria 648
314 Ga0207707_11262127 3300025912 Bacteria 595
315 Ga0207695_11355160 3300025913 Bacteria 592
316 Ga0207671_11020117 3300025914 Bacteria 652
317 Ga0207693_10062680 3300025915 Bacteria 2913
318 Ga0207693_10516800 3300025915 Bacteria 932
319 Ga0207663_10515818 3300025916 Bacteria 930
320 Ga0207660_11189277 3300025917 Bacteria 620
321 Ga0207662_10011179 3300025918 Bacteria 4969
322 Ga0207662_10380031 3300025918 Bacteria 954
323 Ga0207662_10683174 3300025918 Bacteria 719
324 Ga0207657_10036867 3300025919 Bacteria 4374
325 Ga0207657_10341548 3300025919 Bacteria 1182
326 Ga0207649_10546472 3300025920 Bacteria 886
327 Ga0207649_10598831 3300025920 Bacteria 847
328 Ga0207646_10022911 3300025922 Bacteria 5742
329 Ga0207646_10039940 3300025922 Bacteria 4223
330 Ga0207646_10136340 3300025922 Bacteria 2210
331 Ga0207646_10177937 3300025922 Bacteria 1921
332 Ga0207646_10297630 3300025922 Bacteria 1458
333 Ga0207646_11451591 3300025922 Unclassified 595
334 Ga0207681_10784289 3300025923 Bacteria 796
335 Ga0207681_11552385 3300025923 Bacteria 555
336 Ga0207659_10099495 3300025926 Bacteria 2189
337 Ga0207659_10225682 3300025926 Bacteria 1508
338 Ga0207687_10638805 3300025927 Bacteria 900
339 Ga0207664_10001895 3300025929 Bacteria 13748
340 Ga0207664_10130655 3300025929 Bacteria 2114
341 Ga0207664_11537640 3300025929 Bacteria 587
342 Ga0207690_10205107 3300025932 Bacteria 1500
343 Ga0207690_10301812 3300025932 Bacteria 1253
344 Ga0207690_11044095 3300025932 Bacteria 680
345 Ga0207706_10032639 3300025933 Bacteria 4635
346 Ga0207709_10075384 3300025935 Bacteria 2156
347 Ga0207670_10239006 3300025936 Bacteria 1398
348 Ga0207670_10540067 3300025936 Bacteria 951
349 Ga0207669_10054530 3300025937 Bacteria 2415
350 Ga0207669_10139490 3300025937 Bacteria 1680
351 Ga0207704_10100222 3300025938 Bacteria 1929
352 Ga0207704_11345930 3300025938 Bacteria 611
353 Ga0207665_10279602 3300025939 Bacteria 1242
354 Ga0207691_10258894 3300025940 Bacteria 1500
355 Ga0207711_10366635 3300025941 Bacteria 1335
356 Ga0207711_11437841 3300025941 Bacteria 632
357 Ga0207689_10017369 3300025942 Bacteria 6089
358 Ga0207689_10029324 3300025942 Bacteria 4596
359 Ga0207689_10365124 3300025942 Bacteria 1201
360 Ga0207679_10700298 3300025945 Bacteria 919
361 Ga0207679_11336867 3300025945 Bacteria 658
362 Ga0207667_10629307 3300025949 Bacteria 1080
363 Ga0207651_10947804 3300025960 Bacteria 768
364 Ga0207668_10475637 3300025972 Bacteria 1071
365 Ga0207668_10483634 3300025972 Bacteria 1062
366 Ga0207640_10991597 3300025981 Bacteria 738
367 Ga0207658_10141206 3300025986 Bacteria 1949
368 Ga0207658_10513212 3300025986 Bacteria 1069
369 Ga0207658_10657272 3300025986 Bacteria 945
370 Ga0207658_11102893 3300025986 Bacteria 725
371 Ga0207677_10336713 3300026023 Bacteria 1259
372 Ga0207703_10665861 3300026035 Bacteria 988
373 Ga0207703_11128102 3300026035 Bacteria 753
374 Ga0207678_10023885 3300026067 Bacteria 5346
375 Ga0207678_10113678 3300026067 Bacteria 2310
376 Ga0207708_10032856 3300026075 Bacteria 3940
377 Ga0207708_10204788 3300026075 Bacteria 1575
378 Ga0207702_10084142 3300026078 Bacteria 2769
379 Ga0207702_10171984 3300026078 Bacteria 1987
380 Ga0207641_10277686 3300026088 Bacteria 1574
381 Ga0207641_10681171 3300026088 Bacteria 1011
382 Ga0207648_10001929 3300026089 Bacteria 22670
383 Ga0207648_10622104 3300026089 Bacteria 996
384 Ga0207676_10018645 3300026095 Bacteria 5051
385 Ga0207676_10258056 3300026095 Bacteria 1572
386 Ga0207676_11162440 3300026095 Bacteria 764
387 Ga0207674_10045402 3300026116 Bacteria 4520
388 Ga0207674_10125035 3300026116 Unclassified 2538
389 Ga0207675_100026059 3300026118 Bacteria 5442
390 Ga0207675_100071149 3300026118 Bacteria 3251
391 Ga0207683_10022689 3300026121 Bacteria 5390
392 Ga0207683_10065647 3300026121 Bacteria 3200
393 Ga0207683_10147535 3300026121 Bacteria 2122
394 Ga0207683_10919424 3300026121 Bacteria 812
395 Ga0207683_10972843 3300026121 Bacteria 788
396 Ga0207428_10000365 3300027907 Bacteria 58330
397 Ga0207428_10006355 3300027907 Bacteria 10929
398 Ga0207428_10239132 3300027907 Bacteria 1357
399 Ga0207428_10372554 3300027907 Unclassified 1048
400 Ga0268266_10965884 3300028379 Bacteria 824
401 Ga0268266_11257199 3300028379 Bacteria 715
402 Ga0268266_11585754 3300028379 Bacteria 630
403 Ga0268265_10022401 3300028380 Bacteria 4438
404 Ga0268265_10082547 3300028380 Bacteria 2542
405 Ga0268265_10113603 3300028380 Bacteria 2216
406 Ga0268264_10205579 3300028381 Bacteria 1804
407 Ga0268264_11310715 3300028381 Bacteria 734
408 Ga0265338_10136743 3300028800 Bacteria 1925
409 Ga0265330_10009451 3300031235 Bacteria 4632
410 Ga0265330_10269737 3300031235 Bacteria 717
411 Ga0265332_10000044 3300031238 Bacteria 114444
412 Ga0265328_10002340 3300031239 Bacteria 8544
413 Ga0265320_10274588 3300031240 Unclassified 746
414 Ga0265325_10152569 3300031241 Bacteria 1092
415 Ga0265325_10353035 3300031241 Unclassified 649
416 Ga0265329_10013927 3300031242 Bacteria 2853
417 Ga0265340_10087798 3300031247 Unclassified 1457
418 Ga0265339_10163001 3300031249 Bacteria 1121
419 Ga0265331_10000076 3300031250 Bacteria 145884
420 Ga0265327_10084672 3300031251 Unclassified 1558
421 Ga0265316_10000006 3300031344 Bacteria 289686
422 Ga0265316_10212482 3300031344 Bacteria 1430
423 Ga0265316_10256745 3300031344 Bacteria 1282
424 Ga0307408_100474096 3300031548 Unclassified 1090
425 Ga0265314_10000056 3300031711 Bacteria 171647
426 Ga0265314_10020912 3300031711 Bacteria 5044
427 Ga0265342_10003118 3300031712 Bacteria 13851
428 Ga0265342_10014410 3300031712 Bacteria 5249
429 Ga0265342_10040407 3300031712 Bacteria 2829
430 Ga0316576_10035276 3300031727 Bacteria 3570
431 Ga0316578_10849739 3300031728 Bacteria 528
432 Ga0307405_12046167 3300031731 Unclassified 513
433 Ga0316577_10562014 3300031733 Bacteria 649
434 Ga0307407_10146717 3300031903 Bacteria 1529
435 Ga0307416_103097136 3300032002 Bacteria 556
436 Ga0316592_1149623 3300033524 Unclassified 550
437 Ga0373930_0035367 3300034816 Bacteria 1045
438 Ga0373959_0062089 3300034820 Bacteria 829
439 Ga0373926_0173394 3300035083 Bacteria 826
440 Ga0373929_0213774 3300035085 Bacteria 546
441 Ga0373934_0438086 3300035086 Bacteria 547
442 Ga0373944_0029762 3300035089 Bacteria 1634
443 Ga0373951_0061629 3300035091 Bacteria 940
444 Ga0373923_0257853 3300035111 Bacteria 817
445 Ga0373932_0065659 3300035112 Bacteria 1113
446 Ga0373936_0000641 3300035113 Bacteria 12087
447 Ga0373936_0072518 3300035113 Bacteria 1422
448 Ga0373936_0635535 3300035113 Bacteria 502
449 Ga0373939_0011143 3300035114 Bacteria 2262
450 Ga0373939_0336595 3300035114 Bacteria 611
451 Ga0373945_0035869 3300035116 Bacteria 1774
452 Ga0373953_0007993 3300035117 Bacteria 3571
453 Ga0373954_0026950 3300035118 Bacteria 2636
454 Ga0373957_0038512 3300035120 Bacteria 1790
455 Ga0373957_0526068 3300035120 Bacteria 516
456 Ga0373960_0040444 3300035121 Bacteria 1346
457 Ga0373943_0009965 3300035170 Bacteria 4259
458 Ga0373943_0218876 3300035170 Bacteria 1060
459 Ga0373946_0192679 3300035171 Bacteria 973
460 Ga0373946_0341019 3300035171 Bacteria 747
461 Ga0373955_0097009 3300035172 Bacteria 1687
462 Ga0373961_0055565 3300035241 Bacteria 1187
463 Ga0373924_0017999 3300035410 Bacteria 2718
464 Ga0373924_0496965 3300035410 Bacteria 548
465 Ga0373931_0067194 3300035691 Bacteria 1947
466 Ga0373935_0040709 3300035692 Bacteria 2916
467 Ga0373935_0131306 3300035692 Bacteria 1683
468 Ga0373935_0326388 3300035692 Bacteria 1090
469 Ga0373927_0021329 3300035695 Bacteria 4246
470 Ga0373927_0052566 3300035695 Bacteria 2635
471 Ga0373933_0009791 3300035724 Bacteria 5245
472 Ga0373933_0018208 3300035724 Bacteria 3948
473 Ga0373947_0005413 3300035725 Bacteria 7453
474 Ga0373947_0035367 3300035725 Bacteria 2957
475 Ga0373937_0077831 3300036401 Bacteria 3064
476 Ga0373937_0236233 3300036401 Bacteria 1721
477 Ga0373937_0260448 3300036401 Bacteria 1635
478 Ga0373937_0830029 3300036401 Bacteria 872
479 Ga0373925_0041169 3300037068 Bacteria 3423
480 Ga0395905_0071815 3300037471 Bacteria 3245
481 Ga0395905_0135282 3300037471 Bacteria 2318
482 Ga0436364_0656649 3300037853 Unclassified 731
483 Ga0436364_0773908 3300037853 Bacteria 6045
484 Ga0436364_0939520 3300037853 Bacteria 1240
485 Ga0436364_1429122 3300037853 Bacteria 1269
486 Ga0436365_0824878 3300039437 Bacteria 1402
487 Ga0436360_0072264 3300039438 Bacteria 511
488 Ga0436360_0083095 3300039438 Unclassified 730
489 Ga0436360_0172421 3300039438 Bacteria 2991
490 Ga0436360_0497875 3300039438 Bacteria 1466
491 Ga0436360_0720818 3300039438 Bacteria 657
492 Ga0436360_0869944 3300039438 Bacteria 525
493 Ga0436361_0554849 3300039447 Bacteria 34806
494 Ga0436361_0805706 3300039447 Bacteria 2809
495 Ga0436361_0891320 3300039447 Unclassified 502
496 Ga0436361_0945716 3300039447 Bacteria 703
497 Ga0436363_0255660 3300039450 Bacteria 1467
498 Ga0436362_0104738 3300039453 Bacteria 2138
499 Ga0436362_0621761 3300039453 Bacteria 821
500 Ga0436362_0735501 3300039453 Bacteria 1945
501 Ga0451807_2499475 3300041486 Bacteria 564
502 Ga0451849_1286789 3300041505 Bacteria 558
503 Ga0451853_1584074 3300041512 Bacteria 827
504 Ga0439441_022517 3300042001 Bacteria 1172
505 Ga0450921_010801 3300042123 Bacteria 772
506 Ga0450923_060066 3300042125 Bacteria 828
507 Ga0450894_005576 3300042131 Bacteria 1628
508 Ga0450896_006073 3300042133 Bacteria 1652
509 Ga0450899_010744 3300042135 Bacteria 1017
510 Ga0439434_0245645 3300042435 Unclassified 611
511 Ga0450918_002582 3300042531 Bacteria 3425
512 Ga0451577_0014229 3300042876 Bacteria 7416
513 Ga0451577_0109967 3300042876 Bacteria 2465
514 Ga0451577_0127802 3300042876 Bacteria 2278
515 Ga0451577_0456119 3300042876 Bacteria 1161
516 Ga0451577_0856898 3300042876 Unclassified 819
517 Ga0439440_0176197 3300042993 Unclassified 624
518 Ga0453683_0394365 3300044673 Bacteria 892
519 Ga0466963_0963742 3300044694 Bacteria 601
520 Ga0466964_0452890 3300044706 Bacteria 681
521 Ga0453684_0007847 3300044712 Bacteria 19434
522 Ga0453684_0567381 3300044712 Bacteria 1248
523 Ga0466968_0104654 3300044735 Bacteria 1267
524 Ga0451576_0010179 3300045051 Bacteria 10813
525 Ga0451576_2369635 3300045051 Unclassified 543
526 Ga0451576_2608165 3300045051 Unclassified 515
527 Ga0466967_0525786 3300045976 Bacteria 1163
528 Ga0495592_0030815 3300046454 Bacteria 4057
529 Ga0495592_0282763 3300046454 Bacteria 1084
530 Ga0495603_0025782 3300046455 Bacteria 3554
531 Ga0495641_0022240 3300046461 Bacteria 3175
532 Ga0495651_0072227 3300046462 Bacteria 2621
533 Ga0495651_0686263 3300046462 Bacteria 639
534 Ga0495651_1003004 3300046462 Bacteria 506
535 Ga0495653_0457652 3300046463 Bacteria 801
536 Ga0495580_0173771 3300046472 Bacteria 1488
537 Ga0495580_0482001 3300046472 Bacteria 829
538 Ga0495582_0005954 3300046473 Bacteria 6800
539 Ga0495639_0003444 3300046475 Bacteria 6851
540 Ga0495639_0369476 3300046475 Bacteria 722
541 Ga0495662_0196737 3300046476 Bacteria 994
542 Ga0495664_0015894 3300046477 Bacteria 4283
543 Ga0495664_0500602 3300046477 Bacteria 725
544 Ga0495594_0170797 3300046499 Bacteria 1237
545 Ga0495608_0020357 3300046511 Bacteria 4559
546 Ga0495608_0101336 3300046511 Bacteria 1856
547 Ga0495618_0014606 3300046514 Bacteria 4786
548 Ga0495628_0168857 3300046516 Bacteria 1659
549 Ga0495628_0192257 3300046516 Bacteria 1540
550 Ga0495630_0083288 3300046517 Bacteria 2414
551 Ga0495666_0004676 3300046526 Bacteria 6926
552 Ga0495652_0044698 3300046529 Bacteria 3812
553 Ga0495652_0478035 3300046529 Bacteria 868
554 Ga0495652_0685820 3300046529 Bacteria 690
555 Ga0495652_0839711 3300046529 Bacteria 609
556 Ga0495665_0007757 3300046531 Bacteria 5806
557 Ga0495640_0230638 3300046533 Bacteria 1164
558 Ga0495586_0073868 3300046535 Bacteria 1865
559 Ga0495587_0023688 3300046536 Bacteria 3771
560 Ga0495609_0152922 3300046538 Unclassified 981
561 Ga0495645_0020867 3300046543 Bacteria 4733
562 Ga0495645_0093098 3300046543 Bacteria 2151
563 Ga0495645_0366851 3300046543 Bacteria 924
564 Ga0495667_0014969 3300046559 Bacteria 5240
565 Ga0495667_0894605 3300046559 Bacteria 544
566 Ga0495656_0087739 3300046615 Bacteria 1417
567 Ga0495634_0072746 3300046642 Bacteria 2260
568 Ga0495635_0007103 3300046663 Bacteria 7829
569 Ga0495635_0397659 3300046663 Bacteria 915
570 Ga0495635_0853845 3300046663 Bacteria 585
571 Ga0495657_0026472 3300046675 Bacteria 4106
572 Ga0495657_0067938 3300046675 Bacteria 2337
573 Ga0495599_0022147 3300046678 Bacteria 3965
574 Ga0495599_0423780 3300046678 Bacteria 790
575 Ga0495599_0822723 3300046678 Bacteria 530
576 Ga0495623_0140733 3300046679 Bacteria 1435
577 Ga0495646_0022907 3300046680 Bacteria 3934
578 Ga0495646_0134533 3300046680 Bacteria 1388
579 Ga0495647_0016034 3300046681 Bacteria 2634
580 Ga0495658_0004533 3300046683 Bacteria 6829
581 Ga0495669_0008295 3300046684 Bacteria 4363
582 Ga0495669_0130111 3300046684 Bacteria 1184
583 Ga0495624_0009644 3300046690 Bacteria 6683
584 Ga0495589_0205411 3300046794 Bacteria 929
585 Ga0495600_0080838 3300046809 Bacteria 2121
586 Ga0495600_0423012 3300046809 Bacteria 826
587 Ga0495581_0006948 3300047315 Bacteria 6555
588 Ga0495581_0151436 3300047315 Bacteria 1354
589 Ga0495604_0031488 3300047317 Bacteria 4206
590 Ga0495674_0068827 3300047319 Bacteria 3062
591 Ga0495674_0358515 3300047319 Bacteria 1183
592 Ga0495676_0069839 3300047321 Bacteria 2708
593 Ga0495680_0010283 3300047322 Bacteria 8346
594 Ga0495680_0730761 3300047322 Bacteria 651
595 Ga0495675_0023875 3300047444 Bacteria 3896
596 Ga0495684_0018890 3300047471 Bacteria 5307
597 Ga0495593_0015149 3300047673 Bacteria 4376
598 Ga0495602_0164195 3300048088 Bacteria 1730
599 Ga0495602_0247129 3300048088 Bacteria 1331
600 Ga0495614_0032217 3300048089 Bacteria 2256
601 Ga0496100_0265894 3300048903 Bacteria 1273
602 Ga0496100_0890682 3300048903 Unclassified 699
603 Ga0496100_1014808 3300048903 Bacteria 653
604 Ga0496101_0044842 3300048904 Bacteria 3165
605 Ga0496101_0262555 3300048904 Bacteria 1347
606 Ga0496102_1165143 3300048905 Bacteria 690
607 Ga0496103_0099101 3300048906 Bacteria 1843
608 Ga0496103_1051753 3300048906 Unclassified 505
609 Ga0496104_0347717 3300048907 Bacteria 1395
610 Ga0496104_0686244 3300048907 Bacteria 932
611 Ga0496105_0874230 3300048908 Bacteria 679
612 Ga0496106_0367548 3300048909 Bacteria 1156
613 Ga0496106_1198555 3300048909 Bacteria 592
614 Ga0496107_0537707 3300048910 Unclassified 866
615 Ga0496107_0620213 3300048910 Bacteria 798
616 Ga0496108_0165900 3300048911 Bacteria 1909
617 Ga0496108_0272670 3300048911 Bacteria 1473
618 Ga0496108_0648841 3300048911 Bacteria 918
619 Ga0496109_0614317 3300048912 Bacteria 1023
620 Ga0496110_0346338 3300048913 Bacteria 1353
621 Ga0496110_0748035 3300048913 Bacteria 881
622 Ga0496111_0505231 3300048914 Bacteria 889
623 Ga0496112_0034784 3300048915 Bacteria 4903
624 Ga0496112_0195410 3300048915 Bacteria 1984
625 Ga0496114_0541721 3300048917 Bacteria 1029
626 Ga0496115_0080503 3300048918 Bacteria 2652
627 Ga0496115_0512695 3300048918 Bacteria 962
628 Ga0501031_0203034 3300049568 Bacteria 1293
629 Ga0501031_0336846 3300049568 Bacteria 977
630 Ga0501031_0912585 3300049568 Bacteria 562
631 Ga0501033_0987069 3300049570 Unclassified 563
632 Ga0501036_0543986 3300049572 Bacteria 965
633 Ga0501037_0746570 3300049573 Bacteria 649
634 Ga0501038_0379574 3300049574 Bacteria 1097
635 Ga0501039_0402963 3300049575 Bacteria 1074
636 Ga0501039_1578220 3300049575 Bacteria 504
637 Ga0501040_0203845 3300049576 Bacteria 1405
638 Ga0501040_0322749 3300049576 Bacteria 1104
639 Ga0501040_0375398 3300049576 Bacteria 1020
640 Ga0501041_0269418 3300049577 Bacteria 1071
641 Ga0501042_0688382 3300049578 Bacteria 743
642 Ga0501046_0051976 3300049580 Bacteria 3232
643 Ga0501046_0501839 3300049580 Bacteria 869
644 Ga0501046_0619116 3300049580 Bacteria 767
645 Ga0501048_0827439 3300049582 Bacteria 665
646 Ga0501068_0782388 3300049584 Bacteria 625
647 Ga0501070_1213978 3300049586 Bacteria 578
648 Ga0501070_1477082 3300049586 Bacteria 515
649 Ga0501071_0625311 3300049587 Bacteria 828
650 Ga0501071_1187832 3300049587 Bacteria 589
651 Ga0501072_0003022 3300049588 Bacteria 12690
652 Ga0501072_0176020 3300049588 Bacteria 1707
653 Ga0501072_0431751 3300049588 Bacteria 1044
654 Ga0501073_0428038 3300049589 Bacteria 915
655 Ga0501073_0589459 3300049589 Bacteria 768
656 Ga0501074_0040599 3300049590 Bacteria 3370
657 Ga0501074_0116369 3300049590 Bacteria 1913
658 Ga0501074_0640465 3300049590 Bacteria 751
659 Ga0501075_0016028 3300049591 Bacteria 5392
660 Ga0501075_0344685 3300049591 Bacteria 1135
661 Ga0501076_0015432 3300049592 Bacteria 5772
662 Ga0501076_0147829 3300049592 Bacteria 1911
663 Ga0501076_1064558 3300049592 Bacteria 666
664 Ga0501077_0432384 3300049593 Bacteria 842
665 Ga0501077_0475093 3300049593 Bacteria 801
666 Ga0501079_0004245 3300049741 Bacteria 10628
667 Ga0501079_0221810 3300049741 Bacteria 1477
668 Ga0501080_0446479 3300049742 Bacteria 1160
669 Ga0501081_0019917 3300049743 Bacteria 4469
670 Ga0501081_0739137 3300049743 Bacteria 739
671 Ga0501083_0712409 3300049744 Bacteria 653
672 Ga0501035_0253175 3300049822 Bacteria 1495
673 Ga0501045_0100239 3300049824 Bacteria 2144
674 Ga0501045_0705794 3300049824 Bacteria 744
675 nmdc:mga03683_254731_c1 3300050489 Bacteria 816
676 nmdc:mga03n38_14316_c1 3300050490 Bacteria 3036
677 nmdc:mga00v17_408162_c1 3300050491 Bacteria 883
678 nmdc:mga00v17_52966_c1 3300050491 Bacteria 2472
679 nmdc:mga0yw44_10402_c1 3300050492 Bacteria 4752
680 nmdc:mga0k408_3942_c1 3300050493 Bacteria 7870
681 nmdc:mga06z11_9299_c1 3300050494 Bacteria 4136
682 nmdc:mga07m45_57780_c2 3300050496 Bacteria 658
683 nmdc:mga05p37_105024_c1 3300050507 Bacteria 3475
684 nmdc:mga05p37_1087913_c1 3300050507 Bacteria 839
685 nmdc:mga05p37_1110428_c1 3300050507 Bacteria 827
686 nmdc:mga05p37_1278851_c1 3300050507 Bacteria 750
687 nmdc:mga05p37_2092021_c1 3300050507 Bacteria 531
688 nmdc:mga05p37_38560_c1 3300050507 Bacteria 5861
689 nmdc:mga05p37_726382_c1 3300050507 Bacteria 1099
690 nmdc:mga05p37_8774_c1 3300050507 Bacteria 11941
691 nmdc:mga09592_239313_c1 3300050508 Bacteria 1573
692 nmdc:mga09592_577724_c1 3300050508 Bacteria 964
693 nmdc:mga0qj67_1492090_c1 3300050509 Unclassified 520
694 nmdc:mga0qj67_394374_c1 3300050509 Bacteria 1117
695 nmdc:mga06r32_15456_c1 3300050510 Bacteria 6929
696 nmdc:mga06r32_542477_c1 3300050510 Bacteria 1137
697 nmdc:mga06r32_8449_c1 3300050510 Bacteria 9280
698 nmdc:mga08y16_1299_c1 3300050511 Bacteria 24801
699 nmdc:mga08y16_47842_c1 3300050511 Unclassified 4476
700 nmdc:mga08y16_63226_c1 3300050511 Bacteria 3865
701 nmdc:mga08y16_763654_c1 3300050511 Unclassified 962
702 nmdc:mga08y16_96614_c1 3300050511 Bacteria 3077
703 nmdc:mga0n895_139937_c1 3300050512 Bacteria 2448
704 nmdc:mga0n895_141171_c1 3300050512 Unclassified 2437
705 nmdc:mga0n895_1549890_c1 3300050512 Bacteria 628
706 nmdc:mga0n895_160226_c1 3300050512 Bacteria 2282
707 nmdc:mga0n895_283321_c1 3300050512 Bacteria 1680
708 nmdc:mga0n895_3543_c1 3300050512 Bacteria 12629
709 nmdc:mga0n895_91689_c1 3300050512 Bacteria 3041
710 nmdc:mga0rr50_155431_c1 3300050513 Unclassified 1852
711 nmdc:mga0rr50_15951_c1 3300050513 Bacteria 4974
712 nmdc:mga0rr50_32554_c1 3300050513 Bacteria 3715
713 nmdc:mga0rr50_476643_c1 3300050513 Bacteria 1059
714 nmdc:mga0rr50_857397_c1 3300050513 Bacteria 775
715 nmdc:mga0rr50_90925_c1 3300050513 Bacteria 2376
716 nmdc:mga08x19_444253_c1 3300050514 Bacteria 912
717 nmdc:mga08x19_67079_c1 3300050514 Bacteria 1867
718 nmdc:mga08x19_80877_c1 3300050514 Unclassified 2133
719 nmdc:mga08x19_816822_c1 3300050514 Unclassified 662
720 nmdc:mga0a205_11026_c1 3300050515 Bacteria 8319
721 nmdc:mga0a205_270453_c2 3300050515 Unclassified 1229
722 nmdc:mga0a205_35606_c2 3300050515 Bacteria 3731
723 nmdc:mga0a205_632037_c1 3300050515 Bacteria 922
724 nmdc:mga0a205_6938_c1 3300050515 Bacteria 10241
725 nmdc:mga0a205_694_c1 3300050515 Bacteria 18029
726 nmdc:mga0a205_94824_c1 3300050515 Unclassified 2883
727 Ga0495601_0000713 3300053077 Bacteria 17851
728 Ga0495601_0032225 3300053077 Bacteria 3261
729 Ga0495601_0184262 3300053077 Bacteria 1364
730 Ga0495612_0017245 3300053078 Bacteria 2892
731 Ga0495612_0071902 3300053078 Bacteria 1443
732 Ga0495595_0067770 3300053084 Bacteria 1682
733 Ga0495595_0187165 3300053084 Bacteria 1028
734 Ga0495595_0681918 3300053084 Bacteria 526
735 Ga0495619_0029947 3300053085 Bacteria 3520
736 Ga0495619_0643511 3300053085 Bacteria 723
737 Ga0501084_0018114 3300054114 Bacteria 5865
738 Ga0501084_0261346 3300054114 Bacteria 1461
739 Ga0501084_0492221 3300054114 Bacteria 1036
740 Ga0501084_1730254 3300054114 Bacteria 522
741 Ga0590071_028216 3300059421 Bacteria 1333
742 Ga0590071_119618 3300059421 Bacteria 672
743 Ga0590074_043974 3300059423 Bacteria 808
744 Ga0501082_0195728 3300060353 Bacteria 1758
745 Ga0501082_0242248 3300060353 Bacteria 1569
746 Ga0501082_0434965 3300060353 Bacteria 1146
747 Ga0530510_1474843 3300061734 Bacteria 522

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_1492090_c1 nmdc:mga0qj67_1492090_c1_165_449 94
2 3300041512 Ga0451853_1584074 Ga0451853_1584074_383_670 95
3 3300042876 Ga0451577_0127802 Ga0451577_0127802_825_1112 95
4 3300044712 Ga0453684_0567381 Ga0453684_0567381_453_740 95
5 3300049575 Ga0501039_1578220 Ga0501039_1578220_173_460 95
6 3300049576 Ga0501040_0375398 Ga0501040_0375398_444_731 95
7 3300049578 Ga0501042_0688382 Ga0501042_0688382_310_597 95
8 3300049586 Ga0501070_1213978 Ga0501070_1213978_85_372 95
9 3300049588 Ga0501072_0431751 Ga0501072_0431751_111_398 95
10 3300049592 Ga0501076_0147829 Ga0501076_0147829_388_675 95
11 3300049593 Ga0501077_0475093 Ga0501077_0475093_432_719 95
12 3300049741 Ga0501079_0221810 Ga0501079_0221810_507_794 95
13 3300049742 Ga0501080_0446479 Ga0501080_0446479_577_864 95
14 3300049824 Ga0501045_0705794 Ga0501045_0705794_53_340 95
15 3300054114 Ga0501084_0492221 Ga0501084_0492221_522_809 95
16 3300060353 Ga0501082_0242248 Ga0501082_0242248_366_653 95
17 3300005471 Ga0070698_100076682 Ga0070698_1000766824 97
18 3300003373 JGI25407J50210_10027374 JGI25407J50210_100273742 98
19 3300004803 Ga0058862_12018065 Ga0058862_120180652 98
20 3300005327 Ga0070658_11653618 Ga0070658_116536182 98
21 3300005329 Ga0070683_100047912 Ga0070683_1000479124 98
22 3300005330 Ga0070690_100337367 Ga0070690_1003373671 98
23 3300005330 Ga0070690_100532474 Ga0070690_1005324742 98
24 3300005330 Ga0070690_100835381 Ga0070690_1008353811 98
25 3300005333 Ga0070677_10650010 Ga0070677_106500102 98
26 3300005334 Ga0068869_100018892 Ga0068869_1000188922 98
27 3300005334 Ga0068869_100113757 Ga0068869_1001137571 98
28 3300005334 Ga0068869_100555449 Ga0068869_1005554493 98
29 3300005335 Ga0070666_10078455 Ga0070666_100784554 98
30 3300005335 Ga0070666_10399349 Ga0070666_103993492 98
31 3300005335 Ga0070666_10555314 Ga0070666_105553142 98
32 3300005336 Ga0070680_100068624 Ga0070680_1000686244 98
33 3300005336 Ga0070680_100407166 Ga0070680_1004071662 98
34 3300005337 Ga0070682_100423416 Ga0070682_1004234162 98
35 3300005338 Ga0068868_100057907 Ga0068868_1000579074 98
36 3300005338 Ga0068868_100595569 Ga0068868_1005955692 98
37 3300005339 Ga0070660_100150544 Ga0070660_1001505442 98
38 3300005339 Ga0070660_100373963 Ga0070660_1003739632 98
39 3300005340 Ga0070689_100051129 Ga0070689_1000511292 98
40 3300005340 Ga0070689_100059453 Ga0070689_1000594532 98
41 3300005340 Ga0070689_100890077 Ga0070689_1008900772 98
42 3300005340 Ga0070689_100969010 Ga0070689_1009690101 98
43 3300005341 Ga0070691_10516839 Ga0070691_105168391 98
44 3300005341 Ga0070691_11075777 Ga0070691_110757771 98
45 3300005343 Ga0070687_100029280 Ga0070687_1000292803 98
46 3300005343 Ga0070687_101378880 Ga0070687_1013788801 98
47 3300005345 Ga0070692_10033655 Ga0070692_100336553 98
48 3300005345 Ga0070692_10584411 Ga0070692_105844112 98
49 3300005347 Ga0070668_100767351 Ga0070668_1007673512 98
50 3300005347 Ga0070668_100881089 Ga0070668_1008810892 98
51 3300005353 Ga0070669_100072401 Ga0070669_1000724013 98
52 3300005353 Ga0070669_101858442 Ga0070669_1018584421 98
53 3300005354 Ga0070675_100812546 Ga0070675_1008125461 98
54 3300005355 Ga0070671_101525621 Ga0070671_1015256211 98
55 3300005356 Ga0070674_100015560 Ga0070674_1000155604 98
56 3300005356 Ga0070674_100435832 Ga0070674_1004358322 98
57 3300005364 Ga0070673_100087869 Ga0070673_1000878693 98
58 3300005364 Ga0070673_100297542 Ga0070673_1002975423 98
59 3300005364 Ga0070673_101003114 Ga0070673_1010031141 98
60 3300005364 Ga0070673_101591364 Ga0070673_1015913641 98
61 3300005365 Ga0070688_100043817 Ga0070688_1000438173 98
62 3300005366 Ga0070659_100067384 Ga0070659_1000673842 98
63 3300005366 Ga0070659_100420793 Ga0070659_1004207931 98
64 3300005366 Ga0070659_100971426 Ga0070659_1009714262 98
65 3300005366 Ga0070659_101040552 Ga0070659_1010405522 98
66 3300005367 Ga0070667_100062122 Ga0070667_1000621221 98
67 3300005367 Ga0070667_100770141 Ga0070667_1007701411 98
68 3300005367 Ga0070667_101635510 Ga0070667_1016355102 98
69 3300005406 Ga0070703_10280199 Ga0070703_102801992 98
70 3300005434 Ga0070709_10343032 Ga0070709_103430323 98
71 3300005434 Ga0070709_10370451 Ga0070709_103704511 98
72 3300005435 Ga0070714_100602137 Ga0070714_1006021372 98
73 3300005436 Ga0070713_100717188 Ga0070713_1007171882 98
74 3300005438 Ga0070701_10259489 Ga0070701_102594892 98
75 3300005438 Ga0070701_10322017 Ga0070701_103220172 98
76 3300005440 Ga0070705_100103125 Ga0070705_1001031252 98
77 3300005441 Ga0070700_100142337 Ga0070700_1001423372 98
78 3300005441 Ga0070700_100899397 Ga0070700_1008993972 98
79 3300005441 Ga0070700_101078231 Ga0070700_1010782312 98
80 3300005444 Ga0070694_100114193 Ga0070694_1001141932 98
81 3300005444 Ga0070694_100262806 Ga0070694_1002628062 98
82 3300005444 Ga0070694_101558899 Ga0070694_1015588991 98
83 3300005445 Ga0070708_100034155 Ga0070708_1000341555 98
84 3300005445 Ga0070708_100234236 Ga0070708_1002342362 98
85 3300005445 Ga0070708_101917463 Ga0070708_1019174631 98
86 3300005455 Ga0070663_100040086 Ga0070663_1000400864 98
87 3300005455 Ga0070663_101231440 Ga0070663_1012314402 98
88 3300005456 Ga0070678_100168479 Ga0070678_1001684792 98
89 3300005456 Ga0070678_100202372 Ga0070678_1002023722 98
90 3300005456 Ga0070678_100432739 Ga0070678_1004327392 98
91 3300005456 Ga0070678_100974825 Ga0070678_1009748252 98
92 3300005457 Ga0070662_100720922 Ga0070662_1007209221 98
93 3300005458 Ga0070681_10361376 Ga0070681_103613762 98
94 3300005458 Ga0070681_10875172 Ga0070681_108751722 98
95 3300005459 Ga0068867_100108454 Ga0068867_1001084543 98
96 3300005459 Ga0068867_101046177 Ga0068867_1010461771 98
97 3300005466 Ga0070685_10218033 Ga0070685_102180333 98
98 3300005467 Ga0070706_100252468 Ga0070706_1002524682 98
99 3300005467 Ga0070706_100326300 Ga0070706_1003263002 98
100 3300005468 Ga0070707_100200634 Ga0070707_1002006343 98
101 3300005468 Ga0070707_100255373 Ga0070707_1002553732 98
102 3300005468 Ga0070707_100333729 Ga0070707_1003337292 98
103 3300005468 Ga0070707_101081871 Ga0070707_1010818712 98
104 3300005471 Ga0070698_100096058 Ga0070698_1000960584 98
105 3300005471 Ga0070698_100586290 Ga0070698_1005862901 98
106 3300005471 Ga0070698_100913883 Ga0070698_1009138831 98
107 3300005471 Ga0070698_101252050 Ga0070698_1012520501 98
108 3300005518 Ga0070699_100000430 Ga0070699_10000043013 98
109 3300005518 Ga0070699_101493485 Ga0070699_1014934851 98
110 3300005530 Ga0070679_100501595 Ga0070679_1005015952 98
111 3300005535 Ga0070684_100226725 Ga0070684_1002267252 98
112 3300005535 Ga0070684_100294699 Ga0070684_1002946992 98
113 3300005536 Ga0070697_100175009 Ga0070697_1001750093 98
114 3300005536 Ga0070697_100316271 Ga0070697_1003162712 98
115 3300005536 Ga0070697_100527028 Ga0070697_1005270282 98
116 3300005536 Ga0070697_101879045 Ga0070697_1018790451 98
117 3300005543 Ga0070672_101582558 Ga0070672_1015825582 98
118 3300005544 Ga0070686_100026390 Ga0070686_1000263901 98
119 3300005544 Ga0070686_100154777 Ga0070686_1001547772 98
120 3300005544 Ga0070686_101076133 Ga0070686_1010761331 98
121 3300005544 Ga0070686_101376255 Ga0070686_1013762551 98
122 3300005545 Ga0070695_100364242 Ga0070695_1003642422 98
123 3300005545 Ga0070695_100573694 Ga0070695_1005736942 98
124 3300005545 Ga0070695_100729012 Ga0070695_1007290122 98
125 3300005546 Ga0070696_100076940 Ga0070696_1000769402 98
126 3300005546 Ga0070696_100084323 Ga0070696_1000843232 98
127 3300005547 Ga0070693_100114322 Ga0070693_1001143222 98
128 3300005547 Ga0070693_100376107 Ga0070693_1003761072 98
129 3300005547 Ga0070693_100678182 Ga0070693_1006781821 98
130 3300005548 Ga0070665_100110862 Ga0070665_1001108622 98
131 3300005548 Ga0070665_100270778 Ga0070665_1002707782 98
132 3300005548 Ga0070665_100352147 Ga0070665_1003521473 98
133 3300005548 Ga0070665_101243394 Ga0070665_1012433942 98
134 3300005549 Ga0070704_100434803 Ga0070704_1004348032 98
135 3300005563 Ga0068855_100294244 Ga0068855_1002942442 98
136 3300005564 Ga0070664_100580401 Ga0070664_1005804012 98
137 3300005564 Ga0070664_101232296 Ga0070664_1012322961 98
138 3300005577 Ga0068857_100050616 Ga0068857_1000506162 98
139 3300005577 Ga0068857_100260412 Ga0068857_1002604122 98
140 3300005578 Ga0068854_100151760 Ga0068854_1001517602 98
141 3300005578 Ga0068854_101739402 Ga0068854_1017394021 98
142 3300005615 Ga0070702_100019763 Ga0070702_1000197633 98
143 3300005615 Ga0070702_100050912 Ga0070702_1000509122 98
144 3300005615 Ga0070702_100248584 Ga0070702_1002485842 98
145 3300005615 Ga0070702_100518801 Ga0070702_1005188012 98
146 3300005616 Ga0068852_100771446 Ga0068852_1007714462 98
147 3300005616 Ga0068852_102074813 Ga0068852_1020748132 98
148 3300005617 Ga0068859_100062593 Ga0068859_1000625933 98
149 3300005617 Ga0068859_100083297 Ga0068859_1000832974 98
150 3300005618 Ga0068864_100040791 Ga0068864_1000407912 98
151 3300005618 Ga0068864_100098562 Ga0068864_1000985624 98
152 3300005618 Ga0068864_101058101 Ga0068864_1010581012 98
153 3300005718 Ga0068866_10046246 Ga0068866_100462462 98
154 3300005718 Ga0068866_10311574 Ga0068866_103115743 98
155 3300005719 Ga0068861_100433729 Ga0068861_1004337292 98
156 3300005719 Ga0068861_101233154 Ga0068861_1012331542 98
157 3300005834 Ga0068851_10537432 Ga0068851_105374322 98
158 3300005840 Ga0068870_10051373 Ga0068870_100513733 98
159 3300005841 Ga0068863_100011064 Ga0068863_1000110641 98
160 3300005841 Ga0068863_100132718 Ga0068863_1001327184 98
161 3300005841 Ga0068863_100396373 Ga0068863_1003963732 98
162 3300005842 Ga0068858_100071919 Ga0068858_1000719193 98
163 3300005842 Ga0068858_100831434 Ga0068858_1008314343 98
164 3300005843 Ga0068860_100105181 Ga0068860_1001051812 98
165 3300005843 Ga0068860_100264454 Ga0068860_1002644542 98
166 3300005843 Ga0068860_100930565 Ga0068860_1009305651 98
167 3300005844 Ga0068862_100005233 Ga0068862_1000052335 98
168 3300005844 Ga0068862_100110044 Ga0068862_1001100444 98
169 3300005844 Ga0068862_100381382 Ga0068862_1003813822 98
170 3300005844 Ga0068862_101454712 Ga0068862_1014547122 98
171 3300005937 Ga0081455_10044558 Ga0081455_100445582 98
172 3300005981 Ga0081538_10006544 Ga0081538_100065444 98
173 3300006042 Ga0075368_10015259 Ga0075368_100152592 98
174 3300006048 Ga0075363_100172374 Ga0075363_1001723742 98
175 3300006051 Ga0075364_10129731 Ga0075364_101297314 98
176 3300006051 Ga0075364_10173128 Ga0075364_101731282 98
177 3300006051 Ga0075364_10499032 Ga0075364_104990322 98
178 3300006163 Ga0070715_10065779 Ga0070715_100657792 98
179 3300006163 Ga0070715_10352860 Ga0070715_103528602 98
180 3300006175 Ga0070712_100573964 Ga0070712_1005739642 98
181 3300006175 Ga0070712_101249769 Ga0070712_1012497692 98
182 3300006237 Ga0097621_101396939 Ga0097621_1013969391 98
183 3300006358 Ga0068871_100209078 Ga0068871_1002090783 98
184 3300006358 Ga0068871_101051095 Ga0068871_1010510952 98
185 3300006844 Ga0075428_100099399 Ga0075428_1000993992 98
186 3300006844 Ga0075428_100344566 Ga0075428_1003445662 98
187 3300006844 Ga0075428_100723981 Ga0075428_1007239812 98
188 3300006846 Ga0075430_100336253 Ga0075430_1003362532 98
189 3300006846 Ga0075430_100336749 Ga0075430_1003367492 98
190 3300006847 Ga0075431_100009287 Ga0075431_1000092875 98
191 3300006847 Ga0075431_100375312 Ga0075431_1003753122 98
192 3300006847 Ga0075431_101173413 Ga0075431_1011734132 98
193 3300006847 Ga0075431_101343425 Ga0075431_1013434252 98
194 3300006852 Ga0075433_10002569 Ga0075433_100025693 98
195 3300006852 Ga0075433_10036320 Ga0075433_100363202 98
196 3300006852 Ga0075433_10042835 Ga0075433_100428354 98
197 3300006852 Ga0075433_10330015 Ga0075433_103300152 98
198 3300006852 Ga0075433_10590948 Ga0075433_105909482 98
199 3300006852 Ga0075433_10977575 Ga0075433_109775752 98
200 3300006871 Ga0075434_100002609 Ga0075434_10000260912 98
201 3300006871 Ga0075434_100056895 Ga0075434_1000568953 98
202 3300006871 Ga0075434_100071338 Ga0075434_1000713385 98
203 3300006871 Ga0075434_100141283 Ga0075434_1001412832 98
204 3300006871 Ga0075434_100460369 Ga0075434_1004603693 98
205 3300006871 Ga0075434_100904324 Ga0075434_1009043242 98
206 3300006871 Ga0075434_102001061 Ga0075434_1020010612 98
207 3300006880 Ga0075429_100238276 Ga0075429_1002382763 98
208 3300006880 Ga0075429_100777582 Ga0075429_1007775822 98
209 3300006881 Ga0068865_100056759 Ga0068865_1000567592 98
210 3300006881 Ga0068865_100076261 Ga0068865_1000762612 98
211 3300006914 Ga0075436_100088038 Ga0075436_1000880382 98
212 3300006914 Ga0075436_100804826 Ga0075436_1008048262 98
213 3300006914 Ga0075436_100907250 Ga0075436_1009072502 98
214 3300006914 Ga0075436_101147613 Ga0075436_1011476131 98
215 3300006931 Ga0097620_100062588 Ga0097620_1000625883 98
216 3300006931 Ga0097620_100083293 Ga0097620_1000832932 98
217 3300007076 Ga0075435_100029936 Ga0075435_1000299365 98
218 3300007076 Ga0075435_100051448 Ga0075435_1000514482 98
219 3300007788 Ga0099795_10073275 Ga0099795_100732752 98
220 3300009011 Ga0105251_10065033 Ga0105251_100650332 98
221 3300009092 Ga0105250_10097186 Ga0105250_100971862 98
222 3300009093 Ga0105240_10706397 Ga0105240_107063972 98
223 3300009093 Ga0105240_11127665 Ga0105240_111276652 98
224 3300009094 Ga0111539_10000194 Ga0111539_1000019439 98
225 3300009094 Ga0111539_10001498 Ga0111539_1000149817 98
226 3300009094 Ga0111539_10061439 Ga0111539_100614393 98
227 3300009094 Ga0111539_10122025 Ga0111539_101220254 98
228 3300009094 Ga0111539_10126261 Ga0111539_101262613 98
229 3300009094 Ga0111539_10683240 Ga0111539_106832402 98
230 3300009098 Ga0105245_10483902 Ga0105245_104839021 98
231 3300009101 Ga0105247_10051200 Ga0105247_100512005 98
232 3300009101 Ga0105247_10485458 Ga0105247_104854582 98
233 3300009147 Ga0114129_10000202 Ga0114129_1000020221 98
234 3300009147 Ga0114129_10013693 Ga0114129_100136934 98
235 3300009147 Ga0114129_10408655 Ga0114129_104086553 98
236 3300009147 Ga0114129_10775013 Ga0114129_107750132 98
237 3300009148 Ga0105243_10565673 Ga0105243_105656732 98
238 3300009174 Ga0105241_10500545 Ga0105241_105005452 98
239 3300009174 Ga0105241_10778113 Ga0105241_107781132 98
240 3300009176 Ga0105242_10066717 Ga0105242_100667171 98
241 3300009176 Ga0105242_10112225 Ga0105242_101122252 98
242 3300009177 Ga0105248_10022143 Ga0105248_100221432 98
243 3300009177 Ga0105248_10870995 Ga0105248_108709952 98
244 3300009177 Ga0105248_13082926 Ga0105248_130829261 98
245 3300009551 Ga0105238_11823960 Ga0105238_118239602 98
246 3300009553 Ga0105249_10091821 Ga0105249_100918213 98
247 3300009553 Ga0105249_11223703 Ga0105249_112237032 98
248 3300009553 Ga0105249_11300191 Ga0105249_113001912 98
249 3300009553 Ga0105249_12275866 Ga0105249_122758662 98
250 3300010159 Ga0099796_10074199 Ga0099796_100741991 98
251 3300010375 Ga0105239_11488790 Ga0105239_114887902 98
252 3300010375 Ga0105239_13120003 Ga0105239_131200032 98
253 3300011119 Ga0105246_10068645 Ga0105246_100686453 98
254 3300011119 Ga0105246_10534256 Ga0105246_105342562 98
255 3300011119 Ga0105246_11842778 Ga0105246_118427782 98
256 3300012476 Ga0157344_1007132 Ga0157344_10071322 98
257 3300012481 Ga0157320_1003499 Ga0157320_10034992 98
258 3300012482 Ga0157318_1011096 Ga0157318_10110962 98
259 3300012487 Ga0157321_1007550 Ga0157321_10075502 98
260 3300012488 Ga0157343_1009691 Ga0157343_10096912 98
261 3300012491 Ga0157329_1035464 Ga0157329_10354642 98
262 3300012492 Ga0157335_1005386 Ga0157335_10053862 98
263 3300012505 Ga0157339_1002495 Ga0157339_10024952 98
264 3300012506 Ga0157324_1008976 Ga0157324_10089762 98
265 3300013100 Ga0157373_10159155 Ga0157373_101591552 98
266 3300013102 Ga0157371_10135320 Ga0157371_101353202 98
267 3300013104 Ga0157370_10099706 Ga0157370_100997063 98
268 3300013105 Ga0157369_12600543 Ga0157369_126005432 98
269 3300013296 Ga0157374_10064651 Ga0157374_100646512 98
270 3300013297 Ga0157378_10178196 Ga0157378_101781963 98
271 3300013297 Ga0157378_10488819 Ga0157378_104888191 98
272 3300013297 Ga0157378_11523665 Ga0157378_115236652 98
273 3300013306 Ga0163162_10096906 Ga0163162_100969063 98
274 3300013306 Ga0163162_11245502 Ga0163162_112455022 98
275 3300013307 Ga0157372_10820770 Ga0157372_108207702 98
276 3300013308 Ga0157375_10000044 Ga0157375_1000004410 98
277 3300014326 Ga0157380_10044642 Ga0157380_100446422 98
278 3300014326 Ga0157380_10198141 Ga0157380_101981412 98
279 3300014326 Ga0157380_11334317 Ga0157380_113343172 98
280 3300014745 Ga0157377_10076803 Ga0157377_100768032 98
281 3300014745 Ga0157377_10127396 Ga0157377_101273962 98
282 3300014745 Ga0157377_10711597 Ga0157377_107115972 98
283 3300014969 Ga0157376_11766137 Ga0157376_117661372 98
284 3300017792 Ga0163161_10074649 Ga0163161_100746492 98
285 3300017792 Ga0163161_10801867 Ga0163161_108018672 98
286 3300020069 Ga0197907_10320278 Ga0197907_103202782 98
287 3300020070 Ga0206356_11696130 Ga0206356_116961302 98
288 3300020075 Ga0206349_1872280 Ga0206349_18722802 98
289 3300020077 Ga0206351_10603668 Ga0206351_106036682 98
290 3300020081 Ga0206354_11405769 Ga0206354_114057692 98
291 3300020082 Ga0206353_11280459 Ga0206353_112804593 98
292 3300021358 Ga0213873_10034414 Ga0213873_100344142 98
293 3300021361 Ga0213872_10007568 Ga0213872_100075685 98
294 3300021361 Ga0213872_10374246 Ga0213872_103742462 98
295 3300021388 Ga0213875_10085213 Ga0213875_100852132 98
296 3300021388 Ga0213875_10141540 Ga0213875_101415402 98
297 3300021441 Ga0213871_10072137 Ga0213871_100721372 98
298 3300022467 Ga0224712_10130454 Ga0224712_101304542 98
299 3300025321 Ga0207656_10159519 Ga0207656_101595192 98
300 3300025885 Ga0207653_10035294 Ga0207653_100352942 98
301 3300025893 Ga0207682_10099631 Ga0207682_100996312 98
302 3300025898 Ga0207692_10208637 Ga0207692_102086372 98
303 3300025898 Ga0207692_10486570 Ga0207692_104865701 98
304 3300025898 Ga0207692_10495148 Ga0207692_104951482 98
305 3300025899 Ga0207642_10140512 Ga0207642_101405122 98
306 3300025899 Ga0207642_10775982 Ga0207642_107759821 98
307 3300025900 Ga0207710_10298885 Ga0207710_102988851 98
308 3300025901 Ga0207688_10089634 Ga0207688_100896342 98
309 3300025903 Ga0207680_10363727 Ga0207680_103637272 98
310 3300025904 Ga0207647_10189250 Ga0207647_101892503 98
311 3300025905 Ga0207685_10258203 Ga0207685_102582032 98
312 3300025905 Ga0207685_10311915 Ga0207685_103119152 98
313 3300025906 Ga0207699_10296241 Ga0207699_102962412 98
314 3300025906 Ga0207699_11200852 Ga0207699_112008522 98
315 3300025907 Ga0207645_10029872 Ga0207645_100298722 98
316 3300025907 Ga0207645_10148170 Ga0207645_101481703 98
317 3300025908 Ga0207643_10012368 Ga0207643_100123684 98
318 3300025908 Ga0207643_10181470 Ga0207643_101814703 98
319 3300025909 Ga0207705_10855526 Ga0207705_108555262 98
320 3300025909 Ga0207705_10956206 Ga0207705_109562062 98
321 3300025910 Ga0207684_10032484 Ga0207684_100324843 98
322 3300025910 Ga0207684_10274759 Ga0207684_102747592 98
323 3300025910 Ga0207684_10954132 Ga0207684_109541322 98
324 3300025910 Ga0207684_11739296 Ga0207684_117392961 98
325 3300025911 Ga0207654_10677488 Ga0207654_106774882 98
326 3300025912 Ga0207707_11099979 Ga0207707_110999792 98
327 3300025912 Ga0207707_11262127 Ga0207707_112621272 98
328 3300025913 Ga0207695_11355160 Ga0207695_113551601 98
329 3300025914 Ga0207671_11020117 Ga0207671_110201171 98
330 3300025915 Ga0207693_10062680 Ga0207693_100626802 98
331 3300025915 Ga0207693_10516800 Ga0207693_105168002 98
332 3300025916 Ga0207663_10515818 Ga0207663_105158182 98
333 3300025917 Ga0207660_11189277 Ga0207660_111892772 98
334 3300025918 Ga0207662_10011179 Ga0207662_100111794 98
335 3300025918 Ga0207662_10380031 Ga0207662_103800311 98
336 3300025918 Ga0207662_10683174 Ga0207662_106831742 98
337 3300025919 Ga0207657_10036867 Ga0207657_100368674 98
338 3300025919 Ga0207657_10341548 Ga0207657_103415482 98
339 3300025920 Ga0207649_10546472 Ga0207649_105464722 98
340 3300025920 Ga0207649_10598831 Ga0207649_105988311 98
341 3300025922 Ga0207646_10022911 Ga0207646_100229114 98
342 3300025922 Ga0207646_10039940 Ga0207646_100399402 98
343 3300025922 Ga0207646_10136340 Ga0207646_101363402 98
344 3300025922 Ga0207646_10177937 Ga0207646_101779372 98
345 3300025922 Ga0207646_10297630 Ga0207646_102976303 98
346 3300025922 Ga0207646_11451591 Ga0207646_114515912 98
347 3300025923 Ga0207681_10784289 Ga0207681_107842892 98
348 3300025923 Ga0207681_11552385 Ga0207681_115523851 98
349 3300025926 Ga0207659_10099495 Ga0207659_100994953 98
350 3300025926 Ga0207659_10225682 Ga0207659_102256822 98
351 3300025927 Ga0207687_10638805 Ga0207687_106388052 98
352 3300025929 Ga0207664_10001895 Ga0207664_100018958 98
353 3300025929 Ga0207664_10130655 Ga0207664_101306554 98
354 3300025929 Ga0207664_11537640 Ga0207664_115376401 98
355 3300025932 Ga0207690_10205107 Ga0207690_102051072 98
356 3300025932 Ga0207690_10301812 Ga0207690_103018122 98
357 3300025932 Ga0207690_11044095 Ga0207690_110440951 98
358 3300025933 Ga0207706_10032639 Ga0207706_100326396 98
359 3300025935 Ga0207709_10075384 Ga0207709_100753842 98
360 3300025936 Ga0207670_10239006 Ga0207670_102390062 98
361 3300025936 Ga0207670_10540067 Ga0207670_105400672 98
362 3300025937 Ga0207669_10054530 Ga0207669_100545302 98
363 3300025938 Ga0207704_10100222 Ga0207704_101002223 98
364 3300025938 Ga0207704_11345930 Ga0207704_113459302 98
365 3300025939 Ga0207665_10279602 Ga0207665_102796021 98
366 3300025940 Ga0207691_10258894 Ga0207691_102588942 98
367 3300025941 Ga0207711_10366635 Ga0207711_103666352 98
368 3300025941 Ga0207711_11437841 Ga0207711_114378412 98
369 3300025942 Ga0207689_10017369 Ga0207689_100173695 98
370 3300025942 Ga0207689_10029324 Ga0207689_100293245 98
371 3300025942 Ga0207689_10365124 Ga0207689_103651242 98
372 3300025945 Ga0207679_10700298 Ga0207679_107002982 98
373 3300025945 Ga0207679_11336867 Ga0207679_113368671 98
374 3300025949 Ga0207667_10629307 Ga0207667_106293072 98
375 3300025960 Ga0207651_10947804 Ga0207651_109478042 98
376 3300025972 Ga0207668_10475637 Ga0207668_104756372 98
377 3300025972 Ga0207668_10483634 Ga0207668_104836342 98
378 3300025981 Ga0207640_10991597 Ga0207640_109915972 98
379 3300025986 Ga0207658_10141206 Ga0207658_101412062 98
380 3300025986 Ga0207658_10513212 Ga0207658_105132122 98
381 3300025986 Ga0207658_10657272 Ga0207658_106572722 98
382 3300025986 Ga0207658_11102893 Ga0207658_111028932 98
383 3300026023 Ga0207677_10336713 Ga0207677_103367132 98
384 3300026035 Ga0207703_10665861 Ga0207703_106658612 98
385 3300026035 Ga0207703_11128102 Ga0207703_111281022 98
386 3300026067 Ga0207678_10023885 Ga0207678_100238855 98
387 3300026067 Ga0207678_10113678 Ga0207678_101136783 98
388 3300026075 Ga0207708_10032856 Ga0207708_100328565 98
389 3300026075 Ga0207708_10204788 Ga0207708_102047882 98
390 3300026078 Ga0207702_10084142 Ga0207702_100841424 98
391 3300026078 Ga0207702_10171984 Ga0207702_101719843 98
392 3300026088 Ga0207641_10277686 Ga0207641_102776863 98
393 3300026088 Ga0207641_10681171 Ga0207641_106811711 98
394 3300026089 Ga0207648_10001929 Ga0207648_100019292 98
395 3300026089 Ga0207648_10622104 Ga0207648_106221042 98
396 3300026095 Ga0207676_10018645 Ga0207676_100186454 98
397 3300026095 Ga0207676_10258056 Ga0207676_102580562 98
398 3300026095 Ga0207676_11162440 Ga0207676_111624402 98
399 3300026116 Ga0207674_10045402 Ga0207674_100454022 98
400 3300026116 Ga0207674_10125035 Ga0207674_101250352 98
401 3300026118 Ga0207675_100026059 Ga0207675_1000260593 98
402 3300026118 Ga0207675_100071149 Ga0207675_1000711493 98
403 3300026121 Ga0207683_10022689 Ga0207683_100226895 98
404 3300026121 Ga0207683_10065647 Ga0207683_100656472 98
405 3300026121 Ga0207683_10147535 Ga0207683_101475353 98
406 3300026121 Ga0207683_10972843 Ga0207683_109728432 98
407 3300027907 Ga0207428_10000365 Ga0207428_100003653 98
408 3300027907 Ga0207428_10006355 Ga0207428_1000635512 98
409 3300027907 Ga0207428_10239132 Ga0207428_102391322 98
410 3300027907 Ga0207428_10372554 Ga0207428_103725542 98
411 3300028379 Ga0268266_10965884 Ga0268266_109658842 98
412 3300028379 Ga0268266_11257199 Ga0268266_112571991 98
413 3300028379 Ga0268266_11585754 Ga0268266_115857541 98
414 3300028380 Ga0268265_10022401 Ga0268265_100224015 98
415 3300028380 Ga0268265_10082547 Ga0268265_100825473 98
416 3300028380 Ga0268265_10113603 Ga0268265_101136034 98
417 3300028381 Ga0268264_10205579 Ga0268264_102055793 98
418 3300028381 Ga0268264_11310715 Ga0268264_113107152 98
419 3300028800 Ga0265338_10136743 Ga0265338_101367432 98
420 3300031235 Ga0265330_10009451 Ga0265330_100094515 98
421 3300031235 Ga0265330_10269737 Ga0265330_102697371 98
422 3300031238 Ga0265332_10000044 Ga0265332_1000004450 98
423 3300031239 Ga0265328_10002340 Ga0265328_100023401 98
424 3300031240 Ga0265320_10274588 Ga0265320_102745881 98
425 3300031241 Ga0265325_10152569 Ga0265325_101525692 98
426 3300031241 Ga0265325_10353035 Ga0265325_103530351 98
427 3300031242 Ga0265329_10013927 Ga0265329_100139272 98
428 3300031247 Ga0265340_10087798 Ga0265340_100877982 98
429 3300031249 Ga0265339_10163001 Ga0265339_101630012 98
430 3300031250 Ga0265331_10000076 Ga0265331_10000076115 98
431 3300031251 Ga0265327_10084672 Ga0265327_100846723 98
432 3300031344 Ga0265316_10000006 Ga0265316_10000006131 98
433 3300031344 Ga0265316_10212482 Ga0265316_102124822 98
434 3300031344 Ga0265316_10256745 Ga0265316_102567451 98
435 3300031548 Ga0307408_100474096 Ga0307408_1004740962 98
436 3300031711 Ga0265314_10000056 Ga0265314_1000005679 98
437 3300031711 Ga0265314_10020912 Ga0265314_100209124 98
438 3300031712 Ga0265342_10003118 Ga0265342_100031183 98
439 3300031712 Ga0265342_10014410 Ga0265342_100144106 98
440 3300031712 Ga0265342_10040407 Ga0265342_100404073 98
441 3300031727 Ga0316576_10035276 Ga0316576_100352762 98
442 3300031728 Ga0316578_10849739 Ga0316578_108497391 98
443 3300031731 Ga0307405_12046167 Ga0307405_120461672 98
444 3300031733 Ga0316577_10562014 Ga0316577_105620142 98
445 3300031903 Ga0307407_10146717 Ga0307407_101467172 98
446 3300032002 Ga0307416_103097136 Ga0307416_1030971362 98
447 3300033524 Ga0316592_1149623 Ga0316592_11496231 98
448 3300034816 Ga0373930_0035367 Ga0373930_0035367_227_541 98
449 3300034820 Ga0373959_0062089 Ga0373959_0062089_32_346 98
450 3300035083 Ga0373926_0173394 Ga0373926_0173394_375_671 98
451 3300035085 Ga0373929_0213774 Ga0373929_0213774_223_522 98
452 3300035086 Ga0373934_0438086 Ga0373934_0438086_208_504 98
453 3300035089 Ga0373944_0029762 Ga0373944_0029762_801_1115 98
454 3300035091 Ga0373951_0061629 Ga0373951_0061629_195_509 98
455 3300035111 Ga0373923_0257853 Ga0373923_0257853_196_510 98
456 3300035112 Ga0373932_0065659 Ga0373932_0065659_103_417 98
457 3300035113 Ga0373936_0000641 Ga0373936_0000641_11198_11512 98
458 3300035113 Ga0373936_0072518 Ga0373936_0072518_211_507 98
459 3300035113 Ga0373936_0635535 Ga0373936_0635535_66_380 98
460 3300035114 Ga0373939_0011143 Ga0373939_0011143_128_442 98
461 3300035114 Ga0373939_0336595 Ga0373939_0336595_286_585 98
462 3300035116 Ga0373945_0035869 Ga0373945_0035869_1200_1514 98
463 3300035117 Ga0373953_0007993 Ga0373953_0007993_3235_3549 98
464 3300035118 Ga0373954_0026950 Ga0373954_0026950_1871_2185 98
465 3300035120 Ga0373957_0038512 Ga0373957_0038512_387_701 98
466 3300035120 Ga0373957_0526068 Ga0373957_0526068_55_369 98
467 3300035121 Ga0373960_0040444 Ga0373960_0040444_397_711 98
468 3300035170 Ga0373943_0009965 Ga0373943_0009965_984_1298 98
469 3300035170 Ga0373943_0218876 Ga0373943_0218876_676_972 98
470 3300035171 Ga0373946_0192679 Ga0373946_0192679_648_944 98
471 3300035171 Ga0373946_0341019 Ga0373946_0341019_86_400 98
472 3300035172 Ga0373955_0097009 Ga0373955_0097009_1112_1426 98
473 3300035241 Ga0373961_0055565 Ga0373961_0055565_642_956 98
474 3300035410 Ga0373924_0017999 Ga0373924_0017999_1125_1439 98
475 3300035410 Ga0373924_0496965 Ga0373924_0496965_158_454 98
476 3300035691 Ga0373931_0067194 Ga0373931_0067194_842_1156 98
477 3300035692 Ga0373935_0040709 Ga0373935_0040709_756_1070 98
478 3300035692 Ga0373935_0131306 Ga0373935_0131306_11_307 98
479 3300035692 Ga0373935_0326388 Ga0373935_0326388_601_897 98
480 3300035695 Ga0373927_0021329 Ga0373927_0021329_3847_4143 98
481 3300035695 Ga0373927_0052566 Ga0373927_0052566_129_443 98
482 3300035724 Ga0373933_0009791 Ga0373933_0009791_4424_4738 98
483 3300035724 Ga0373933_0018208 Ga0373933_0018208_285_581 98
484 3300035725 Ga0373947_0005413 Ga0373947_0005413_4464_4778 98
485 3300035725 Ga0373947_0035367 Ga0373947_0035367_804_1100 98
486 3300036401 Ga0373937_0077831 Ga0373937_0077831_1936_2250 98
487 3300036401 Ga0373937_0236233 Ga0373937_0236233_1155_1469 98
488 3300036401 Ga0373937_0260448 Ga0373937_0260448_55_351 98
489 3300036401 Ga0373937_0830029 Ga0373937_0830029_113_427 98
490 3300037068 Ga0373925_0041169 Ga0373925_0041169_1229_1543 98
491 3300037471 Ga0395905_0071815 Ga0395905_0071815_2428_2724 98
492 3300037471 Ga0395905_0135282 Ga0395905_0135282_1401_1697 98
493 3300037853 Ga0436364_0656649 Ga0436364_0656649_326_679 98
494 3300037853 Ga0436364_0773908 Ga0436364_0773908_670_966 98
495 3300037853 Ga0436364_0939520 Ga0436364_0939520_40_336 98
496 3300037853 Ga0436364_1429122 Ga0436364_1429122_473_769 98
497 3300039437 Ga0436365_0824878 Ga0436365_0824878_902_1198 98
498 3300039438 Ga0436360_0072264 Ga0436360_0072264_198_494 98
499 3300039438 Ga0436360_0083095 Ga0436360_0083095_66_362 98
500 3300039438 Ga0436360_0172421 Ga0436360_0172421_1965_2261 98
501 3300039438 Ga0436360_0497875 Ga0436360_0497875_650_946 98
502 3300039438 Ga0436360_0720818 Ga0436360_0720818_93_389 98
503 3300039438 Ga0436360_0869944 Ga0436360_0869944_155_457 98
504 3300039447 Ga0436361_0554849 Ga0436361_0554849_25233_25529 98
505 3300039447 Ga0436361_0805706 Ga0436361_0805706_2475_2771 98
506 3300039447 Ga0436361_0891320 Ga0436361_0891320_173_469 98
507 3300039447 Ga0436361_0945716 Ga0436361_0945716_174_470 98
508 3300039450 Ga0436363_0255660 Ga0436363_0255660_804_1100 98
509 3300039453 Ga0436362_0104738 Ga0436362_0104738_459_755 98
510 3300039453 Ga0436362_0621761 Ga0436362_0621761_151_447 98
511 3300039453 Ga0436362_0735501 Ga0436362_0735501_865_1167 98
512 3300041486 Ga0451807_2499475 Ga0451807_2499475_203_517 98
513 3300041505 Ga0451849_1286789 Ga0451849_1286789_226_540 98
514 3300042001 Ga0439441_022517 Ga0439441_022517_754_1050 98
515 3300042123 Ga0450921_010801 Ga0450921_010801_110_406 98
516 3300042125 Ga0450923_060066 Ga0450923_060066_159_455 98
517 3300042131 Ga0450894_005576 Ga0450894_005576_987_1283 98
518 3300042133 Ga0450896_006073 Ga0450896_006073_945_1241 98
519 3300042135 Ga0450899_010744 Ga0450899_010744_337_633 98
520 3300042435 Ga0439434_0245645 Ga0439434_0245645_201_497 98
521 3300042531 Ga0450918_002582 Ga0450918_002582_2823_3119 98
522 3300042876 Ga0451577_0014229 Ga0451577_0014229_1741_2037 98
523 3300042876 Ga0451577_0109967 Ga0451577_0109967_744_1043 98
524 3300042876 Ga0451577_0456119 Ga0451577_0456119_644_940 98
525 3300042876 Ga0451577_0856898 Ga0451577_0856898_429_725 98
526 3300042993 Ga0439440_0176197 Ga0439440_0176197_121_417 98
527 3300044673 Ga0453683_0394365 Ga0453683_0394365_393_689 98
528 3300044694 Ga0466963_0963742 Ga0466963_0963742_76_375 98
529 3300044706 Ga0466964_0452890 Ga0466964_0452890_280_594 98
530 3300044712 Ga0453684_0007847 Ga0453684_0007847_8952_9248 98
531 3300044735 Ga0466968_0104654 Ga0466968_0104654_517_813 98
532 3300045051 Ga0451576_0010179 Ga0451576_0010179_7837_8133 98
533 3300045051 Ga0451576_2369635 Ga0451576_2369635_207_503 98
534 3300045051 Ga0451576_2608165 Ga0451576_2608165_79_375 98
535 3300045976 Ga0466967_0525786 Ga0466967_0525786_250_564 98
536 3300046454 Ga0495592_0030815 Ga0495592_0030815_1090_1404 98
537 3300046454 Ga0495592_0282763 Ga0495592_0282763_578_892 98
538 3300046455 Ga0495603_0025782 Ga0495603_0025782_30_344 98
539 3300046461 Ga0495641_0022240 Ga0495641_0022240_80_394 98
540 3300046462 Ga0495651_0072227 Ga0495651_0072227_1824_2138 98
541 3300046462 Ga0495651_0686263 Ga0495651_0686263_168_464 98
542 3300046462 Ga0495651_1003004 Ga0495651_1003004_19_333 98
543 3300046463 Ga0495653_0457652 Ga0495653_0457652_95_409 98
544 3300046472 Ga0495580_0173771 Ga0495580_0173771_1096_1410 98
545 3300046472 Ga0495580_0482001 Ga0495580_0482001_484_798 98
546 3300046473 Ga0495582_0005954 Ga0495582_0005954_27_341 98
547 3300046475 Ga0495639_0003444 Ga0495639_0003444_4709_5023 98
548 3300046475 Ga0495639_0369476 Ga0495639_0369476_265_564 98
549 3300046476 Ga0495662_0196737 Ga0495662_0196737_56_370 98
550 3300046477 Ga0495664_0015894 Ga0495664_0015894_1638_1952 98
551 3300046477 Ga0495664_0500602 Ga0495664_0500602_117_431 98
552 3300046499 Ga0495594_0170797 Ga0495594_0170797_732_1046 98
553 3300046511 Ga0495608_0020357 Ga0495608_0020357_1011_1325 98
554 3300046511 Ga0495608_0101336 Ga0495608_0101336_1463_1777 98
555 3300046514 Ga0495618_0014606 Ga0495618_0014606_3312_3626 98
556 3300046516 Ga0495628_0168857 Ga0495628_0168857_1154_1468 98
557 3300046516 Ga0495628_0192257 Ga0495628_0192257_963_1277 98
558 3300046517 Ga0495630_0083288 Ga0495630_0083288_1090_1404 98
559 3300046526 Ga0495666_0004676 Ga0495666_0004676_6596_6910 98
560 3300046529 Ga0495652_0044698 Ga0495652_0044698_1822_2136 98
561 3300046529 Ga0495652_0478035 Ga0495652_0478035_190_486 98
562 3300046529 Ga0495652_0685820 Ga0495652_0685820_284_598 98
563 3300046529 Ga0495652_0839711 Ga0495652_0839711_203_517 98
564 3300046531 Ga0495665_0007757 Ga0495665_0007757_4212_4526 98
565 3300046533 Ga0495640_0230638 Ga0495640_0230638_756_1070 98
566 3300046535 Ga0495586_0073868 Ga0495586_0073868_796_1110 98
567 3300046536 Ga0495587_0023688 Ga0495587_0023688_248_562 98
568 3300046538 Ga0495609_0152922 Ga0495609_0152922_110_409 98
569 3300046543 Ga0495645_0020867 Ga0495645_0020867_1766_2080 98
570 3300046543 Ga0495645_0093098 Ga0495645_0093098_1439_1753 98
571 3300046543 Ga0495645_0366851 Ga0495645_0366851_146_460 98
572 3300046559 Ga0495667_0014969 Ga0495667_0014969_4171_4485 98
573 3300046559 Ga0495667_0894605 Ga0495667_0894605_37_351 98
574 3300046615 Ga0495656_0087739 Ga0495656_0087739_573_872 98
575 3300046642 Ga0495634_0072746 Ga0495634_0072746_1139_1453 98
576 3300046663 Ga0495635_0007103 Ga0495635_0007103_669_983 98
577 3300046663 Ga0495635_0397659 Ga0495635_0397659_67_381 98
578 3300046663 Ga0495635_0853845 Ga0495635_0853845_250_555 98
579 3300046675 Ga0495657_0026472 Ga0495657_0026472_1011_1325 98
580 3300046675 Ga0495657_0067938 Ga0495657_0067938_1832_2146 98
581 3300046678 Ga0495599_0022147 Ga0495599_0022147_193_507 98
582 3300046678 Ga0495599_0423780 Ga0495599_0423780_364_660 98
583 3300046678 Ga0495599_0822723 Ga0495599_0822723_163_477 98
584 3300046679 Ga0495623_0140733 Ga0495623_0140733_1090_1404 98
585 3300046680 Ga0495646_0022907 Ga0495646_0022907_1936_2250 98
586 3300046680 Ga0495646_0134533 Ga0495646_0134533_256_570 98
587 3300046681 Ga0495647_0016034 Ga0495647_0016034_118_432 98
588 3300046683 Ga0495658_0004533 Ga0495658_0004533_3367_3681 98
589 3300046684 Ga0495669_0008295 Ga0495669_0008295_2845_3141 98
590 3300046684 Ga0495669_0130111 Ga0495669_0130111_252_551 98
591 3300046690 Ga0495624_0009644 Ga0495624_0009644_3408_3722 98
592 3300046794 Ga0495589_0205411 Ga0495589_0205411_30_329 98
593 3300046809 Ga0495600_0080838 Ga0495600_0080838_797_1111 98
594 3300046809 Ga0495600_0423012 Ga0495600_0423012_320_634 98
595 3300047315 Ga0495581_0006948 Ga0495581_0006948_6219_6533 98
596 3300047315 Ga0495581_0151436 Ga0495581_0151436_30_344 98
597 3300047317 Ga0495604_0031488 Ga0495604_0031488_1592_1906 98
598 3300047319 Ga0495674_0068827 Ga0495674_0068827_95_409 98
599 3300047319 Ga0495674_0358515 Ga0495674_0358515_324_638 98
600 3300047321 Ga0495676_0069839 Ga0495676_0069839_38_352 98
601 3300047322 Ga0495680_0010283 Ga0495680_0010283_6894_7208 98
602 3300047322 Ga0495680_0730761 Ga0495680_0730761_193_507 98
603 3300047444 Ga0495675_0023875 Ga0495675_0023875_255_569 98
604 3300047471 Ga0495684_0018890 Ga0495684_0018890_3356_3670 98
605 3300047673 Ga0495593_0015149 Ga0495593_0015149_2782_3096 98
606 3300048088 Ga0495602_0164195 Ga0495602_0164195_262_576 98
607 3300048088 Ga0495602_0247129 Ga0495602_0247129_262_576 98
608 3300048089 Ga0495614_0032217 Ga0495614_0032217_1253_1567 98
609 3300048903 Ga0496100_0265894 Ga0496100_0265894_714_1028 98
610 3300048903 Ga0496100_0890682 Ga0496100_0890682_303_599 98
611 3300048903 Ga0496100_1014808 Ga0496100_1014808_66_365 98
612 3300048904 Ga0496101_0044842 Ga0496101_0044842_137_451 98
613 3300048904 Ga0496101_0262555 Ga0496101_0262555_677_973 98
614 3300048905 Ga0496102_1165143 Ga0496102_1165143_218_514 98
615 3300048906 Ga0496103_0099101 Ga0496103_0099101_523_837 98
616 3300048906 Ga0496103_1051753 Ga0496103_1051753_48_344 98
617 3300048907 Ga0496104_0347717 Ga0496104_0347717_132_446 98
618 3300048907 Ga0496104_0686244 Ga0496104_0686244_613_909 98
619 3300048908 Ga0496105_0874230 Ga0496105_0874230_304_600 98
620 3300048909 Ga0496106_0367548 Ga0496106_0367548_336_632 98
621 3300048909 Ga0496106_1198555 Ga0496106_1198555_29_325 98
622 3300048910 Ga0496107_0537707 Ga0496107_0537707_100_396 98
623 3300048910 Ga0496107_0620213 Ga0496107_0620213_136_450 98
624 3300048911 Ga0496108_0165900 Ga0496108_0165900_509_823 98
625 3300048911 Ga0496108_0272670 Ga0496108_0272670_1066_1362 98
626 3300048911 Ga0496108_0648841 Ga0496108_0648841_276_590 98
627 3300048912 Ga0496109_0614317 Ga0496109_0614317_109_423 98
628 3300048913 Ga0496110_0346338 Ga0496110_0346338_234_548 98
629 3300048913 Ga0496110_0748035 Ga0496110_0748035_364_660 98
630 3300048914 Ga0496111_0505231 Ga0496111_0505231_549_863 98
631 3300048915 Ga0496112_0034784 Ga0496112_0034784_4143_4439 98
632 3300048915 Ga0496112_0195410 Ga0496112_0195410_56_352 98
633 3300048917 Ga0496114_0541721 Ga0496114_0541721_238_537 98
634 3300048918 Ga0496115_0080503 Ga0496115_0080503_608_904 98
635 3300048918 Ga0496115_0512695 Ga0496115_0512695_375_689 98
636 3300049568 Ga0501031_0203034 Ga0501031_0203034_349_645 98
637 3300049568 Ga0501031_0336846 Ga0501031_0336846_559_855 98
638 3300049568 Ga0501031_0912585 Ga0501031_0912585_231_536 98
639 3300049570 Ga0501033_0987069 Ga0501033_0987069_90_392 98
640 3300049572 Ga0501036_0543986 Ga0501036_0543986_282_581 98
641 3300049573 Ga0501037_0746570 Ga0501037_0746570_244_543 98
642 3300049574 Ga0501038_0379574 Ga0501038_0379574_321_617 98
643 3300049575 Ga0501039_0402963 Ga0501039_0402963_529_828 98
644 3300049576 Ga0501040_0203845 Ga0501040_0203845_1068_1364 98
645 3300049576 Ga0501040_0322749 Ga0501040_0322749_286_585 98
646 3300049577 Ga0501041_0269418 Ga0501041_0269418_116_415 98
647 3300049580 Ga0501046_0051976 Ga0501046_0051976_2859_3158 98
648 3300049580 Ga0501046_0501839 Ga0501046_0501839_454_750 98
649 3300049580 Ga0501046_0619116 Ga0501046_0619116_211_507 98
650 3300049582 Ga0501048_0827439 Ga0501048_0827439_241_540 98
651 3300049584 Ga0501068_0782388 Ga0501068_0782388_143_442 98
652 3300049586 Ga0501070_1477082 Ga0501070_1477082_38_352 98
653 3300049587 Ga0501071_0625311 Ga0501071_0625311_349_654 98
654 3300049587 Ga0501071_1187832 Ga0501071_1187832_89_388 98
655 3300049588 Ga0501072_0003022 Ga0501072_0003022_4695_4994 98
656 3300049588 Ga0501072_0176020 Ga0501072_0176020_1077_1382 98
657 3300049589 Ga0501073_0428038 Ga0501073_0428038_131_427 98
658 3300049589 Ga0501073_0589459 Ga0501073_0589459_271_567 98
659 3300049590 Ga0501074_0040599 Ga0501074_0040599_2561_2860 98
660 3300049590 Ga0501074_0116369 Ga0501074_0116369_233_529 98
661 3300049590 Ga0501074_0640465 Ga0501074_0640465_280_585 98
662 3300049591 Ga0501075_0016028 Ga0501075_0016028_4414_4713 98
663 3300049591 Ga0501075_0344685 Ga0501075_0344685_767_1063 98
664 3300049592 Ga0501076_0015432 Ga0501076_0015432_5366_5665 98
665 3300049592 Ga0501076_1064558 Ga0501076_1064558_58_354 98
666 3300049593 Ga0501077_0432384 Ga0501077_0432384_333_632 98
667 3300049741 Ga0501079_0004245 Ga0501079_0004245_266_565 98
668 3300049743 Ga0501081_0019917 Ga0501081_0019917_3558_3857 98
669 3300049743 Ga0501081_0739137 Ga0501081_0739137_59_355 98
670 3300049744 Ga0501083_0712409 Ga0501083_0712409_149_445 98
671 3300049822 Ga0501035_0253175 Ga0501035_0253175_517_813 98
672 3300049824 Ga0501045_0100239 Ga0501045_0100239_129_428 98
673 3300050489 nmdc:mga03683_254731_c1 nmdc:mga03683_254731_c1_496_795 98
674 3300050490 nmdc:mga03n38_14316_c1 nmdc:mga03n38_14316_c1_1819_2118 98
675 3300050491 nmdc:mga00v17_408162_c1 nmdc:mga00v17_408162_c1_240_539 98
676 3300050491 nmdc:mga00v17_52966_c1 nmdc:mga00v17_52966_c1_118_417 98
677 3300050492 nmdc:mga0yw44_10402_c1 nmdc:mga0yw44_10402_c1_4221_4520 98
678 3300050493 nmdc:mga0k408_3942_c1 nmdc:mga0k408_3942_c1_944_1243 98
679 3300050494 nmdc:mga06z11_9299_c1 nmdc:mga06z11_9299_c1_2894_3193 98
680 3300050496 nmdc:mga07m45_57780_c2 nmdc:mga07m45_57780_c2_40_339 98
681 3300050507 nmdc:mga05p37_105024_c1 nmdc:mga05p37_105024_c1_598_894 98
682 3300050507 nmdc:mga05p37_1087913_c1 nmdc:mga05p37_1087913_c1_389_688 98
683 3300050507 nmdc:mga05p37_1110428_c1 nmdc:mga05p37_1110428_c1_206_502 98
684 3300050507 nmdc:mga05p37_1278851_c1 nmdc:mga05p37_1278851_c1_122_418 98
685 3300050507 nmdc:mga05p37_2092021_c1 nmdc:mga05p37_2092021_c1_77_376 98
686 3300050507 nmdc:mga05p37_38560_c1 nmdc:mga05p37_38560_c1_4273_4569 98
687 3300050507 nmdc:mga05p37_726382_c1 nmdc:mga05p37_726382_c1_117_413 98
688 3300050507 nmdc:mga05p37_8774_c1 nmdc:mga05p37_8774_c1_10017_10313 98
689 3300050508 nmdc:mga09592_239313_c1 nmdc:mga09592_239313_c1_542_841 98
690 3300050508 nmdc:mga09592_577724_c1 nmdc:mga09592_577724_c1_350_649 98
691 3300050509 nmdc:mga0qj67_394374_c1 nmdc:mga0qj67_394374_c1_594_893 98
692 3300050510 nmdc:mga06r32_15456_c1 nmdc:mga06r32_15456_c1_6256_6552 98
693 3300050510 nmdc:mga06r32_542477_c1 nmdc:mga06r32_542477_c1_417_713 98
694 3300050510 nmdc:mga06r32_8449_c1 nmdc:mga06r32_8449_c1_359_655 98
695 3300050511 nmdc:mga08y16_1299_c1 nmdc:mga08y16_1299_c1_2168_2467 98
696 3300050511 nmdc:mga08y16_47842_c1 nmdc:mga08y16_47842_c1_3315_3614 98
697 3300050511 nmdc:mga08y16_63226_c1 nmdc:mga08y16_63226_c1_1765_2061 98
698 3300050511 nmdc:mga08y16_763654_c1 nmdc:mga08y16_763654_c1_492_788 98
699 3300050511 nmdc:mga08y16_96614_c1 nmdc:mga08y16_96614_c1_2339_2635 98
700 3300050512 nmdc:mga0n895_139937_c1 nmdc:mga0n895_139937_c1_774_1073 98
701 3300050512 nmdc:mga0n895_141171_c1 nmdc:mga0n895_141171_c1_653_952 98
702 3300050512 nmdc:mga0n895_1549890_c1 nmdc:mga0n895_1549890_c1_53_349 98
703 3300050512 nmdc:mga0n895_160226_c1 nmdc:mga0n895_160226_c1_1184_1480 98
704 3300050512 nmdc:mga0n895_283321_c1 nmdc:mga0n895_283321_c1_786_1085 98
705 3300050512 nmdc:mga0n895_3543_c1 nmdc:mga0n895_3543_c1_1758_2054 98
706 3300050512 nmdc:mga0n895_91689_c1 nmdc:mga0n895_91689_c1_1817_2131 98
707 3300050513 nmdc:mga0rr50_155431_c1 nmdc:mga0rr50_155431_c1_556_855 98
708 3300050513 nmdc:mga0rr50_15951_c1 nmdc:mga0rr50_15951_c1_2985_3284 98
709 3300050513 nmdc:mga0rr50_32554_c1 nmdc:mga0rr50_32554_c1_934_1230 98
710 3300050513 nmdc:mga0rr50_476643_c1 nmdc:mga0rr50_476643_c1_714_1010 98
711 3300050513 nmdc:mga0rr50_857397_c1 nmdc:mga0rr50_857397_c1_215_529 98
712 3300050513 nmdc:mga0rr50_90925_c1 nmdc:mga0rr50_90925_c1_442_738 98
713 3300050514 nmdc:mga08x19_444253_c1 nmdc:mga08x19_444253_c1_204_500 98
714 3300050514 nmdc:mga08x19_67079_c1 nmdc:mga08x19_67079_c1_1213_1527 98
715 3300050514 nmdc:mga08x19_80877_c1 nmdc:mga08x19_80877_c1_314_610 98
716 3300050514 nmdc:mga08x19_816822_c1 nmdc:mga08x19_816822_c1_201_500 98
717 3300050515 nmdc:mga0a205_11026_c1 nmdc:mga0a205_11026_c1_5903_6199 98
718 3300050515 nmdc:mga0a205_270453_c2 nmdc:mga0a205_270453_c2_351_650 98
719 3300050515 nmdc:mga0a205_35606_c2 nmdc:mga0a205_35606_c2_2705_3004 98
720 3300050515 nmdc:mga0a205_632037_c1 nmdc:mga0a205_632037_c1_38_337 98
721 3300050515 nmdc:mga0a205_6938_c1 nmdc:mga0a205_6938_c1_3734_4030 98
722 3300050515 nmdc:mga0a205_694_c1 nmdc:mga0a205_694_c1_10822_11118 98
723 3300050515 nmdc:mga0a205_94824_c1 nmdc:mga0a205_94824_c1_1000_1296 98
724 3300053077 Ga0495601_0000713 Ga0495601_0000713_937_1233 98
725 3300053077 Ga0495601_0032225 Ga0495601_0032225_95_409 98
726 3300053077 Ga0495601_0184262 Ga0495601_0184262_40_354 98
727 3300053078 Ga0495612_0017245 Ga0495612_0017245_1163_1477 98
728 3300053078 Ga0495612_0071902 Ga0495612_0071902_1063_1377 98
729 3300053084 Ga0495595_0067770 Ga0495595_0067770_1336_1650 98
730 3300053084 Ga0495595_0187165 Ga0495595_0187165_10_306 98
731 3300053084 Ga0495595_0681918 Ga0495595_0681918_63_377 98
732 3300053085 Ga0495619_0029947 Ga0495619_0029947_2564_2878 98
733 3300053085 Ga0495619_0643511 Ga0495619_0643511_94_408 98
734 3300054114 Ga0501084_0018114 Ga0501084_0018114_2933_3232 98
735 3300054114 Ga0501084_0261346 Ga0501084_0261346_259_555 98
736 3300054114 Ga0501084_1730254 Ga0501084_1730254_159_455 98
737 3300059421 Ga0590071_028216 Ga0590071_028216_368_664 98
738 3300059421 Ga0590071_119618 Ga0590071_119618_160_456 98
739 3300059423 Ga0590074_043974 Ga0590074_043974_497_793 98
740 3300060353 Ga0501082_0195728 Ga0501082_0195728_165_464 98
741 3300060353 Ga0501082_0434965 Ga0501082_0434965_456_752 98
742 3300061734 Ga0530510_1474843 Ga0530510_1474843_18_317 98
743 3300003203 JGI25406J46586_10075979 JGI25406J46586_100759792 102
744 3300005456 Ga0070678_100930560 Ga0070678_1009305602 102
745 3300005985 Ga0081539_10071881 Ga0081539_100718812 102
746 3300025937 Ga0207669_10139490 Ga0207669_101394902 102
747 3300026121 Ga0207683_10919424 Ga0207683_109194241 102

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8565 3 99
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8442 3 102
1v8c-assembly3.cif.gz_B crystal structure of moad related protein from thermus thermophilus hb8 0.8153 3 97
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8128 3 99
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8109 3 102
ID Description Score Start End Superfamily
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8564 3 99 3.10.20.30
1v8cB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8162 3 98 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8126 3 99 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8095 1 102 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8062 1 102 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9699 1 98
AF-A0A1G0SXB6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9673 1 89
AF-A0A7V9SE48-F1-model_v4 MoaD/ThiS family protein 0.9631 2 102
AF-A0A534ZY62-F1-model_v4 MoaD/ThiS family protein 0.9617 1 88
AF-A0A3N5LTQ9-F1-model_v4 MoaD/ThiS family protein 0.9567 19 102

Feature Viewer

pLDDT pTM Quality
93.5 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map