F478881

General Info

Members Datasets Scaffolds Average Seq Length
746 227 1492 190

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0035922|Ga0451577_0035922_3764_4429
Length 221
Sequence LYCSSFLENNVFVRKPFLSDKYPPRTKESDMEISRRDFLRVSVAAGTGTALSGLVGSGVNLAPTVARAQELRIKGAKTTPSICPYCSVGCGTLINTVDGKIVNIEGDPRSPHNEGTLCPKGAAIFQLHVNPNRPTQVLHRAAGAADWEVWDLERAMNRIAELVKKTRDETFIERLPSGKLVNVTPAVFALGGATLEIEFNHLCQKLMRGLGIVAIENQARI

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
150 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
169 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
170 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
199 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
200 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
201 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
202 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
208 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.54
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.54
Rhizosphere 99.46
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0035922 3300042876 Bacteria 4463
2 JGI25406J46586_10017024 3300003203 Bacteria 3013
3 JGI25405J52794_10003729 3300003911 Bacteria 2689
4 Ga0058863_10074702 3300004799 Bacteria 6048
5 Ga0058862_12788718 3300004803 Bacteria 4545
6 Ga0065714_10172870 3300005288 Bacteria 996
7 Ga0065704_10008523 3300005289 Bacteria 2944
8 Ga0065704_10310276 3300005289 Bacteria 870
9 Ga0065712_10005267 3300005290 Bacteria 5510
10 Ga0065712_10008498 3300005290 Bacteria 2427
11 Ga0065712_10135171 3300005290 Bacteria 1505
12 Ga0065715_10032310 3300005293 Bacteria 1805
13 Ga0065707_10096162 3300005295 Bacteria 3297
14 Ga0065707_10203551 3300005295 Bacteria 1299
15 Ga0070690_100212591 3300005330 Unclassified 1351
16 Ga0070670_100006659 3300005331 Bacteria 9791
17 Ga0070670_100686376 3300005331 Bacteria 920
18 Ga0070666_10195935 3300005335 Bacteria 1421
19 Ga0068868_100102989 3300005338 Bacteria 2312
20 Ga0070661_100239501 3300005344 Bacteria 1397
21 Ga0070692_10051522 3300005345 Bacteria 2141
22 Ga0070668_100073317 3300005347 Bacteria 2669
23 Ga0070668_101301050 3300005347 Bacteria 661
24 Ga0070669_100017426 3300005353 Bacteria 5124
25 Ga0070675_100027270 3300005354 Bacteria 4588
26 Ga0070671_100108494 3300005355 Bacteria 2331
27 Ga0070671_100202685 3300005355 Bacteria 1683
28 Ga0070671_100274781 3300005355 Bacteria 1432
29 Ga0070674_100323784 3300005356 Bacteria 1237
30 Ga0070673_100038626 3300005364 Bacteria 3647
31 Ga0070673_100233653 3300005364 Bacteria 1596
32 Ga0070688_100388979 3300005365 Bacteria 1030
33 Ga0070667_100035908 3300005367 Bacteria 4154
34 Ga0070709_10126773 3300005434 Bacteria 1737
35 Ga0070711_100000126 3300005439 Bacteria 40475
36 Ga0070705_100049272 3300005440 Bacteria 2445
37 Ga0070705_100313828 3300005440 Bacteria 1129
38 Ga0070694_100000850 3300005444 Bacteria 17185
39 Ga0070694_100088384 3300005444 Bacteria 2169
40 Ga0070694_100113522 3300005444 Bacteria 1933
41 Ga0070694_100155646 3300005444 Bacteria 1673
42 Ga0070694_100249307 3300005444 Bacteria 1342
43 Ga0070694_100383353 3300005444 Bacteria 1097
44 Ga0070708_100006984 3300005445 Bacteria 9009
45 Ga0070708_100016385 3300005445 Bacteria 6148
46 Ga0070708_100017658 3300005445 Bacteria 5956
47 Ga0070708_100021441 3300005445 Bacteria 5463
48 Ga0070708_100030386 3300005445 Bacteria 4669
49 Ga0070708_100093131 3300005445 Bacteria 2746
50 Ga0070708_100121209 3300005445 Bacteria 2413
51 Ga0070708_100175030 3300005445 Bacteria 2005
52 Ga0070708_100218143 3300005445 Bacteria 1788
53 Ga0070708_100296176 3300005445 Bacteria 1523
54 Ga0070708_100299571 3300005445 Bacteria 1514
55 Ga0070708_100384536 3300005445 Bacteria 1323
56 Ga0070708_100492208 3300005445 Bacteria 1157
57 Ga0070708_100740309 3300005445 Bacteria 925
58 Ga0070708_100746477 3300005445 Bacteria 920
59 Ga0070662_100404223 3300005457 Bacteria 1127
60 Ga0070681_10082037 3300005458 Bacteria 3180
61 Ga0070681_10135655 3300005458 Bacteria 2392
62 Ga0068867_100913236 3300005459 Bacteria 791
63 Ga0070706_100009936 3300005467 Bacteria 8836
64 Ga0070706_100041240 3300005467 Bacteria 4262
65 Ga0070706_100042901 3300005467 Bacteria 4179
66 Ga0070706_100083215 3300005467 Bacteria 2964
67 Ga0070706_100295937 3300005467 Bacteria 1510
68 Ga0070706_100426995 3300005467 Bacteria 1233
69 Ga0070706_100656324 3300005467 Bacteria 974
70 Ga0070706_100716704 3300005467 Bacteria 927
71 Ga0070707_100000923 3300005468 Bacteria 29141
72 Ga0070707_100004517 3300005468 Bacteria 13028
73 Ga0070707_100019403 3300005468 Bacteria 6405
74 Ga0070707_100051109 3300005468 Bacteria 3962
75 Ga0070707_100060286 3300005468 Bacteria 3639
76 Ga0070707_100085042 3300005468 Bacteria 3057
77 Ga0070707_100085253 3300005468 Bacteria 3053
78 Ga0070707_100304443 3300005468 Bacteria 1549
79 Ga0070707_100307128 3300005468 Bacteria 1542
80 Ga0070707_100314697 3300005468 Bacteria 1521
81 Ga0070698_100002338 3300005471 Bacteria 20951
82 Ga0070698_100012434 3300005471 Bacteria 9009
83 Ga0070698_100012746 3300005471 Bacteria 8904
84 Ga0070698_100012967 3300005471 Bacteria 8824
85 Ga0070698_100212762 3300005471 Bacteria 1867
86 Ga0070699_100007298 3300005518 Bacteria 9620
87 Ga0070699_100009226 3300005518 Bacteria 8552
88 Ga0070699_100013779 3300005518 Bacteria 6954
89 Ga0070699_100023501 3300005518 Bacteria 5310
90 Ga0070699_100032372 3300005518 Bacteria 4514
91 Ga0070699_100038516 3300005518 Bacteria 4139
92 Ga0070699_100039795 3300005518 Bacteria 4070
93 Ga0070699_100090889 3300005518 Bacteria 2669
94 Ga0070699_100097691 3300005518 Bacteria 2573
95 Ga0070699_100158251 3300005518 Bacteria 2004
96 Ga0070699_100210518 3300005518 Bacteria 1730
97 Ga0070699_100221143 3300005518 Bacteria 1687
98 Ga0070699_100311348 3300005518 Bacteria 1414
99 Ga0070699_100412170 3300005518 Bacteria 1222
100 Ga0070679_100072288 3300005530 Bacteria 3441
101 Ga0070697_100005642 3300005536 Bacteria 9643
102 Ga0070697_100008448 3300005536 Bacteria 8035
103 Ga0070697_100014761 3300005536 Bacteria 6131
104 Ga0070697_100016360 3300005536 Bacteria 5832
105 Ga0070697_100021802 3300005536 Bacteria 5078
106 Ga0070697_100026474 3300005536 Bacteria 4634
107 Ga0070697_100048853 3300005536 Bacteria 3432
108 Ga0070697_100072844 3300005536 Bacteria 2819
109 Ga0070697_100075443 3300005536 Bacteria 2772
110 Ga0070697_100120591 3300005536 Bacteria 2193
111 Ga0070697_100161479 3300005536 Bacteria 1893
112 Ga0070697_100703844 3300005536 Bacteria 891
113 Ga0070672_100003411 3300005543 Bacteria 10309
114 Ga0070672_100161232 3300005543 Bacteria 1861
115 Ga0070695_100039649 3300005545 Bacteria 2978
116 Ga0070695_100068179 3300005545 Bacteria 2322
117 Ga0070695_100905801 3300005545 Bacteria 712
118 Ga0070696_100009721 3300005546 Bacteria 6433
119 Ga0070696_100022337 3300005546 Bacteria 4297
120 Ga0070696_100086168 3300005546 Bacteria 2230
121 Ga0070665_100544196 3300005548 Bacteria 1173
122 Ga0070704_100003789 3300005549 Bacteria 8704
123 Ga0070704_100050156 3300005549 Bacteria 2932
124 Ga0070704_100279008 3300005549 Bacteria 1383
125 Ga0070664_100052303 3300005564 Unclassified 3459
126 Ga0070664_100077681 3300005564 Bacteria 2855
127 Ga0068857_100155674 3300005577 Bacteria 2072
128 Ga0068859_100442522 3300005617 Bacteria 1396
129 Ga0068859_101339151 3300005617 Unclassified 789
130 Ga0068864_100305443 3300005618 Bacteria 1490
131 Ga0068863_100537689 3300005841 Bacteria 1153
132 Ga0068863_100566782 3300005841 Bacteria 1122
133 Ga0068860_100452675 3300005843 Bacteria 1276
134 Ga0068862_100335229 3300005844 Bacteria 1400
135 Ga0081455_10003567 3300005937 Bacteria 17856
136 Ga0081455_10125537 3300005937 Bacteria 2015
137 Ga0081455_10132240 3300005937 Bacteria 1949
138 Ga0081538_10002027 3300005981 Bacteria 20254
139 Ga0081538_10005780 3300005981 Bacteria 11037
140 Ga0081538_10013677 3300005981 Bacteria 6413
141 Ga0081538_10031492 3300005981 Bacteria 3575
142 Ga0081539_10002099 3300005985 Bacteria 29693
143 Ga0081539_10239824 3300005985 Bacteria 812
144 Ga0075432_10150875 3300006058 Bacteria 893
145 Ga0070716_100015646 3300006173 Bacteria 3902
146 Ga0070716_100254834 3300006173 Bacteria 1197
147 Ga0075427_10000492 3300006194 Bacteria 4530
148 Ga0075428_100009753 3300006844 Bacteria 10671
149 Ga0075428_100010028 3300006844 Bacteria 10523
150 Ga0075428_100026946 3300006844 Bacteria 6366
151 Ga0075428_100414311 3300006844 Bacteria 1444
152 Ga0075428_100611719 3300006844 Bacteria 1163
153 Ga0075428_101509383 3300006844 Bacteria 704
154 Ga0075430_100000040 3300006846 Bacteria 68222
155 Ga0075430_100007555 3300006846 Bacteria 9178
156 Ga0075430_100045106 3300006846 Bacteria 3725
157 Ga0075430_100071336 3300006846 Bacteria 2914
158 Ga0075430_100129588 3300006846 Bacteria 2102
159 Ga0075430_100193356 3300006846 Bacteria 1691
160 Ga0075431_100000192 3300006847 Bacteria 44545
161 Ga0075431_100009690 3300006847 Bacteria 9674
162 Ga0075431_100024052 3300006847 Bacteria 6238
163 Ga0075431_100027056 3300006847 Bacteria 5883
164 Ga0075431_100031048 3300006847 Bacteria 5503
165 Ga0075431_100042671 3300006847 Bacteria 4679
166 Ga0075431_100125721 3300006847 Bacteria 2646
167 Ga0075431_100168942 3300006847 Bacteria 2248
168 Ga0075431_100228896 3300006847 Bacteria 1894
169 Ga0075431_100242589 3300006847 Bacteria 1833
170 Ga0075431_100272089 3300006847 Bacteria 1716
171 Ga0075431_100363985 3300006847 Bacteria 1452
172 Ga0075431_100402977 3300006847 Bacteria 1369
173 Ga0075431_100842125 3300006847 Bacteria 889
174 Ga0075433_10001101 3300006852 Bacteria 19508
175 Ga0075433_10016123 3300006852 Bacteria 6148
176 Ga0075433_10050549 3300006852 Bacteria 3619
177 Ga0075433_10051274 3300006852 Bacteria 3593
178 Ga0075433_10101040 3300006852 Bacteria 2554
179 Ga0075433_10131733 3300006852 Unclassified 2221
180 Ga0075433_10152230 3300006852 Bacteria 2057
181 Ga0075433_10292419 3300006852 Bacteria 1443
182 Ga0075434_100002629 3300006871 Bacteria 15842
183 Ga0075434_100015514 3300006871 Bacteria 7310
184 Ga0075434_100015800 3300006871 Bacteria 7247
185 Ga0075434_100018076 3300006871 Bacteria 6802
186 Ga0075434_100035100 3300006871 Bacteria 4956
187 Ga0075434_100064113 3300006871 Bacteria 3658
188 Ga0075434_100084059 3300006871 Bacteria 3181
189 Ga0075434_100178339 3300006871 Bacteria 2144
190 Ga0075434_100393005 3300006871 Bacteria 1408
191 Ga0075434_100514387 3300006871 Bacteria 1218
192 Ga0075434_100546027 3300006871 Bacteria 1178
193 Ga0075434_100718214 3300006871 Bacteria 1016
194 Ga0075434_101666662 3300006871 Bacteria 646
195 Ga0075429_100001755 3300006880 Bacteria 17959
196 Ga0075429_100021020 3300006880 Bacteria 5662
197 Ga0075429_100033894 3300006880 Bacteria 4436
198 Ga0075429_100050176 3300006880 Bacteria 3631
199 Ga0075429_100127381 3300006880 Bacteria 2226
200 Ga0075429_100143651 3300006880 Bacteria 2089
201 Ga0075429_100581335 3300006880 Bacteria 981
202 Ga0075429_100633512 3300006880 Bacteria 937
203 Ga0075429_100676787 3300006880 Bacteria 904
204 Ga0075429_100686052 3300006880 Bacteria 897
205 Ga0075429_100950513 3300006880 Bacteria 752
206 Ga0068865_100514562 3300006881 Bacteria 1000
207 Ga0075436_100011043 3300006914 Bacteria 6197
208 Ga0075436_100018101 3300006914 Bacteria 4824
209 Ga0075436_100021150 3300006914 Bacteria 4464
210 Ga0075436_100026789 3300006914 Bacteria 3968
211 Ga0075436_100050908 3300006914 Bacteria 2858
212 Ga0075436_100179089 3300006914 Bacteria 1498
213 Ga0075436_100329919 3300006914 Unclassified 1097
214 Ga0075436_100343152 3300006914 Bacteria 1075
215 Ga0097620_100442446 3300006931 Bacteria 1396
216 Ga0097620_101339465 3300006931 Unclassified 789
217 Ga0075435_100025704 3300007076 Bacteria 4585
218 Ga0075435_100040600 3300007076 Bacteria 3717
219 Ga0075435_100055244 3300007076 Bacteria 3206
220 Ga0075435_100060235 3300007076 Bacteria 3078
221 Ga0075435_100070940 3300007076 Bacteria 2844
222 Ga0075435_100126291 3300007076 Bacteria 2138
223 Ga0075435_100199220 3300007076 Bacteria 1696
224 Ga0075435_100207843 3300007076 Bacteria 1660
225 Ga0075435_100271074 3300007076 Bacteria 1448
226 Ga0075435_100317402 3300007076 Bacteria 1333
227 Ga0075435_100946621 3300007076 Bacteria 752
228 Ga0075435_101166452 3300007076 Bacteria 674
229 Ga0099794_10002438 3300007265 Bacteria 6857
230 Ga0099794_10003250 3300007265 Bacteria 6165
231 Ga0099794_10011941 3300007265 Bacteria 3734
232 Ga0099794_10031264 3300007265 Bacteria 2492
233 Ga0111539_10001175 3300009094 Bacteria 34728
234 Ga0111539_10326760 3300009094 Bacteria 1785
235 Ga0111539_10933120 3300009094 Bacteria 1009
236 Ga0114129_10000032 3300009147 Bacteria 111487
237 Ga0114129_10000848 3300009147 Bacteria 39581
238 Ga0114129_10005875 3300009147 Bacteria 17382
239 Ga0114129_10014053 3300009147 Bacteria 11405
240 Ga0114129_10021143 3300009147 Bacteria 9240
241 Ga0114129_10037910 3300009147 Bacteria 6801
242 Ga0114129_10043365 3300009147 Bacteria 6328
243 Ga0114129_10045239 3300009147 Bacteria 6188
244 Ga0114129_10067176 3300009147 Bacteria 5001
245 Ga0114129_10074283 3300009147 Bacteria 4735
246 Ga0114129_10083562 3300009147 Bacteria 4435
247 Ga0114129_10108704 3300009147 Bacteria 3828
248 Ga0114129_10152688 3300009147 Bacteria 3160
249 Ga0114129_10153561 3300009147 Bacteria 3150
250 Ga0114129_10411038 3300009147 Bacteria 1782
251 Ga0114129_10475536 3300009147 Bacteria 1636
252 Ga0114129_10548196 3300009147 Bacteria 1504
253 Ga0114129_10791989 3300009147 Bacteria 1210
254 Ga0114129_10798551 3300009147 Bacteria 1204
255 Ga0114129_10875075 3300009147 Bacteria 1140
256 Ga0114129_11122992 3300009147 Bacteria 983
257 Ga0105241_10777935 3300009174 Bacteria 880
258 Ga0105242_10420514 3300009176 Bacteria 1252
259 Ga0105242_10498399 3300009176 Bacteria 1158
260 Ga0099796_10043695 3300010159 Bacteria 1528
261 Ga0105239_10578415 3300010375 Bacteria 1280
262 Ga0157378_10083501 3300013297 Bacteria 2891
263 Ga0157378_10557173 3300013297 Bacteria 1152
264 Ga0157378_10599812 3300013297 Bacteria 1112
265 Ga0163162_10073686 3300013306 Bacteria 3471
266 Ga0163162_10083374 3300013306 Bacteria 3271
267 Ga0157372_10768291 3300013307 Bacteria 1120
268 Ga0157375_10221737 3300013308 Bacteria 2049
269 Ga0163163_10721703 3300014325 Bacteria 1060
270 Ga0157380_10753401 3300014326 Bacteria 985
271 Ga0207653_10009916 3300025885 Bacteria 2970
272 Ga0207653_10016646 3300025885 Bacteria 2309
273 Ga0207653_10020403 3300025885 Bacteria 2097
274 Ga0207642_10137982 3300025899 Bacteria 1282
275 Ga0207699_10009112 3300025906 Bacteria 4927
276 Ga0207643_10040610 3300025908 Bacteria 2620
277 Ga0207684_10001313 3300025910 Bacteria 27290
278 Ga0207684_10002886 3300025910 Bacteria 17035
279 Ga0207684_10006969 3300025910 Bacteria 10224
280 Ga0207684_10074077 3300025910 Bacteria 2892
281 Ga0207684_10077081 3300025910 Bacteria 2834
282 Ga0207684_10080389 3300025910 Bacteria 2773
283 Ga0207684_10080750 3300025910 Bacteria 2767
284 Ga0207684_10086787 3300025910 Bacteria 2665
285 Ga0207684_10287079 3300025910 Bacteria 1419
286 Ga0207684_10305417 3300025910 Bacteria 1372
287 Ga0207684_10543444 3300025910 Bacteria 994
288 Ga0207707_10033990 3300025912 Bacteria 4462
289 Ga0207707_10095748 3300025912 Bacteria 2595
290 Ga0207707_11235858 3300025912 Bacteria 603
291 Ga0207663_10000046 3300025916 Bacteria 67693
292 Ga0207663_10533143 3300025916 Bacteria 916
293 Ga0207657_10033792 3300025919 Bacteria 4605
294 Ga0207657_10429064 3300025919 Bacteria 1038
295 Ga0207649_10052466 3300025920 Bacteria 2530
296 Ga0207652_10032962 3300025921 Bacteria 4361
297 Ga0207646_10001490 3300025922 Bacteria 28831
298 Ga0207646_10006446 3300025922 Bacteria 12116
299 Ga0207646_10006898 3300025922 Bacteria 11667
300 Ga0207646_10008460 3300025922 Bacteria 10309
301 Ga0207646_10013899 3300025922 Bacteria 7677
302 Ga0207646_10015441 3300025922 Bacteria 7212
303 Ga0207646_10015565 3300025922 Bacteria 7179
304 Ga0207646_10022718 3300025922 Bacteria 5772
305 Ga0207646_10043260 3300025922 Bacteria 4045
306 Ga0207646_10103089 3300025922 Bacteria 2558
307 Ga0207646_10111334 3300025922 Bacteria 2457
308 Ga0207646_10159964 3300025922 Bacteria 2032
309 Ga0207646_10167465 3300025922 Bacteria 1984
310 Ga0207646_10173088 3300025922 Bacteria 1949
311 Ga0207646_10414682 3300025922 Bacteria 1216
312 Ga0207681_10142958 3300025923 Bacteria 1784
313 Ga0207681_10255625 3300025923 Bacteria 1370
314 Ga0207659_10059427 3300025926 Bacteria 2748
315 Ga0207659_10447187 3300025926 Bacteria 1088
316 Ga0207644_10131154 3300025931 Bacteria 1919
317 Ga0207644_10160508 3300025931 Bacteria 1747
318 Ga0207690_10075723 3300025932 Bacteria 2335
319 Ga0207706_10068139 3300025933 Bacteria 3131
320 Ga0207706_10419813 3300025933 Bacteria 1159
321 Ga0207669_10038890 3300025937 Bacteria 2744
322 Ga0207704_10223849 3300025938 Bacteria 1394
323 Ga0207665_10455925 3300025939 Bacteria 982
324 Ga0207691_10001800 3300025940 Bacteria 21035
325 Ga0207691_10020979 3300025940 Bacteria 6175
326 Ga0207679_10088020 3300025945 Bacteria 2393
327 Ga0207679_10205427 3300025945 Bacteria 1648
328 Ga0207651_10355557 3300025960 Bacteria 1235
329 Ga0207640_10843759 3300025981 Bacteria 797
330 Ga0207677_10151722 3300026023 Bacteria 1789
331 Ga0207678_10398432 3300026067 Bacteria 1192
332 Ga0207641_10244388 3300026088 Bacteria 1674
333 Ga0207641_10494681 3300026088 Bacteria 1187
334 Ga0207683_10009609 3300026121 Bacteria 8243
335 Ga0209984_1009753 3300027424 Bacteria 1224
336 Ga0209995_1011297 3300027471 Bacteria 1451
337 Ga0209968_1009238 3300027526 Bacteria 1508
338 Ga0209982_1003995 3300027552 Bacteria 2101
339 Ga0210002_1009483 3300027617 Bacteria 1486
340 Ga0209983_1029311 3300027665 Bacteria 1170
341 Ga0209588_1008397 3300027671 Bacteria 3062
342 Ga0209588_1043729 3300027671 Bacteria 1448
343 Ga0209971_1007532 3300027682 Bacteria 2585
344 Ga0209966_1020863 3300027695 Bacteria 1272
345 Ga0209998_10001742 3300027717 Bacteria 5182
346 Ga0209974_10011763 3300027876 Bacteria 2935
347 Ga0209974_10019303 3300027876 Bacteria 2259
348 Ga0207428_10000628 3300027907 Bacteria 41501
349 Ga0207428_10370601 3300027907 Bacteria 1052
350 Ga0268266_10624900 3300028379 Bacteria 1036
351 Ga0268265_10043242 3300028380 Bacteria 3348
352 Ga0265327_10021942 3300031251 Bacteria 3836
353 Ga0307408_100032846 3300031548 Unclassified 3621
354 Ga0307408_100054147 3300031548 Bacteria 2900
355 Ga0307408_100104617 3300031548 Bacteria 2163
356 Ga0307408_100355098 3300031548 Bacteria 1245
357 Ga0307408_100455867 3300031548 Bacteria 1110
358 Ga0307405_10022859 3300031731 Bacteria 3543
359 Ga0307413_10003070 3300031824 Bacteria 6947
360 Ga0307410_10064362 3300031852 Bacteria 2519
361 Ga0307410_10154861 3300031852 Bacteria 1710
362 Ga0307410_10282902 3300031852 Bacteria 1302
363 Ga0307406_10242842 3300031901 Bacteria 1352
364 Ga0307406_10754153 3300031901 Bacteria 817
365 Ga0307407_10064545 3300031903 Bacteria 2152
366 Ga0307407_10132347 3300031903 Bacteria 1597
367 Ga0307407_10398077 3300031903 Bacteria 987
368 Ga0307407_10528291 3300031903 Bacteria 869
369 Ga0307407_10786474 3300031903 Bacteria 723
370 Ga0307412_10023591 3300031911 Bacteria 3788
371 Ga0307412_10322685 3300031911 Unclassified 1229
372 Ga0307409_100006158 3300031995 Bacteria 7016
373 Ga0307409_101212384 3300031995 Bacteria 778
374 Ga0307416_100006323 3300032002 Bacteria 7406
375 Ga0307416_100019230 3300032002 Bacteria 4837
376 Ga0307416_100094758 3300032002 Bacteria 2575
377 Ga0307416_100234222 3300032002 Bacteria 1773
378 Ga0307416_101507476 3300032002 Bacteria 778
379 Ga0307416_101548703 3300032002 Bacteria 768
380 Ga0307414_10002418 3300032004 Bacteria 9777
381 Ga0307414_10066128 3300032004 Bacteria 2583
382 Ga0307414_10657651 3300032004 Bacteria 945
383 Ga0307411_10013961 3300032005 Bacteria 4454
384 Ga0307411_10246897 3300032005 Bacteria 1401
385 Ga0307411_10257396 3300032005 Bacteria 1376
386 Ga0307411_10296829 3300032005 Bacteria 1294
387 Ga0307411_11151590 3300032005 Bacteria 701
388 Ga0307411_11422952 3300032005 Bacteria 635
389 Ga0307415_100002119 3300032126 Bacteria 9820
390 Ga0307415_100248838 3300032126 Bacteria 1443
391 Ga0307415_100341623 3300032126 Bacteria 1257
392 Ga0307415_100917773 3300032126 Bacteria 808
393 Ga0373939_0070419 3300035114 Bacteria 1137
394 Ga0373941_0008186 3300035115 Bacteria 2589
395 Ga0373960_0050360 3300035121 Bacteria 1234
396 Ga0373943_0298881 3300035170 Bacteria 914
397 Ga0373931_0002419 3300035691 Bacteria 8257
398 Ga0373931_0003331 3300035691 Bacteria 7195
399 Ga0373935_0113102 3300035692 Bacteria 1804
400 Ga0373927_0235053 3300035695 Bacteria 1204
401 Ga0373927_0555400 3300035695 Bacteria 759
402 Ga0373947_0031684 3300035725 Bacteria 3113
403 Ga0373947_0151929 3300035725 Bacteria 1492
404 Ga0373937_0172219 3300036401 Bacteria 2031
405 Ga0395905_0070393 3300037471 Bacteria 3278
406 Ga0395905_0074264 3300037471 Bacteria 3187
407 Ga0395901_0134549 3300038443 Bacteria 2598
408 Ga0395901_0191485 3300038443 Bacteria 2145
409 Ga0439436_0151688 3300041404 Bacteria 654
410 Ga0439433_0040025 3300041999 Bacteria 1089
411 Ga0439441_009959 3300042001 Bacteria 1584
412 Ga0439441_041268 3300042001 Bacteria 925
413 Ga0439448_0043738 3300042005 Bacteria 1455
414 Ga0439450_013674 3300042008 Bacteria 1635
415 Ga0439454_026810 3300042011 Bacteria 883
416 Ga0439462_0090967 3300042015 Bacteria 837
417 Ga0439463_052202 3300042016 Bacteria 1043
418 Ga0439458_0029583 3300042157 Bacteria 1300
419 Ga0439434_0025317 3300042435 Bacteria 1791
420 Ga0439460_0121813 3300042461 Bacteria 854
421 Ga0451577_0000065 3300042876 Bacteria 260821
422 Ga0451577_0004450 3300042876 Bacteria 14799
423 Ga0451577_0675640 3300042876 Bacteria 936
424 Ga0453683_0000458 3300044673 Bacteria 46966
425 Ga0453683_0007283 3300044673 Bacteria 7536
426 Ga0453683_0049424 3300044673 Bacteria 2636
427 Ga0453683_0075814 3300044673 Bacteria 2105
428 Ga0453683_0248801 3300044673 Bacteria 1133
429 Ga0453683_0273111 3300044673 Bacteria 1079
430 Ga0453683_0592455 3300044673 Bacteria 723
431 Ga0453684_0000349 3300044712 Bacteria 192484
432 Ga0453684_0000990 3300044712 Bacteria 92744
433 Ga0453684_0020133 3300044712 Bacteria 10095
434 Ga0453684_0044102 3300044712 Bacteria 5977
435 Ga0453684_0093273 3300044712 Bacteria 3709
436 Ga0453684_0151672 3300044712 Bacteria 2753
437 Ga0453684_0803752 3300044712 Bacteria 1014
438 Ga0453684_0926485 3300044712 Bacteria 931
439 Ga0453684_0961560 3300044712 Bacteria 911
440 Ga0451576_0000086 3300045051 Bacteria 235554
441 Ga0451576_0040433 3300045051 Bacteria 4935
442 Ga0451576_0111224 3300045051 Unclassified 2850
443 Ga0451576_0255026 3300045051 Bacteria 1833
444 Ga0451576_0315508 3300045051 Bacteria 1636
445 Ga0451576_0392307 3300045051 Bacteria 1455
446 Ga0451576_0727649 3300045051 Bacteria 1042
447 Ga0451576_0878974 3300045051 Bacteria 941
448 Ga0495580_0009393 3300046472 Bacteria 7694
449 Ga0495580_0013924 3300046472 Bacteria 6121
450 Ga0495663_0022106 3300046525 Bacteria 1836
451 Ga0495586_0534495 3300046535 Bacteria 677
452 Ga0495621_0030217 3300046539 Bacteria 1851
453 Ga0495677_0095952 3300047445 Bacteria 1120
454 Ga0496103_0308998 3300048906 Bacteria 1017
455 Ga0496106_0494135 3300048909 Bacteria 983
456 Ga0496106_0713095 3300048909 Bacteria 799
457 Ga0496114_0170453 3300048917 Bacteria 1896
458 Ga0501306_031805 3300049127 Bacteria 787
459 Ga0501291_032667 3300049514 Bacteria 884
460 Ga0501298_007242 3300049521 Unclassified 1837
461 Ga0501317_004226 3300049533 Bacteria 1483
462 Ga0501031_0116006 3300049568 Bacteria 1749
463 Ga0501031_0124059 3300049568 Bacteria 1687
464 Ga0501031_0374087 3300049568 Bacteria 922
465 Ga0501031_0555242 3300049568 Bacteria 740
466 Ga0501032_0359273 3300049569 Bacteria 938
467 Ga0501032_0533765 3300049569 Bacteria 748
468 Ga0501033_0018671 3300049570 Bacteria 5241
469 Ga0501033_0109102 3300049570 Bacteria 2016
470 Ga0501036_0022733 3300049572 Bacteria 5279
471 Ga0501036_0067924 3300049572 Bacteria 3016
472 Ga0501036_0199593 3300049572 Bacteria 1682
473 Ga0501037_0048408 3300049573 Bacteria 3115
474 Ga0501037_0109035 3300049573 Bacteria 1995
475 Ga0501037_0236623 3300049573 Bacteria 1281
476 Ga0501038_0002448 3300049574 Bacteria 17287
477 Ga0501038_0219099 3300049574 Bacteria 1519
478 Ga0501038_0368297 3300049574 Bacteria 1116
479 Ga0501038_0711109 3300049574 Bacteria 752
480 Ga0501038_0736387 3300049574 Unclassified 736
481 Ga0501039_0002376 3300049575 Bacteria 14017
482 Ga0501039_0227064 3300049575 Bacteria 1467
483 Ga0501039_0633784 3300049575 Bacteria 837
484 Ga0501039_0662809 3300049575 Bacteria 817
485 Ga0501040_0001437 3300049576 Bacteria 15077
486 Ga0501040_0018747 3300049576 Bacteria 4596
487 Ga0501040_0027789 3300049576 Bacteria 3810
488 Ga0501040_0035126 3300049576 Bacteria 3398
489 Ga0501040_0061387 3300049576 Bacteria 2585
490 Ga0501040_0127055 3300049576 Bacteria 1791
491 Ga0501040_0190309 3300049576 Bacteria 1456
492 Ga0501040_0413499 3300049576 Bacteria 969
493 Ga0501040_0578448 3300049576 Bacteria 811
494 Ga0501041_0003190 3300049577 Bacteria 9428
495 Ga0501041_0016562 3300049577 Bacteria 4384
496 Ga0501041_0045216 3300049577 Bacteria 2676
497 Ga0501041_0156352 3300049577 Bacteria 1424
498 Ga0501041_0246533 3300049577 Bacteria 1123
499 Ga0501042_0000034 3300049578 Bacteria 43770
500 Ga0501042_0010771 3300049578 Bacteria 6148
501 Ga0501042_0085233 3300049578 Bacteria 2266
502 Ga0501042_0087545 3300049578 Bacteria 2234
503 Ga0501042_0103815 3300049578 Bacteria 2045
504 Ga0501042_0309239 3300049578 Bacteria 1142
505 Ga0501043_0012783 3300049579 Bacteria 6562
506 Ga0501043_0047477 3300049579 Bacteria 3376
507 Ga0501043_0168850 3300049579 Bacteria 1707
508 Ga0501046_0013999 3300049580 Bacteria 6775
509 Ga0501046_0018234 3300049580 Bacteria 5844
510 Ga0501046_0061976 3300049580 Bacteria 2923
511 Ga0501046_0089165 3300049580 Bacteria 2374
512 Ga0501046_0337662 3300049580 Bacteria 1095
513 Ga0501046_0394248 3300049580 Bacteria 1001
514 Ga0501048_0007735 3300049582 Bacteria 8149
515 Ga0501048_0098025 3300049582 Unclassified 2068
516 Ga0501048_0129346 3300049582 Bacteria 1785
517 Ga0501048_0473712 3300049582 Bacteria 897
518 Ga0501067_0030381 3300049583 Bacteria 2996
519 Ga0501068_0003003 3300049584 Bacteria 8990
520 Ga0501068_0013051 3300049584 Bacteria 4723
521 Ga0501068_0049475 3300049584 Bacteria 2539
522 Ga0501069_0013206 3300049585 Bacteria 4401
523 Ga0501069_0076697 3300049585 Bacteria 1879
524 Ga0501070_0873775 3300049586 Bacteria 702
525 Ga0501071_0005752 3300049587 Bacteria 8000
526 Ga0501071_0093852 3300049587 Bacteria 2207
527 Ga0501072_0000420 3300049588 Bacteria 30352
528 Ga0501072_0010810 3300049588 Bacteria 6955
529 Ga0501072_0022582 3300049588 Bacteria 4879
530 Ga0501072_0029146 3300049588 Bacteria 4309
531 Ga0501072_0055184 3300049588 Bacteria 3132
532 Ga0501072_0106071 3300049588 Bacteria 2235
533 Ga0501072_0564191 3300049588 Bacteria 899
534 Ga0501072_0577225 3300049588 Bacteria 887
535 Ga0501072_0577741 3300049588 Bacteria 887
536 Ga0501073_0165467 3300049589 Bacteria 1531
537 Ga0501074_0044860 3300049590 Bacteria 3199
538 Ga0501074_0069917 3300049590 Bacteria 2524
539 Ga0501074_0154278 3300049590 Bacteria 1641
540 Ga0501074_0431515 3300049590 Bacteria 934
541 Ga0501074_0486961 3300049590 Bacteria 874
542 Ga0501074_0666144 3300049590 Bacteria 735
543 Ga0501075_0000890 3300049591 Bacteria 18847
544 Ga0501075_0004361 3300049591 Bacteria 9570
545 Ga0501075_0009510 3300049591 Bacteria 6802
546 Ga0501075_0162136 3300049591 Bacteria 1706
547 Ga0501075_0249898 3300049591 Bacteria 1351
548 Ga0501075_0517730 3300049591 Bacteria 910
549 Ga0501075_0534264 3300049591 Bacteria 895
550 Ga0501075_0701664 3300049591 Bacteria 771
551 Ga0501075_0816600 3300049591 Bacteria 709
552 Ga0501076_0013014 3300049592 Bacteria 6229
553 Ga0501076_0018249 3300049592 Bacteria 5345
554 Ga0501076_0052024 3300049592 Bacteria 3243
555 Ga0501076_0094872 3300049592 Bacteria 2402
556 Ga0501076_0102535 3300049592 Bacteria 2307
557 Ga0501076_0296551 3300049592 Bacteria 1325
558 Ga0501076_0885562 3300049592 Bacteria 736
559 Ga0501077_0000051 3300049593 Bacteria 61179
560 Ga0501077_0008677 3300049593 Bacteria 6301
561 Ga0501077_0020849 3300049593 Bacteria 4149
562 Ga0501077_0041753 3300049593 Bacteria 2919
563 Ga0501077_0084298 3300049593 Bacteria 2014
564 Ga0501077_0225172 3300049593 Bacteria 1192
565 Ga0501077_0341105 3300049593 Bacteria 956
566 Ga0501077_0461529 3300049593 Bacteria 813
567 Ga0501077_0531166 3300049593 Bacteria 755
568 Ga0501209_073198 3300049656 Bacteria 977
569 Ga0501216_004459 3300049660 Bacteria 2079
570 Ga0501216_029192 3300049660 Bacteria 1010
571 Ga0501217_050078 3300049661 Bacteria 1089
572 Ga0501224_028854 3300049664 Bacteria 831
573 Ga0501239_024696 3300049672 Bacteria 758
574 Ga0501248_022588 3300049678 Bacteria 663
575 Ga0501249_008591 3300049679 Bacteria 2120
576 Ga0501229_007095 3300049706 Bacteria 1391
577 Ga0501079_0000789 3300049741 Bacteria 21567
578 Ga0501079_0002538 3300049741 Bacteria 13245
579 Ga0501079_0034063 3300049741 Bacteria 3918
580 Ga0501079_0107547 3300049741 Bacteria 2165
581 Ga0501079_0590662 3300049741 Bacteria 874
582 Ga0501080_0024386 3300049742 Bacteria 5607
583 Ga0501080_0038156 3300049742 Bacteria 4486
584 Ga0501080_0147655 3300049742 Bacteria 2174
585 Ga0501080_0357846 3300049742 Bacteria 1317
586 Ga0501080_0365798 3300049742 Bacteria 1301
587 Ga0501080_0600397 3300049742 Bacteria 977
588 Ga0501081_0001354 3300049743 Bacteria 14955
589 Ga0501081_0017585 3300049743 Bacteria 4736
590 Ga0501081_0030175 3300049743 Bacteria 3669
591 Ga0501081_0081370 3300049743 Bacteria 2268
592 Ga0501081_0200643 3300049743 Bacteria 1446
593 Ga0501081_0249577 3300049743 Bacteria 1295
594 Ga0501081_0323041 3300049743 Bacteria 1135
595 Ga0501081_0338711 3300049743 Bacteria 1107
596 Ga0501081_0372655 3300049743 Bacteria 1054
597 Ga0501081_0400852 3300049743 Bacteria 1015
598 Ga0501081_0415722 3300049743 Bacteria 997
599 Ga0501081_0457180 3300049743 Bacteria 949
600 Ga0501081_0713300 3300049743 Bacteria 753
601 Ga0501081_0728331 3300049743 Bacteria 745
602 Ga0501081_0868919 3300049743 Bacteria 679
603 Ga0501083_0039342 3300049744 Bacteria 3212
604 Ga0501083_0077668 3300049744 Bacteria 2203
605 Ga0501266_018793 3300049763 Bacteria 932
606 Ga0501268_001945 3300049765 Bacteria 2648
607 Ga0501035_0005209 3300049822 Bacteria 12305
608 Ga0501035_0135509 3300049822 Bacteria 2144
609 Ga0501035_0530647 3300049822 Bacteria 966
610 Ga0501045_0001265 3300049824 Bacteria 16773
611 Ga0501045_0001879 3300049824 Bacteria 14228
612 Ga0501045_0118902 3300049824 Bacteria 1961
613 Ga0501045_0185785 3300049824 Bacteria 1549
614 Ga0501045_0785334 3300049824 Bacteria 701
615 Ga0501204_008924 3300049850 Bacteria 1152
616 nmdc:mga05p37_11166_c1 3300050507 Bacteria 10675
617 nmdc:mga05p37_1621_c1 3300050507 Bacteria 26061
618 nmdc:mga05p37_172216_c1 3300050507 Bacteria 2640
619 nmdc:mga05p37_207131_c1 3300050507 Bacteria 2372
620 nmdc:mga05p37_232981_c1 3300050507 Bacteria 2218
621 nmdc:mga05p37_23640_c1 3300050507 Bacteria 7461
622 nmdc:mga05p37_2688_c1 3300050507 Bacteria 20683
623 nmdc:mga05p37_29491_c1 3300050507 Bacteria 6695
624 nmdc:mga05p37_300908_c1 3300050507 Bacteria 1906
625 nmdc:mga05p37_34876_c1 3300050507 Bacteria 6165
626 nmdc:mga05p37_3775_c1 3300050507 Bacteria 17732
627 nmdc:mga05p37_380598_c1 3300050507 Bacteria 1654
628 nmdc:mga05p37_4041_c1 3300050507 Bacteria 17147
629 nmdc:mga05p37_4419_c1 3300050507 Bacteria 16190
630 nmdc:mga05p37_46750_c2 3300050507 Bacteria 4450
631 nmdc:mga05p37_51631_c1 3300050507 Bacteria 5056
632 nmdc:mga05p37_90946_c1 3300050507 Bacteria 3761
633 nmdc:mga09592_1064693_c1 3300050508 Bacteria 674
634 nmdc:mga09592_1255894_c1 3300050508 Bacteria 610
635 nmdc:mga09592_12601_c1 3300050508 Bacteria 6891
636 nmdc:mga09592_28999_c1 3300050508 Bacteria 4602
637 nmdc:mga09592_34819_c1 3300050508 Bacteria 4212
638 nmdc:mga09592_49658_c1 3300050508 Bacteria 3537
639 nmdc:mga09592_5596_c1 3300050508 Bacteria 10239
640 nmdc:mga09592_659578_c1 3300050508 Bacteria 893
641 nmdc:mga09592_725455_c1 3300050508 Bacteria 845
642 nmdc:mga09592_75832_c1 3300050508 Bacteria 2859
643 nmdc:mga09592_9548_c1 3300050508 Bacteria 7885
644 nmdc:mga0qj67_106695_c1 3300050509 Bacteria 2260
645 nmdc:mga0qj67_24700_c1 3300050509 Bacteria 4636
646 nmdc:mga0qj67_271854_c1 3300050509 Bacteria 1374
647 nmdc:mga0qj67_319077_c1 3300050509 Bacteria 1258
648 nmdc:mga0qj67_545963_c1 3300050509 Bacteria 930
649 nmdc:mga0qj67_681_c1 3300050509 Bacteria 23126
650 nmdc:mga0qj67_79021_c1 3300050509 Bacteria 2634
651 nmdc:mga0qj67_8216_c1 3300050509 Bacteria 7736
652 nmdc:mga06r32_1002233_c1 3300050510 Bacteria 788
653 nmdc:mga06r32_12541_c2 3300050510 Bacteria 4812
654 nmdc:mga06r32_194459_c1 3300050510 Bacteria 2016
655 nmdc:mga06r32_2218_c1 3300050510 Bacteria 17390
656 nmdc:mga06r32_223516_c1 3300050510 Bacteria 1871
657 nmdc:mga06r32_252439_c1 3300050510 Bacteria 1751
658 nmdc:mga06r32_255856_c1 3300050510 Bacteria 1739
659 nmdc:mga06r32_28439_c1 3300050510 Bacteria 5230
660 nmdc:mga06r32_3390_c1 3300050510 Bacteria 14252
661 nmdc:mga06r32_38736_c1 3300050510 Bacteria 4519
662 nmdc:mga06r32_700_c1 3300050510 Bacteria 29256
663 nmdc:mga06r32_70173_c1 3300050510 Bacteria 3388
664 nmdc:mga06r32_85726_c1 3300050510 Bacteria 3071
665 nmdc:mga06r32_950_c1 3300050510 Bacteria 25815
666 nmdc:mga08y16_207673_c1 3300050511 Bacteria 2028
667 nmdc:mga08y16_563275_c1 3300050511 Bacteria 1152
668 nmdc:mga08y16_62855_c1 3300050511 Bacteria 3877
669 nmdc:mga08y16_832_c1 3300050511 Bacteria 29640
670 nmdc:mga0n895_10072_c1 3300050512 Bacteria 8319
671 nmdc:mga0n895_1080725_c1 3300050512 Bacteria 780
672 nmdc:mga0n895_12336_c1 3300050512 Bacteria 7663
673 nmdc:mga0n895_13985_c1 3300050512 Bacteria 7269
674 nmdc:mga0n895_180680_c1 3300050512 Bacteria 2141
675 nmdc:mga0n895_251602_c1 3300050512 Bacteria 1793
676 nmdc:mga0n895_269239_c1 3300050512 Bacteria 1728
677 nmdc:mga0n895_384676_c1 3300050512 Bacteria 1420
678 nmdc:mga0n895_413586_c1 3300050512 Bacteria 1364
679 nmdc:mga0n895_47670_c1 3300050512 Bacteria 4190
680 nmdc:mga0n895_4946_c1 3300050512 Bacteria 11055
681 nmdc:mga0n895_508041_c1 3300050512 Bacteria 1214
682 nmdc:mga0n895_657_c1 3300050512 Bacteria 24148
683 nmdc:mga0n895_909651_c1 3300050512 Bacteria 865
684 nmdc:mga0rr50_121326_c1 3300050513 Bacteria 2081
685 nmdc:mga0rr50_12615_c1 3300050513 Bacteria 5471
686 nmdc:mga0rr50_194788_c1 3300050513 Bacteria 1663
687 nmdc:mga0rr50_262165_c1 3300050513 Bacteria 1438
688 nmdc:mga0rr50_33351_c1 3300050513 Bacteria 3677
689 nmdc:mga0rr50_571837_c1 3300050513 Bacteria 963
690 nmdc:mga0rr50_888205_c1 3300050513 Bacteria 760
691 nmdc:mga0rr50_91130_c1 3300050513 Bacteria 2373
692 nmdc:mga08x19_18303_c1 3300050514 Bacteria 4294
693 nmdc:mga08x19_189220_c1 3300050514 Bacteria 1408
694 nmdc:mga08x19_23974_c1 3300050514 Bacteria 3788
695 nmdc:mga08x19_241700_c1 3300050514 Bacteria 1245
696 nmdc:mga08x19_28438_c1 3300050514 Bacteria 3502
697 nmdc:mga08x19_409494_c1 3300050514 Bacteria 952
698 nmdc:mga08x19_6035_c1 3300050514 Bacteria 7160
699 nmdc:mga0a205_106761_c1 3300050515 Bacteria 2698
700 nmdc:mga0a205_11033_c1 3300050515 Bacteria 8316
701 nmdc:mga0a205_268281_c1 3300050515 Bacteria 1584
702 nmdc:mga0a205_28590_c1 3300050515 Bacteria 5331
703 nmdc:mga0a205_356246_c1 3300050515 Bacteria 1330
704 nmdc:mga0a205_357725_c1 3300050515 Bacteria 1327
705 nmdc:mga0a205_3660_c1 3300050515 Bacteria 13768
706 nmdc:mga0a205_435544_c1 3300050515 Bacteria 1172
707 nmdc:mga0a205_45005_c1 3300050515 Bacteria 4256
708 nmdc:mga0a205_47449_c1 3300050515 Bacteria 4145
709 nmdc:mga0a205_54611_c1 3300050515 Bacteria 1947
710 nmdc:mga0a205_658643_c1 3300050515 Bacteria 898
711 nmdc:mga0a205_86141_c1 3300050515 Bacteria 3034
712 nmdc:mga0a205_91617_c1 3300050515 Bacteria 2938
713 nmdc:mga0a205_92443_c1 3300050515 Bacteria 2923
714 nmdc:mga0a205_92659_c2 3300050515 Bacteria 2378
715 nmdc:mga0a205_977781_c1 3300050515 Bacteria 693
716 Ga0501084_0007634 3300054114 Bacteria 8920
717 Ga0501084_0026044 3300054114 Bacteria 4878
718 Ga0501084_0046314 3300054114 Bacteria 3643
719 Ga0501084_0181733 3300054114 Bacteria 1775
720 Ga0501084_0339345 3300054114 Bacteria 1269
721 Ga0501084_0707717 3300054114 Unclassified 849
722 Ga0590071_005737 3300059421 Bacteria 2979
723 Ga0590071_039993 3300059421 Bacteria 1127
724 Ga0590075_021884 3300059424 Bacteria 1598
725 Ga0590075_032551 3300059424 Bacteria 1323
726 Ga0590077_016082 3300059426 Bacteria 1568
727 Ga0501082_0005141 3300060353 Bacteria 11389
728 Ga0501082_0031566 3300060353 Bacteria 4569
729 Ga0501082_0050329 3300060353 Bacteria 3593
730 Ga0501082_0071412 3300060353 Bacteria 2990
731 Ga0501082_0120661 3300060353 Bacteria 2272
732 Ga0501082_0173848 3300060353 Bacteria 1873
733 Ga0501082_0196778 3300060353 Bacteria 1753
734 Ga0501082_0240162 3300060353 Bacteria 1576
735 Ga0501082_0539591 3300060353 Bacteria 1020
736 Ga0501082_0631788 3300060353 Bacteria 937
737 Ga0501082_0762254 3300060353 Bacteria 847
738 Ga0530510_0000802 3300061734 Bacteria 20451
739 Ga0530510_0010756 3300061734 Bacteria 6421
740 Ga0530510_0118182 3300061734 Bacteria 1945
741 Ga0530510_0150648 3300061734 Bacteria 1717
742 Ga0530510_0365896 3300061734 Bacteria 1084
743 Ga0530510_0540463 3300061734 Bacteria 885
744 Ga0530510_0683499 3300061734 Bacteria 782
745 Ga0530510_0788519 3300061734 Bacteria 725
746 2881103859 2881101125 Bacteria 4590519
747 Ga0451577_0035922
748 JGI25406J46586_10017024
749 JGI25405J52794_10003729
750 Ga0058863_10074702
751 Ga0058862_12788718
752 Ga0065714_10172870
753 Ga0065704_10008523
754 Ga0065704_10310276
755 Ga0065712_10005267
756 Ga0065712_10008498
757 Ga0065712_10135171
758 Ga0065715_10032310
759 Ga0065707_10096162
760 Ga0065707_10203551
761 Ga0070690_100212591
762 Ga0070670_100006659
763 Ga0070670_100686376
764 Ga0070666_10195935
765 Ga0068868_100102989
766 Ga0070661_100239501
767 Ga0070692_10051522
768 Ga0070668_100073317
769 Ga0070668_101301050
770 Ga0070669_100017426
771 Ga0070675_100027270
772 Ga0070671_100108494
773 Ga0070671_100202685
774 Ga0070671_100274781
775 Ga0070674_100323784
776 Ga0070673_100038626
777 Ga0070673_100233653
778 Ga0070688_100388979
779 Ga0070667_100035908
780 Ga0070709_10126773
781 Ga0070711_100000126
782 Ga0070705_100049272
783 Ga0070705_100313828
784 Ga0070694_100000850
785 Ga0070694_100088384
786 Ga0070694_100113522
787 Ga0070694_100155646
788 Ga0070694_100249307
789 Ga0070694_100383353
790 Ga0070708_100006984
791 Ga0070708_100016385
792 Ga0070708_100017658
793 Ga0070708_100021441
794 Ga0070708_100030386
795 Ga0070708_100093131
796 Ga0070708_100121209
797 Ga0070708_100175030
798 Ga0070708_100218143
799 Ga0070708_100296176
800 Ga0070708_100299571
801 Ga0070708_100384536
802 Ga0070708_100492208
803 Ga0070708_100740309
804 Ga0070708_100746477
805 Ga0070662_100404223
806 Ga0070681_10082037
807 Ga0070681_10135655
808 Ga0068867_100913236
809 Ga0070706_100009936
810 Ga0070706_100041240
811 Ga0070706_100042901
812 Ga0070706_100083215
813 Ga0070706_100295937
814 Ga0070706_100426995
815 Ga0070706_100656324
816 Ga0070706_100716704
817 Ga0070707_100000923
818 Ga0070707_100004517
819 Ga0070707_100019403
820 Ga0070707_100051109
821 Ga0070707_100060286
822 Ga0070707_100085042
823 Ga0070707_100085253
824 Ga0070707_100304443
825 Ga0070707_100307128
826 Ga0070707_100314697
827 Ga0070698_100002338
828 Ga0070698_100012434
829 Ga0070698_100012746
830 Ga0070698_100012967
831 Ga0070698_100212762
832 Ga0070699_100007298
833 Ga0070699_100009226
834 Ga0070699_100013779
835 Ga0070699_100023501
836 Ga0070699_100032372
837 Ga0070699_100038516
838 Ga0070699_100039795
839 Ga0070699_100090889
840 Ga0070699_100097691
841 Ga0070699_100158251
842 Ga0070699_100210518
843 Ga0070699_100221143
844 Ga0070699_100311348
845 Ga0070699_100412170
846 Ga0070679_100072288
847 Ga0070697_100005642
848 Ga0070697_100008448
849 Ga0070697_100014761
850 Ga0070697_100016360
851 Ga0070697_100021802
852 Ga0070697_100026474
853 Ga0070697_100048853
854 Ga0070697_100072844
855 Ga0070697_100075443
856 Ga0070697_100120591
857 Ga0070697_100161479
858 Ga0070697_100703844
859 Ga0070672_100003411
860 Ga0070672_100161232
861 Ga0070695_100039649
862 Ga0070695_100068179
863 Ga0070695_100905801
864 Ga0070696_100009721
865 Ga0070696_100022337
866 Ga0070696_100086168
867 Ga0070665_100544196
868 Ga0070704_100003789
869 Ga0070704_100050156
870 Ga0070704_100279008
871 Ga0070664_100052303
872 Ga0070664_100077681
873 Ga0068857_100155674
874 Ga0068859_100442522
875 Ga0068859_101339151
876 Ga0068864_100305443
877 Ga0068863_100537689
878 Ga0068863_100566782
879 Ga0068860_100452675
880 Ga0068862_100335229
881 Ga0081455_10003567
882 Ga0081455_10125537
883 Ga0081455_10132240
884 Ga0081538_10002027
885 Ga0081538_10005780
886 Ga0081538_10013677
887 Ga0081538_10031492
888 Ga0081539_10002099
889 Ga0081539_10239824
890 Ga0075432_10150875
891 Ga0070716_100015646
892 Ga0070716_100254834
893 Ga0075427_10000492
894 Ga0075428_100009753
895 Ga0075428_100010028
896 Ga0075428_100026946
897 Ga0075428_100414311
898 Ga0075428_100611719
899 Ga0075428_101509383
900 Ga0075430_100000040
901 Ga0075430_100007555
902 Ga0075430_100045106
903 Ga0075430_100071336
904 Ga0075430_100129588
905 Ga0075430_100193356
906 Ga0075431_100000192
907 Ga0075431_100009690
908 Ga0075431_100024052
909 Ga0075431_100027056
910 Ga0075431_100031048
911 Ga0075431_100042671
912 Ga0075431_100125721
913 Ga0075431_100168942
914 Ga0075431_100228896
915 Ga0075431_100242589
916 Ga0075431_100272089
917 Ga0075431_100363985
918 Ga0075431_100402977
919 Ga0075431_100842125
920 Ga0075433_10001101
921 Ga0075433_10016123
922 Ga0075433_10050549
923 Ga0075433_10051274
924 Ga0075433_10101040
925 Ga0075433_10131733
926 Ga0075433_10152230
927 Ga0075433_10292419
928 Ga0075434_100002629
929 Ga0075434_100015514
930 Ga0075434_100015800
931 Ga0075434_100018076
932 Ga0075434_100035100
933 Ga0075434_100064113
934 Ga0075434_100084059
935 Ga0075434_100178339
936 Ga0075434_100393005
937 Ga0075434_100514387
938 Ga0075434_100546027
939 Ga0075434_100718214
940 Ga0075434_101666662
941 Ga0075429_100001755
942 Ga0075429_100021020
943 Ga0075429_100033894
944 Ga0075429_100050176
945 Ga0075429_100127381
946 Ga0075429_100143651
947 Ga0075429_100581335
948 Ga0075429_100633512
949 Ga0075429_100676787
950 Ga0075429_100686052
951 Ga0075429_100950513
952 Ga0068865_100514562
953 Ga0075436_100011043
954 Ga0075436_100018101
955 Ga0075436_100021150
956 Ga0075436_100026789
957 Ga0075436_100050908
958 Ga0075436_100179089
959 Ga0075436_100329919
960 Ga0075436_100343152
961 Ga0097620_100442446
962 Ga0097620_101339465
963 Ga0075435_100025704
964 Ga0075435_100040600
965 Ga0075435_100055244
966 Ga0075435_100060235
967 Ga0075435_100070940
968 Ga0075435_100126291
969 Ga0075435_100199220
970 Ga0075435_100207843
971 Ga0075435_100271074
972 Ga0075435_100317402
973 Ga0075435_100946621
974 Ga0075435_101166452
975 Ga0099794_10002438
976 Ga0099794_10003250
977 Ga0099794_10011941
978 Ga0099794_10031264
979 Ga0111539_10001175
980 Ga0111539_10326760
981 Ga0111539_10933120
982 Ga0114129_10000032
983 Ga0114129_10000848
984 Ga0114129_10005875
985 Ga0114129_10014053
986 Ga0114129_10021143
987 Ga0114129_10037910
988 Ga0114129_10043365
989 Ga0114129_10045239
990 Ga0114129_10067176
991 Ga0114129_10074283
992 Ga0114129_10083562
993 Ga0114129_10108704
994 Ga0114129_10152688
995 Ga0114129_10153561
996 Ga0114129_10411038
997 Ga0114129_10475536
998 Ga0114129_10548196
999 Ga0114129_10791989
1000 Ga0114129_10798551
1001 Ga0114129_10875075
1002 Ga0114129_11122992
1003 Ga0105241_10777935
1004 Ga0105242_10420514
1005 Ga0105242_10498399
1006 Ga0099796_10043695
1007 Ga0105239_10578415
1008 Ga0157378_10083501
1009 Ga0157378_10557173
1010 Ga0157378_10599812
1011 Ga0163162_10073686
1012 Ga0163162_10083374
1013 Ga0157372_10768291
1014 Ga0157375_10221737
1015 Ga0163163_10721703
1016 Ga0157380_10753401
1017 Ga0207653_10009916
1018 Ga0207653_10016646
1019 Ga0207653_10020403
1020 Ga0207642_10137982
1021 Ga0207699_10009112
1022 Ga0207643_10040610
1023 Ga0207684_10001313
1024 Ga0207684_10002886
1025 Ga0207684_10006969
1026 Ga0207684_10074077
1027 Ga0207684_10077081
1028 Ga0207684_10080389
1029 Ga0207684_10080750
1030 Ga0207684_10086787
1031 Ga0207684_10287079
1032 Ga0207684_10305417
1033 Ga0207684_10543444
1034 Ga0207707_10033990
1035 Ga0207707_10095748
1036 Ga0207707_11235858
1037 Ga0207663_10000046
1038 Ga0207663_10533143
1039 Ga0207657_10033792
1040 Ga0207657_10429064
1041 Ga0207649_10052466
1042 Ga0207652_10032962
1043 Ga0207646_10001490
1044 Ga0207646_10006446
1045 Ga0207646_10006898
1046 Ga0207646_10008460
1047 Ga0207646_10013899
1048 Ga0207646_10015441
1049 Ga0207646_10015565
1050 Ga0207646_10022718
1051 Ga0207646_10043260
1052 Ga0207646_10103089
1053 Ga0207646_10111334
1054 Ga0207646_10159964
1055 Ga0207646_10167465
1056 Ga0207646_10173088
1057 Ga0207646_10414682
1058 Ga0207681_10142958
1059 Ga0207681_10255625
1060 Ga0207659_10059427
1061 Ga0207659_10447187
1062 Ga0207644_10131154
1063 Ga0207644_10160508
1064 Ga0207690_10075723
1065 Ga0207706_10068139
1066 Ga0207706_10419813
1067 Ga0207669_10038890
1068 Ga0207704_10223849
1069 Ga0207665_10455925
1070 Ga0207691_10001800
1071 Ga0207691_10020979
1072 Ga0207679_10088020
1073 Ga0207679_10205427
1074 Ga0207651_10355557
1075 Ga0207640_10843759
1076 Ga0207677_10151722
1077 Ga0207678_10398432
1078 Ga0207641_10244388
1079 Ga0207641_10494681
1080 Ga0207683_10009609
1081 Ga0209984_1009753
1082 Ga0209995_1011297
1083 Ga0209968_1009238
1084 Ga0209982_1003995
1085 Ga0210002_1009483
1086 Ga0209983_1029311
1087 Ga0209588_1008397
1088 Ga0209588_1043729
1089 Ga0209971_1007532
1090 Ga0209966_1020863
1091 Ga0209998_10001742
1092 Ga0209974_10011763
1093 Ga0209974_10019303
1094 Ga0207428_10000628
1095 Ga0207428_10370601
1096 Ga0268266_10624900
1097 Ga0268265_10043242
1098 Ga0265327_10021942
1099 Ga0307408_100032846
1100 Ga0307408_100054147
1101 Ga0307408_100104617
1102 Ga0307408_100355098
1103 Ga0307408_100455867
1104 Ga0307405_10022859
1105 Ga0307413_10003070
1106 Ga0307410_10064362
1107 Ga0307410_10154861
1108 Ga0307410_10282902
1109 Ga0307406_10242842
1110 Ga0307406_10754153
1111 Ga0307407_10064545
1112 Ga0307407_10132347
1113 Ga0307407_10398077
1114 Ga0307407_10528291
1115 Ga0307407_10786474
1116 Ga0307412_10023591
1117 Ga0307412_10322685
1118 Ga0307409_100006158
1119 Ga0307409_101212384
1120 Ga0307416_100006323
1121 Ga0307416_100019230
1122 Ga0307416_100094758
1123 Ga0307416_100234222
1124 Ga0307416_101507476
1125 Ga0307416_101548703
1126 Ga0307414_10002418
1127 Ga0307414_10066128
1128 Ga0307414_10657651
1129 Ga0307411_10013961
1130 Ga0307411_10246897
1131 Ga0307411_10257396
1132 Ga0307411_10296829
1133 Ga0307411_11151590
1134 Ga0307411_11422952
1135 Ga0307415_100002119
1136 Ga0307415_100248838
1137 Ga0307415_100341623
1138 Ga0307415_100917773
1139 Ga0373939_0070419
1140 Ga0373941_0008186
1141 Ga0373960_0050360
1142 Ga0373943_0298881
1143 Ga0373931_0002419
1144 Ga0373931_0003331
1145 Ga0373935_0113102
1146 Ga0373927_0235053
1147 Ga0373927_0555400
1148 Ga0373947_0031684
1149 Ga0373947_0151929
1150 Ga0373937_0172219
1151 Ga0395905_0070393
1152 Ga0395905_0074264
1153 Ga0395901_0134549
1154 Ga0395901_0191485
1155 Ga0439436_0151688
1156 Ga0439433_0040025
1157 Ga0439441_009959
1158 Ga0439441_041268
1159 Ga0439448_0043738
1160 Ga0439450_013674
1161 Ga0439454_026810
1162 Ga0439462_0090967
1163 Ga0439463_052202
1164 Ga0439458_0029583
1165 Ga0439434_0025317
1166 Ga0439460_0121813
1167 Ga0451577_0000065
1168 Ga0451577_0004450
1169 Ga0451577_0675640
1170 Ga0453683_0000458
1171 Ga0453683_0007283
1172 Ga0453683_0049424
1173 Ga0453683_0075814
1174 Ga0453683_0248801
1175 Ga0453683_0273111
1176 Ga0453683_0592455
1177 Ga0453684_0000349
1178 Ga0453684_0000990
1179 Ga0453684_0020133
1180 Ga0453684_0044102
1181 Ga0453684_0093273
1182 Ga0453684_0151672
1183 Ga0453684_0803752
1184 Ga0453684_0926485
1185 Ga0453684_0961560
1186 Ga0451576_0000086
1187 Ga0451576_0040433
1188 Ga0451576_0111224
1189 Ga0451576_0255026
1190 Ga0451576_0315508
1191 Ga0451576_0392307
1192 Ga0451576_0727649
1193 Ga0451576_0878974
1194 Ga0495580_0009393
1195 Ga0495580_0013924
1196 Ga0495663_0022106
1197 Ga0495586_0534495
1198 Ga0495621_0030217
1199 Ga0495677_0095952
1200 Ga0496103_0308998
1201 Ga0496106_0494135
1202 Ga0496106_0713095
1203 Ga0496114_0170453
1204 Ga0501306_031805
1205 Ga0501291_032667
1206 Ga0501298_007242
1207 Ga0501317_004226
1208 Ga0501031_0116006
1209 Ga0501031_0124059
1210 Ga0501031_0374087
1211 Ga0501031_0555242
1212 Ga0501032_0359273
1213 Ga0501032_0533765
1214 Ga0501033_0018671
1215 Ga0501033_0109102
1216 Ga0501036_0022733
1217 Ga0501036_0067924
1218 Ga0501036_0199593
1219 Ga0501037_0048408
1220 Ga0501037_0109035
1221 Ga0501037_0236623
1222 Ga0501038_0002448
1223 Ga0501038_0219099
1224 Ga0501038_0368297
1225 Ga0501038_0711109
1226 Ga0501038_0736387
1227 Ga0501039_0002376
1228 Ga0501039_0227064
1229 Ga0501039_0633784
1230 Ga0501039_0662809
1231 Ga0501040_0001437
1232 Ga0501040_0018747
1233 Ga0501040_0027789
1234 Ga0501040_0035126
1235 Ga0501040_0061387
1236 Ga0501040_0127055
1237 Ga0501040_0190309
1238 Ga0501040_0413499
1239 Ga0501040_0578448
1240 Ga0501041_0003190
1241 Ga0501041_0016562
1242 Ga0501041_0045216
1243 Ga0501041_0156352
1244 Ga0501041_0246533
1245 Ga0501042_0000034
1246 Ga0501042_0010771
1247 Ga0501042_0085233
1248 Ga0501042_0087545
1249 Ga0501042_0103815
1250 Ga0501042_0309239
1251 Ga0501043_0012783
1252 Ga0501043_0047477
1253 Ga0501043_0168850
1254 Ga0501046_0013999
1255 Ga0501046_0018234
1256 Ga0501046_0061976
1257 Ga0501046_0089165
1258 Ga0501046_0337662
1259 Ga0501046_0394248
1260 Ga0501048_0007735
1261 Ga0501048_0098025
1262 Ga0501048_0129346
1263 Ga0501048_0473712
1264 Ga0501067_0030381
1265 Ga0501068_0003003
1266 Ga0501068_0013051
1267 Ga0501068_0049475
1268 Ga0501069_0013206
1269 Ga0501069_0076697
1270 Ga0501070_0873775
1271 Ga0501071_0005752
1272 Ga0501071_0093852
1273 Ga0501072_0000420
1274 Ga0501072_0010810
1275 Ga0501072_0022582
1276 Ga0501072_0029146
1277 Ga0501072_0055184
1278 Ga0501072_0106071
1279 Ga0501072_0564191
1280 Ga0501072_0577225
1281 Ga0501072_0577741
1282 Ga0501073_0165467
1283 Ga0501074_0044860
1284 Ga0501074_0069917
1285 Ga0501074_0154278
1286 Ga0501074_0431515
1287 Ga0501074_0486961
1288 Ga0501074_0666144
1289 Ga0501075_0000890
1290 Ga0501075_0004361
1291 Ga0501075_0009510
1292 Ga0501075_0162136
1293 Ga0501075_0249898
1294 Ga0501075_0517730
1295 Ga0501075_0534264
1296 Ga0501075_0701664
1297 Ga0501075_0816600
1298 Ga0501076_0013014
1299 Ga0501076_0018249
1300 Ga0501076_0052024
1301 Ga0501076_0094872
1302 Ga0501076_0102535
1303 Ga0501076_0296551
1304 Ga0501076_0885562
1305 Ga0501077_0000051
1306 Ga0501077_0008677
1307 Ga0501077_0020849
1308 Ga0501077_0041753
1309 Ga0501077_0084298
1310 Ga0501077_0225172
1311 Ga0501077_0341105
1312 Ga0501077_0461529
1313 Ga0501077_0531166
1314 Ga0501209_073198
1315 Ga0501216_004459
1316 Ga0501216_029192
1317 Ga0501217_050078
1318 Ga0501224_028854
1319 Ga0501239_024696
1320 Ga0501248_022588
1321 Ga0501249_008591
1322 Ga0501229_007095
1323 Ga0501079_0000789
1324 Ga0501079_0002538
1325 Ga0501079_0034063
1326 Ga0501079_0107547
1327 Ga0501079_0590662
1328 Ga0501080_0024386
1329 Ga0501080_0038156
1330 Ga0501080_0147655
1331 Ga0501080_0357846
1332 Ga0501080_0365798
1333 Ga0501080_0600397
1334 Ga0501081_0001354
1335 Ga0501081_0017585
1336 Ga0501081_0030175
1337 Ga0501081_0081370
1338 Ga0501081_0200643
1339 Ga0501081_0249577
1340 Ga0501081_0323041
1341 Ga0501081_0338711
1342 Ga0501081_0372655
1343 Ga0501081_0400852
1344 Ga0501081_0415722
1345 Ga0501081_0457180
1346 Ga0501081_0713300
1347 Ga0501081_0728331
1348 Ga0501081_0868919
1349 Ga0501083_0039342
1350 Ga0501083_0077668
1351 Ga0501266_018793
1352 Ga0501268_001945
1353 Ga0501035_0005209
1354 Ga0501035_0135509
1355 Ga0501035_0530647
1356 Ga0501045_0001265
1357 Ga0501045_0001879
1358 Ga0501045_0118902
1359 Ga0501045_0185785
1360 Ga0501045_0785334
1361 Ga0501204_008924
1362 nmdc:mga05p37_11166_c1
1363 nmdc:mga05p37_1621_c1
1364 nmdc:mga05p37_172216_c1
1365 nmdc:mga05p37_207131_c1
1366 nmdc:mga05p37_232981_c1
1367 nmdc:mga05p37_23640_c1
1368 nmdc:mga05p37_2688_c1
1369 nmdc:mga05p37_29491_c1
1370 nmdc:mga05p37_300908_c1
1371 nmdc:mga05p37_34876_c1
1372 nmdc:mga05p37_3775_c1
1373 nmdc:mga05p37_380598_c1
1374 nmdc:mga05p37_4041_c1
1375 nmdc:mga05p37_4419_c1
1376 nmdc:mga05p37_46750_c2
1377 nmdc:mga05p37_51631_c1
1378 nmdc:mga05p37_90946_c1
1379 nmdc:mga09592_1064693_c1
1380 nmdc:mga09592_1255894_c1
1381 nmdc:mga09592_12601_c1
1382 nmdc:mga09592_28999_c1
1383 nmdc:mga09592_34819_c1
1384 nmdc:mga09592_49658_c1
1385 nmdc:mga09592_5596_c1
1386 nmdc:mga09592_659578_c1
1387 nmdc:mga09592_725455_c1
1388 nmdc:mga09592_75832_c1
1389 nmdc:mga09592_9548_c1
1390 nmdc:mga0qj67_106695_c1
1391 nmdc:mga0qj67_24700_c1
1392 nmdc:mga0qj67_271854_c1
1393 nmdc:mga0qj67_319077_c1
1394 nmdc:mga0qj67_545963_c1
1395 nmdc:mga0qj67_681_c1
1396 nmdc:mga0qj67_79021_c1
1397 nmdc:mga0qj67_8216_c1
1398 nmdc:mga06r32_1002233_c1
1399 nmdc:mga06r32_12541_c2
1400 nmdc:mga06r32_194459_c1
1401 nmdc:mga06r32_2218_c1
1402 nmdc:mga06r32_223516_c1
1403 nmdc:mga06r32_252439_c1
1404 nmdc:mga06r32_255856_c1
1405 nmdc:mga06r32_28439_c1
1406 nmdc:mga06r32_3390_c1
1407 nmdc:mga06r32_38736_c1
1408 nmdc:mga06r32_700_c1
1409 nmdc:mga06r32_70173_c1
1410 nmdc:mga06r32_85726_c1
1411 nmdc:mga06r32_950_c1
1412 nmdc:mga08y16_207673_c1
1413 nmdc:mga08y16_563275_c1
1414 nmdc:mga08y16_62855_c1
1415 nmdc:mga08y16_832_c1
1416 nmdc:mga0n895_10072_c1
1417 nmdc:mga0n895_1080725_c1
1418 nmdc:mga0n895_12336_c1
1419 nmdc:mga0n895_13985_c1
1420 nmdc:mga0n895_180680_c1
1421 nmdc:mga0n895_251602_c1
1422 nmdc:mga0n895_269239_c1
1423 nmdc:mga0n895_384676_c1
1424 nmdc:mga0n895_413586_c1
1425 nmdc:mga0n895_47670_c1
1426 nmdc:mga0n895_4946_c1
1427 nmdc:mga0n895_508041_c1
1428 nmdc:mga0n895_657_c1
1429 nmdc:mga0n895_909651_c1
1430 nmdc:mga0rr50_121326_c1
1431 nmdc:mga0rr50_12615_c1
1432 nmdc:mga0rr50_194788_c1
1433 nmdc:mga0rr50_262165_c1
1434 nmdc:mga0rr50_33351_c1
1435 nmdc:mga0rr50_571837_c1
1436 nmdc:mga0rr50_888205_c1
1437 nmdc:mga0rr50_91130_c1
1438 nmdc:mga08x19_18303_c1
1439 nmdc:mga08x19_189220_c1
1440 nmdc:mga08x19_23974_c1
1441 nmdc:mga08x19_241700_c1
1442 nmdc:mga08x19_28438_c1
1443 nmdc:mga08x19_409494_c1
1444 nmdc:mga08x19_6035_c1
1445 nmdc:mga0a205_106761_c1
1446 nmdc:mga0a205_11033_c1
1447 nmdc:mga0a205_268281_c1
1448 nmdc:mga0a205_28590_c1
1449 nmdc:mga0a205_356246_c1
1450 nmdc:mga0a205_357725_c1
1451 nmdc:mga0a205_3660_c1
1452 nmdc:mga0a205_435544_c1
1453 nmdc:mga0a205_45005_c1
1454 nmdc:mga0a205_47449_c1
1455 nmdc:mga0a205_54611_c1
1456 nmdc:mga0a205_658643_c1
1457 nmdc:mga0a205_86141_c1
1458 nmdc:mga0a205_91617_c1
1459 nmdc:mga0a205_92443_c1
1460 nmdc:mga0a205_92659_c2
1461 nmdc:mga0a205_977781_c1
1462 Ga0501084_0007634
1463 Ga0501084_0026044
1464 Ga0501084_0046314
1465 Ga0501084_0181733
1466 Ga0501084_0339345
1467 Ga0501084_0707717
1468 Ga0590071_005737
1469 Ga0590071_039993
1470 Ga0590075_021884
1471 Ga0590075_032551
1472 Ga0590077_016082
1473 Ga0501082_0005141
1474 Ga0501082_0031566
1475 Ga0501082_0050329
1476 Ga0501082_0071412
1477 Ga0501082_0120661
1478 Ga0501082_0173848
1479 Ga0501082_0196778
1480 Ga0501082_0240162
1481 Ga0501082_0539591
1482 Ga0501082_0631788
1483 Ga0501082_0762254
1484 Ga0530510_0000802
1485 Ga0530510_0010756
1486 Ga0530510_0118182
1487 Ga0530510_0150648
1488 Ga0530510_0365896
1489 Ga0530510_0540463
1490 Ga0530510_0683499
1491 Ga0530510_0788519
1492 2881103859

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04879

Molybdop_Fe4S4

Molybdopterin oxidoreductase Fe4S4 domain

76

130

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ldx-assembly1.cif.gz_G structure of mammalian respiratory complex i, class3. 0.8269 45 77
5luf-assembly1.cif.gz_G cryo-em of bovine respirasome 0.7348 44 76
6q20-assembly1.cif.gz_A crystal structure of human 1e01 fab in complex with influenza virus neuraminidase from a/japan/305/1957 (h2n2) 0.681 45 74
8p2a-assembly1.cif.gz_A crystal structure of safmn3 domain 2 0.6678 46 76
1xew-assembly1.cif.gz_Y structural biochemistry of atp-driven dimerization and dna stimulated activation of smc atpases. 0.6671 99 135
ID Description Score Start End Superfamily
2iv2X01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8783 47 91 2.20.25.90
af_Q2FY41_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8091 59 77 2.40.50.140
af_Q2FVV9_257_311_2.20.25.90 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.8065 47 91 2.20.25.90
af_L0T2Z1_2_58_2.20.25.90 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.7924 47 94 2.20.25.90
2v45A01 Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains 0.7877 47 99 2.20.25.90
ID Description Score Start End GO Terms
AF-A0A2U8DUU9-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.7452 46 111 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A7W1LZ31-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.7215 46 112 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A7Y3GVU8-F1-model_v4 Molybdopterin oxidoreductase family protein 0.7036 45 114 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539
AF-A0A7W1LZ31-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.7026 46 112 GO:0016491
GO:0030313
GO:0046872
GO:0051539
AF-A0A7V5E8S1-F1-model_v4 4Fe-4S Mo/W bis-MGD-type domain-containing protein 0.7024 46 114 GO:0016491
GO:0030313
GO:0046872
GO:0051539

Map