F478862

General Info

Members Datasets Scaffolds Average Seq Length
746 338 1492 133

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10230874|Ga0157370_102308742
Length 146
Sequence LKELVIIRLAEGIRMLSRIFRTTEVSAHCDLPCGVYDPAQARIEAESIKAIIAKVADNDHPDFRTRAIVIKEQRSELVKHHLWVLWTDYFKPPHFEKYPQLHTLVNEATKLAGASGTKGELDAAKADELLAKIDEIAEIFWETKKA

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
87 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
88 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
164 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
165 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
168 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
193 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
194 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
195 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
198 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
201 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
202 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
203 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
274 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
275 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
276 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
296 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
297 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
324 2643221561 Nocardioides sp. Root151 Isolate Unclassified
325 2643221604 Nocardioides sp. Root190 Isolate Unclassified
326 2643221615 Nocardioides sp. Root224 Isolate Unclassified
327 2643221617 Nocardioides sp. Root79 Isolate Unclassified
328 2643221620 Nocardioides sp. Root240 Isolate Unclassified
329 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
330 2643221679 Angustibacter sp. Root456 Isolate Unclassified
331 2643221696 Nocardioides sp. Root140 Isolate Unclassified
332 2738541305 Nocardioides sp. CF167 Isolate Unclassified
333 2739367898 Nocardioides sp. CF479 Isolate Unclassified
334 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
335 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
336 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
337 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
338 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.62
Metatranscriptomes 7.1
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0
Endosphere 8.98
Nodule 0.13
Rhizoplane 9.12
Rhizosphere 78.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10230874 3300013104 Bacteria 1713
2 LJQas_1020289 3300000549 Bacteria 773
3 JGI24740J21852_10101825 3300001979 Bacteria 730
4 JGI24740J21852_10173194 3300001979 Bacteria 535
5 JGI24743J22301_10005496 3300001991 Bacteria 2119
6 JGI24735J21928_10002795 3300002067 Bacteria 6023
7 JGI24735J21928_10113378 3300002067 Bacteria 780
8 JGI24745J21846_1039873 3300002073 Bacteria 580
9 JGI24738J21930_10001988 3300002075 Bacteria 5494
10 JGI24738J21930_10079012 3300002075 Bacteria 687
11 JGI24744J21845_10004441 3300002077 Bacteria 2899
12 JGI24033J26618_1032824 3300002155 Bacteria 703
13 JGI24033J26618_1034548 3300002155 Bacteria 689
14 JGI24742J22300_10057329 3300002244 Bacteria 712
15 Ga0058863_11896839 3300004799 Bacteria 585
16 Ga0058863_11929540 3300004799 Bacteria 534
17 Ga0058861_11972693 3300004800 Bacteria 770
18 Ga0058862_12866861 3300004803 Bacteria 616
19 Ga0070658_10657144 3300005327 Bacteria 909
20 Ga0070658_10933335 3300005327 Bacteria 755
21 Ga0070683_100018860 3300005329 Bacteria 6121
22 Ga0070683_100026889 3300005329 Bacteria 5186
23 Ga0070683_100036698 3300005329 Bacteria 4486
24 Ga0070683_100289884 3300005329 Bacteria 1557
25 Ga0070683_100295501 3300005329 Bacteria 1541
26 Ga0070683_100502654 3300005329 Bacteria 1158
27 Ga0070683_101297708 3300005329 Bacteria 700
28 Ga0070683_101690397 3300005329 Bacteria 609
29 Ga0070670_100255569 3300005331 Bacteria 1527
30 Ga0068869_100287126 3300005334 Bacteria 1325
31 Ga0068869_100725058 3300005334 Bacteria 849
32 Ga0070666_10388229 3300005335 Bacteria 1003
33 Ga0070682_100005510 3300005337 Bacteria 7045
34 Ga0070682_100161079 3300005337 Bacteria 1549
35 Ga0070682_100250925 3300005337 Bacteria 1275
36 Ga0070682_100323635 3300005337 Bacteria 1140
37 Ga0070682_100356227 3300005337 Bacteria 1093
38 Ga0070682_100658378 3300005337 Bacteria 835
39 Ga0068868_100059347 3300005338 Bacteria 3026
40 Ga0068868_100273477 3300005338 Bacteria 1428
41 Ga0068868_100505120 3300005338 Bacteria 1060
42 Ga0070660_100029719 3300005339 Bacteria 4098
43 Ga0070689_100162830 3300005340 Bacteria 1804
44 Ga0070689_101215962 3300005340 Bacteria 677
45 Ga0070661_100509954 3300005344 Bacteria 964
46 Ga0070668_100284144 3300005347 Bacteria 1383
47 Ga0070668_101174869 3300005347 Bacteria 695
48 Ga0070669_100117855 3300005353 Bacteria 2022
49 Ga0070675_100105688 3300005354 Bacteria 2376
50 Ga0070675_100992909 3300005354 Bacteria 771
51 Ga0070675_101852025 3300005354 Bacteria 557
52 Ga0070674_100226288 3300005356 Bacteria 1458
53 Ga0070674_100742570 3300005356 Bacteria 843
54 Ga0070674_100769870 3300005356 Bacteria 829
55 Ga0070673_100071410 3300005364 Bacteria 2789
56 Ga0070673_100580385 3300005364 Bacteria 1021
57 Ga0070659_100115181 3300005366 Bacteria 2172
58 Ga0070659_101390880 3300005366 Bacteria 624
59 Ga0070667_100176567 3300005367 Bacteria 1888
60 Ga0070667_101284641 3300005367 Bacteria 686
61 Ga0070701_10112907 3300005438 Bacteria 1521
62 Ga0070701_10199231 3300005438 Bacteria 1182
63 Ga0070705_100011684 3300005440 Bacteria 4439
64 Ga0070700_100002030 3300005441 Bacteria 10286
65 Ga0070700_100067475 3300005441 Bacteria 2272
66 Ga0070663_100529011 3300005455 Bacteria 983
67 Ga0070663_100757312 3300005455 Bacteria 830
68 Ga0070663_101768414 3300005455 Bacteria 554
69 Ga0070678_100203448 3300005456 Bacteria 1636
70 Ga0070678_101316115 3300005456 Bacteria 673
71 Ga0068867_100045040 3300005459 Bacteria 3233
72 Ga0070685_10905615 3300005466 Bacteria 657
73 Ga0070707_100249991 3300005468 Bacteria 1725
74 Ga0070698_100007249 3300005471 Bacteria 12011
75 Ga0070679_100037607 3300005530 Bacteria 4810
76 Ga0070684_100010736 3300005535 Bacteria 7270
77 Ga0070684_100037528 3300005535 Bacteria 4157
78 Ga0070684_100242291 3300005535 Bacteria 1648
79 Ga0070684_100709929 3300005535 Bacteria 938
80 Ga0070684_100732020 3300005535 Bacteria 923
81 Ga0070672_100002294 3300005543 Bacteria 12066
82 Ga0070686_100077185 3300005544 Bacteria 2196
83 Ga0070696_100272392 3300005546 Bacteria 1288
84 Ga0070693_100021942 3300005547 Bacteria 3389
85 Ga0070693_100142660 3300005547 Bacteria 1509
86 Ga0070665_100000877 3300005548 Bacteria 38753
87 Ga0070665_100191194 3300005548 Bacteria 2048
88 Ga0070665_101572533 3300005548 Bacteria 666
89 Ga0068855_100745400 3300005563 Bacteria 1045
90 Ga0068855_101778776 3300005563 Bacteria 627
91 Ga0070664_100573858 3300005564 Bacteria 1045
92 Ga0070664_101473545 3300005564 Bacteria 644
93 Ga0068857_100013196 3300005577 Bacteria 7200
94 Ga0068857_101510683 3300005577 Bacteria 655
95 Ga0068854_100024098 3300005578 Bacteria 4163
96 Ga0068854_102042875 3300005578 Bacteria 529
97 Ga0068856_100143587 3300005614 Bacteria 2395
98 Ga0068856_100491883 3300005614 Bacteria 1247
99 Ga0068856_101346579 3300005614 Bacteria 729
100 Ga0068852_100020037 3300005616 Bacteria 5311
101 Ga0068852_100229088 3300005616 Bacteria 1770
102 Ga0068852_100462633 3300005616 Bacteria 1258
103 Ga0068852_102006963 3300005616 Bacteria 601
104 Ga0068852_102026676 3300005616 Bacteria 598
105 Ga0068864_100107866 3300005618 Bacteria 2477
106 Ga0068864_100162370 3300005618 Bacteria 2031
107 Ga0068864_100690214 3300005618 Bacteria 997
108 Ga0068866_10022387 3300005718 Bacteria 2925
109 Ga0068866_10072327 3300005718 Bacteria 1826
110 Ga0068866_10128477 3300005718 Bacteria 1438
111 Ga0068866_10135225 3300005718 Bacteria 1408
112 Ga0068861_100113306 3300005719 Bacteria 2176
113 Ga0068861_100857248 3300005719 Bacteria 857
114 Ga0068861_100910411 3300005719 Bacteria 834
115 Ga0068861_101383284 3300005719 Bacteria 687
116 Ga0068870_10001361 3300005840 Bacteria 9856
117 Ga0068870_10236945 3300005840 Bacteria 1125
118 Ga0068870_10327225 3300005840 Bacteria 976
119 Ga0068858_100036515 3300005842 Bacteria 4556
120 Ga0068858_100358859 3300005842 Bacteria 1397
121 Ga0068860_100000301 3300005843 Bacteria 68703
122 Ga0068860_102139410 3300005843 Bacteria 581
123 Ga0068862_100536140 3300005844 Bacteria 1116
124 Ga0068862_102045844 3300005844 Bacteria 584
125 Ga0081455_10428324 3300005937 Bacteria 910
126 Ga0081539_10336780 3300005985 Bacteria 637
127 Ga0075365_10003466 3300006038 Bacteria 8134
128 Ga0075365_10008946 3300006038 Bacteria 5722
129 Ga0075365_10012149 3300006038 Bacteria 5099
130 Ga0075365_10044427 3300006038 Bacteria 2911
131 Ga0075365_10065083 3300006038 Bacteria 2443
132 Ga0075365_10077992 3300006038 Bacteria 2239
133 Ga0075365_10084250 3300006038 Bacteria 2157
134 Ga0075365_10189353 3300006038 Bacteria 1440
135 Ga0075368_10078931 3300006042 Bacteria 1337
136 Ga0075363_100015504 3300006048 Bacteria 3748
137 Ga0075363_100022891 3300006048 Bacteria 3162
138 Ga0075363_100152196 3300006048 Bacteria 1306
139 Ga0075363_100264566 3300006048 Bacteria 992
140 Ga0075363_100615519 3300006048 Bacteria 651
141 Ga0075364_10129396 3300006051 Bacteria 1694
142 Ga0075364_10183507 3300006051 Bacteria 1416
143 Ga0075364_10216073 3300006051 Bacteria 1300
144 Ga0075364_10315947 3300006051 Bacteria 1064
145 Ga0075364_10362364 3300006051 Bacteria 988
146 Ga0075362_10005527 3300006177 Bacteria 4633
147 Ga0075362_10114798 3300006177 Bacteria 1270
148 Ga0075362_10215211 3300006177 Bacteria 938
149 Ga0075367_10059592 3300006178 Bacteria 2273
150 Ga0075367_10105542 3300006178 Bacteria 1725
151 Ga0075367_10447630 3300006178 Bacteria 818
152 Ga0075366_10898808 3300006195 Bacteria 552
153 Ga0097621_100284746 3300006237 Bacteria 1456
154 Ga0097621_100834390 3300006237 Bacteria 855
155 Ga0075370_10006873 3300006353 Bacteria 5756
156 Ga0075370_10139568 3300006353 Bacteria 1416
157 Ga0075370_10356145 3300006353 Bacteria 875
158 Ga0075370_10360225 3300006353 Bacteria 869
159 Ga0075370_10637540 3300006353 Bacteria 646
160 Ga0068871_100332734 3300006358 Bacteria 1340
161 Ga0068865_100205441 3300006881 Bacteria 1532
162 Ga0068865_100254338 3300006881 Bacteria 1388
163 Ga0068865_100300870 3300006881 Bacteria 1284
164 Ga0068865_100425535 3300006881 Bacteria 1093
165 Ga0068865_101128579 3300006881 Bacteria 691
166 Ga0075435_100739443 3300007076 Bacteria 856
167 Ga0111539_10156430 3300009094 Bacteria 2667
168 Ga0111539_10363998 3300009094 Bacteria 1683
169 Ga0111539_10827757 3300009094 Bacteria 1077
170 Ga0105245_10048719 3300009098 Bacteria 3791
171 Ga0105245_10379999 3300009098 Bacteria 1406
172 Ga0105245_11931000 3300009098 Bacteria 643
173 Ga0105247_10359134 3300009101 Bacteria 1027
174 Ga0105243_10013478 3300009148 Bacteria 6183
175 Ga0105243_10040099 3300009148 Bacteria 3655
176 Ga0105243_10048180 3300009148 Bacteria 3358
177 Ga0105243_10312206 3300009148 Bacteria 1429
178 Ga0105243_10329976 3300009148 Bacteria 1393
179 Ga0105243_10442848 3300009148 Bacteria 1217
180 Ga0105243_11303401 3300009148 Bacteria 743
181 Ga0105241_10496897 3300009174 Bacteria 1087
182 Ga0105241_11005729 3300009174 Bacteria 780
183 Ga0105242_10145880 3300009176 Bacteria 2059
184 Ga0105242_10442577 3300009176 Bacteria 1223
185 Ga0105242_10616313 3300009176 Bacteria 1050
186 Ga0105248_10036933 3300009177 Bacteria 5464
187 Ga0105248_10037756 3300009177 Bacteria 5405
188 Ga0105237_10176632 3300009545 Bacteria 2136
189 Ga0105237_11070037 3300009545 Bacteria 813
190 Ga0105238_10053478 3300009551 Bacteria 4057
191 Ga0105238_10233124 3300009551 Bacteria 1817
192 Ga0105238_11450858 3300009551 Bacteria 714
193 Ga0105249_10049526 3300009553 Bacteria 3831
194 Ga0105249_10088808 3300009553 Bacteria 2887
195 Ga0105249_10936973 3300009553 Bacteria 934
196 Ga0105249_11042222 3300009553 Bacteria 887
197 Ga0105249_12106143 3300009553 Bacteria 637
198 Ga0105239_10047792 3300010375 Bacteria 4690
199 Ga0105239_10423831 3300010375 Bacteria 1508
200 Ga0105239_10509039 3300010375 Bacteria 1369
201 Ga0105246_10005742 3300011119 Bacteria 7574
202 Ga0105246_10295357 3300011119 Bacteria 1306
203 Ga0105246_11055070 3300011119 Bacteria 739
204 Ga0157321_1019385 3300012487 Bacteria 610
205 Ga0157329_1004607 3300012491 Bacteria 900
206 Ga0157338_1028125 3300012515 Bacteria 701
207 Ga0157371_10225848 3300013102 Bacteria 1345
208 Ga0157371_10500741 3300013102 Bacteria 897
209 Ga0157371_11144917 3300013102 Bacteria 598
210 Ga0157369_10594257 3300013105 Bacteria 1143
211 Ga0157369_10686482 3300013105 Bacteria 1055
212 Ga0157378_10039562 3300013297 Bacteria 4182
213 Ga0157378_10173702 3300013297 Bacteria 2023
214 Ga0157378_11630945 3300013297 Bacteria 691
215 Ga0163162_10083818 3300013306 Bacteria 3262
216 Ga0163162_10484926 3300013306 Bacteria 1367
217 Ga0163162_11360277 3300013306 Bacteria 807
218 Ga0163162_11897315 3300013306 Bacteria 682
219 Ga0157372_10036207 3300013307 Bacteria 5439
220 Ga0157372_10351120 3300013307 Bacteria 1718
221 Ga0157372_10533554 3300013307 Bacteria 1368
222 Ga0157372_10569236 3300013307 Bacteria 1321
223 Ga0157372_10853496 3300013307 Bacteria 1057
224 Ga0157372_11833845 3300013307 Bacteria 697
225 Ga0157372_12475312 3300013307 Bacteria 596
226 Ga0157375_10082103 3300013308 Bacteria 3264
227 Ga0157375_10091362 3300013308 Bacteria 3106
228 Ga0157375_11564194 3300013308 Bacteria 779
229 Ga0163163_10008911 3300014325 Bacteria 8937
230 Ga0163163_10141023 3300014325 Bacteria 2452
231 Ga0163163_12234536 3300014325 Bacteria 606
232 Ga0157380_10001167 3300014326 Bacteria 17023
233 Ga0157380_10027489 3300014326 Bacteria 4326
234 Ga0157380_10085056 3300014326 Bacteria 2595
235 Ga0157380_10724494 3300014326 Bacteria 1003
236 Ga0157380_10965333 3300014326 Bacteria 883
237 Ga0182008_10081035 3300014497 Bacteria 1597
238 Ga0182008_10245820 3300014497 Bacteria 922
239 Ga0157379_10062503 3300014968 Bacteria 3330
240 Ga0157379_11730857 3300014968 Bacteria 613
241 Ga0157376_11184050 3300014969 Bacteria 792
242 Ga0182007_10342040 3300015262 Bacteria 560
243 Ga0182005_1240250 3300015265 Bacteria 557
244 Ga0163161_10019285 3300017792 Bacteria 4783
245 Ga0163161_10037252 3300017792 Bacteria 3486
246 Ga0197907_10056086 3300020069 Bacteria 545
247 Ga0197907_10244688 3300020069 Bacteria 757
248 Ga0197907_10620040 3300020069 Bacteria 514
249 Ga0206356_10679922 3300020070 Bacteria 742
250 Ga0206349_1252062 3300020075 Bacteria 999
251 Ga0206349_1378472 3300020075 Bacteria 504
252 Ga0206355_1079244 3300020076 Bacteria 627
253 Ga0206355_1568330 3300020076 Bacteria 601
254 Ga0206351_10988822 3300020077 Bacteria 578
255 Ga0206352_10183314 3300020078 Bacteria 889
256 Ga0206352_11003452 3300020078 Bacteria 600
257 Ga0206352_11276507 3300020078 Bacteria 515
258 Ga0206354_10645953 3300020081 Bacteria 654
259 Ga0206354_11268698 3300020081 Bacteria 698
260 Ga0206354_11398516 3300020081 Bacteria 699
261 Ga0206354_11439178 3300020081 Bacteria 642
262 Ga0206354_11505572 3300020081 Bacteria 1703
263 Ga0206353_10446549 3300020082 Bacteria 1344
264 Ga0206353_11236499 3300020082 Bacteria 918
265 Ga0206353_11966952 3300020082 Bacteria 1256
266 Ga0213876_10611574 3300021384 Bacteria 580
267 Ga0224712_10407212 3300022467 Bacteria 649
268 Ga0224712_10442318 3300022467 Bacteria 623
269 Ga0224712_10687091 3300022467 Bacteria 503
270 Ga0207697_10469029 3300025315 Bacteria 557
271 Ga0207656_10318721 3300025321 Bacteria 772
272 Ga0207642_10251383 3300025899 Bacteria 1003
273 Ga0207642_10492043 3300025899 Bacteria 749
274 Ga0207688_10015355 3300025901 Bacteria 4154
275 Ga0207688_10072435 3300025901 Bacteria 1957
276 Ga0207688_10197947 3300025901 Bacteria 1204
277 Ga0207688_10286793 3300025901 Bacteria 1004
278 Ga0207647_10274450 3300025904 Bacteria 963
279 Ga0207643_10000778 3300025908 Bacteria 19442
280 Ga0207643_10013077 3300025908 Bacteria 4488
281 Ga0207643_10118746 3300025908 Bacteria 1564
282 Ga0207643_10786684 3300025908 Bacteria 616
283 Ga0207705_10344999 3300025909 Bacteria 1146
284 Ga0207705_10734229 3300025909 Bacteria 767
285 Ga0207654_11221145 3300025911 Bacteria 548
286 Ga0207707_10516377 3300025912 Bacteria 1018
287 Ga0207671_10537106 3300025914 Bacteria 932
288 Ga0207671_10902846 3300025914 Bacteria 698
289 Ga0207660_10265553 3300025917 Bacteria 1358
290 Ga0207657_10070914 3300025919 Bacteria 2952
291 Ga0207657_10158895 3300025919 Bacteria 1837
292 Ga0207657_10750551 3300025919 Bacteria 756
293 Ga0207652_10005068 3300025921 Bacteria 10688
294 Ga0207652_11660820 3300025921 Bacteria 543
295 Ga0207681_10295226 3300025923 Bacteria 1281
296 Ga0207694_10109311 3300025924 Bacteria 2198
297 Ga0207694_10397070 3300025924 Bacteria 1146
298 Ga0207694_10623599 3300025924 Bacteria 907
299 Ga0207650_10701305 3300025925 Bacteria 855
300 Ga0207659_10082150 3300025926 Bacteria 2385
301 Ga0207659_11803663 3300025926 Bacteria 520
302 Ga0207687_10040893 3300025927 Bacteria 3180
303 Ga0207687_10089742 3300025927 Bacteria 2239
304 Ga0207687_10106507 3300025927 Bacteria 2073
305 Ga0207690_10064848 3300025932 Bacteria 2496
306 Ga0207690_10382817 3300025932 Bacteria 1118
307 Ga0207686_10156361 3300025934 Bacteria 1593
308 Ga0207709_10026257 3300025935 Bacteria 3343
309 Ga0207709_10055484 3300025935 Bacteria 2448
310 Ga0207709_10059081 3300025935 Bacteria 2386
311 Ga0207709_10377564 3300025935 Bacteria 1078
312 Ga0207709_10658695 3300025935 Bacteria 834
313 Ga0207669_10262505 3300025937 Bacteria 1292
314 Ga0207669_11246656 3300025937 Bacteria 631
315 Ga0207704_10022323 3300025938 Bacteria 3389
316 Ga0207704_10026695 3300025938 Bacteria 3172
317 Ga0207691_10002791 3300025940 Bacteria 17029
318 Ga0207691_10427708 3300025940 Bacteria 1128
319 Ga0207691_10951644 3300025940 Bacteria 718
320 Ga0207711_10272225 3300025941 Bacteria 1558
321 Ga0207689_10173353 3300025942 Bacteria 1778
322 Ga0207661_10030989 3300025944 Bacteria 4125
323 Ga0207661_10096113 3300025944 Bacteria 2478
324 Ga0207661_10114304 3300025944 Bacteria 2288
325 Ga0207661_10115388 3300025944 Bacteria 2278
326 Ga0207679_10775163 3300025945 Bacteria 873
327 Ga0207667_10794831 3300025949 Bacteria 943
328 Ga0207712_11413925 3300025961 Bacteria 622
329 Ga0207668_10540433 3300025972 Bacteria 1008
330 Ga0207668_11480506 3300025972 Bacteria 612
331 Ga0207640_10081567 3300025981 Bacteria 2212
332 Ga0207658_10091600 3300025986 Bacteria 2359
333 Ga0207658_10734253 3300025986 Bacteria 894
334 Ga0207677_10212648 3300026023 Bacteria 1545
335 Ga0207677_11350642 3300026023 Bacteria 655
336 Ga0207677_11629952 3300026023 Bacteria 597
337 Ga0207639_10371271 3300026041 Bacteria 1282
338 Ga0207678_10239150 3300026067 Bacteria 1555
339 Ga0207708_10001770 3300026075 Bacteria 15960
340 Ga0207708_10042833 3300026075 Bacteria 3450
341 Ga0207708_10217092 3300026075 Bacteria 1531
342 Ga0207702_10616373 3300026078 Bacteria 1065
343 Ga0207648_10007609 3300026089 Bacteria 10619
344 Ga0207648_10720819 3300026089 Bacteria 925
345 Ga0207648_11940245 3300026089 Bacteria 550
346 Ga0207676_10085276 3300026095 Bacteria 2577
347 Ga0207674_10027535 3300026116 Bacteria 6011
348 Ga0207674_10957742 3300026116 Bacteria 824
349 Ga0207675_100190534 3300026118 Bacteria 1967
350 Ga0207675_100735893 3300026118 Bacteria 997
351 Ga0207675_101371527 3300026118 Bacteria 728
352 Ga0207683_10032144 3300026121 Bacteria 4557
353 Ga0207683_10054927 3300026121 Bacteria 3492
354 Ga0207698_10018852 3300026142 Bacteria 4712
355 Ga0207698_10020726 3300026142 Bacteria 4531
356 Ga0207698_11332284 3300026142 Bacteria 733
357 Ga0209983_1105397 3300027665 Bacteria 639
358 Ga0209813_10000742 3300027866 Bacteria 7430
359 Ga0209813_10018740 3300027866 Bacteria 1916
360 Ga0209813_10291899 3300027866 Bacteria 631
361 Ga0209974_10062941 3300027876 Bacteria 1257
362 Ga0207428_10574259 3300027907 Bacteria 814
363 Ga0268266_10000947 3300028379 Bacteria 36968
364 Ga0268264_10000269 3300028381 Bacteria 91321
365 Ga0268264_11773337 3300028381 Bacteria 627
366 Ga0314311_1153184 3300030733 Bacteria 722
367 Ga0316183_1040990 3300030742 Bacteria 598
368 Ga0316181_1256185 3300030744 Bacteria 585
369 Ga0307408_101004360 3300031548 Bacteria 769
370 Ga0307408_101649149 3300031548 Bacteria 610
371 Ga0307408_102016963 3300031548 Bacteria 555
372 Ga0307408_102129668 3300031548 Bacteria 541
373 Ga0307408_102209368 3300031548 Bacteria 532
374 Ga0316576_10421113 3300031727 Bacteria 988
375 Ga0316578_10524243 3300031728 Bacteria 697
376 Ga0307405_10205373 3300031731 Bacteria 1434
377 Ga0307405_12111062 3300031731 Bacteria 506
378 Ga0307413_10324864 3300031824 Bacteria 1177
379 Ga0307413_11065420 3300031824 Bacteria 696
380 Ga0307410_10018619 3300031852 Bacteria 4201
381 Ga0307410_10358603 3300031852 Bacteria 1167
382 Ga0307410_10389589 3300031852 Bacteria 1123
383 Ga0307406_10043969 3300031901 Bacteria 2797
384 Ga0307406_10440260 3300031901 Bacteria 1043
385 Ga0307406_11281504 3300031901 Bacteria 639
386 Ga0307407_10027674 3300031903 Bacteria 3021
387 Ga0307407_11396499 3300031903 Bacteria 551
388 Ga0307412_10125779 3300031911 Bacteria 1854
389 Ga0307412_10142228 3300031911 Bacteria 1759
390 Ga0307409_100016688 3300031995 Bacteria 4868
391 Ga0307409_100143913 3300031995 Bacteria 2058
392 Ga0307409_100178300 3300031995 Bacteria 1878
393 Ga0307409_100503955 3300031995 Bacteria 1179
394 Ga0307416_100033220 3300032002 Bacteria 3909
395 Ga0307416_100076071 3300032002 Bacteria 2812
396 Ga0307416_100267284 3300032002 Bacteria 1676
397 Ga0307416_100867409 3300032002 Bacteria 1001
398 Ga0307416_101244781 3300032002 Bacteria 850
399 Ga0307414_10096868 3300032004 Bacteria 2209
400 Ga0307414_10165423 3300032004 Bacteria 1762
401 Ga0307414_10373188 3300032004 Bacteria 1231
402 Ga0307414_11481559 3300032004 Bacteria 631
403 Ga0307411_10998348 3300032005 Bacteria 749
404 Ga0307415_100001157 3300032126 Bacteria 12349
405 Ga0307415_100109628 3300032126 Bacteria 2045
406 Ga0307415_100126543 3300032126 Bacteria 1927
407 Ga0307415_101039204 3300032126 Bacteria 764
408 Ga0307415_101151381 3300032126 Bacteria 728
409 Ga0373958_0183816 3300034819 Bacteria 540
410 Ga0316584_0480293 3300036712 Bacteria 875
411 Ga0395899_0084830 3300037312 Bacteria 2302
412 Ga0395899_0431846 3300037312 Bacteria 866
413 Ga0395900_0144564 3300037418 Bacteria 2433
414 Ga0395900_0289034 3300037418 Bacteria 1628
415 Ga0395898_0008300 3300037466 Bacteria 10980
416 Ga0395898_0711768 3300037466 Bacteria 946
417 Ga0436364_1134014 3300037853 Bacteria 2286
418 Ga0395901_0048226 3300038443 Bacteria 4423
419 Ga0395901_0392618 3300038443 Bacteria 1426
420 Ga0395901_0955111 3300038443 Bacteria 836
421 Ga0436365_0571723 3300039437 Bacteria 3518
422 Ga0436365_1006813 3300039437 Bacteria 1287
423 Ga0436365_1822162 3300039437 Bacteria 2297
424 Ga0436361_0450335 3300039447 Bacteria 571
425 Ga0439438_076010 3300041405 Bacteria 827
426 Ga0439465_0022610 3300041413 Bacteria 1976
427 Ga0451789_0914727 3300041443 Bacteria 648
428 Ga0451797_0009395 3300041453 Bacteria 708
429 Ga0451797_0331062 3300041453 Bacteria 826
430 Ga0451797_0511918 3300041453 Bacteria 520
431 Ga0451798_0372281 3300041458 Bacteria 626
432 Ga0451802_1652602 3300041460 Bacteria 915
433 Ga0451806_221579 3300041462 Bacteria 975
434 Ga0451807_1160485 3300041486 Bacteria 552
435 Ga0451851_0454981 3300041507 Bacteria 665
436 Ga0451855_2056453 3300041511 Bacteria 797
437 Ga0451853_0191011 3300041512 Bacteria 1768
438 Ga0439431_0003912 3300041997 Bacteria 3285
439 Ga0439433_0075789 3300041999 Bacteria 814
440 Ga0439442_105199 3300042002 Bacteria 613
441 Ga0439445_0006632 3300042004 Bacteria 2665
442 Ga0439448_0288351 3300042005 Bacteria 582
443 Ga0439458_0066654 3300042157 Bacteria 905
444 Ga0439434_0000865 3300042435 Bacteria 8713
445 Ga0466969_0031989 3300044656 Bacteria 2676
446 Ga0466972_0108498 3300044658 Bacteria 1312
447 Ga0466965_0016178 3300044683 Bacteria 3546
448 Ga0466966_0313032 3300044684 Bacteria 943
449 Ga0466966_0802413 3300044684 Bacteria 567
450 Ga0466961_0029506 3300044693 Bacteria 3525
451 Ga0466961_0074522 3300044693 Bacteria 2152
452 Ga0466961_0620583 3300044693 Bacteria 649
453 Ga0466963_0019903 3300044694 Bacteria 4216
454 Ga0466963_0084046 3300044694 Bacteria 2159
455 Ga0466963_0093242 3300044694 Bacteria 2053
456 Ga0466963_0175366 3300044694 Bacteria 1495
457 Ga0466964_0013813 3300044706 Bacteria 3066
458 Ga0466964_0023975 3300044706 Bacteria 2375
459 Ga0466964_0212205 3300044706 Bacteria 936
460 Ga0466971_0037930 3300044719 Bacteria 2161
461 Ga0466971_0313446 3300044719 Bacteria 755
462 Ga0466971_0356459 3300044719 Bacteria 708
463 Ga0466970_0002635 3300044765 Bacteria 8654
464 Ga0466970_0017227 3300044765 Bacteria 3731
465 Ga0466970_0087397 3300044765 Bacteria 1690
466 Ga0466970_0093050 3300044765 Bacteria 1637
467 Ga0466970_0473618 3300044765 Bacteria 719
468 Ga0466957_0069625 3300044842 Bacteria 2173
469 Ga0466957_0149675 3300044842 Bacteria 1508
470 Ga0466957_0614228 3300044842 Bacteria 762
471 Ga0466960_0008036 3300044901 Bacteria 4307
472 Ga0466960_0015741 3300044901 Bacteria 3267
473 Ga0466960_0126124 3300044901 Bacteria 1346
474 Ga0466960_0270710 3300044901 Bacteria 949
475 Ga0466959_0054179 3300045049 Bacteria 2931
476 Ga0466959_0275070 3300045049 Bacteria 1157
477 Ga0466959_0513393 3300045049 Bacteria 809
478 Ga0451576_0827144 3300045051 Bacteria 972
479 Ga0466958_0031701 3300045836 Bacteria 3142
480 Ga0466958_0721409 3300045836 Bacteria 649
481 Ga0466967_0012708 3300045976 Bacteria 6461
482 Ga0466967_0014095 3300045976 Bacteria 6210
483 Ga0466967_0067209 3300045976 Bacteria 3196
484 Ga0466967_0074800 3300045976 Bacteria 3043
485 Ga0466967_0077833 3300045976 Bacteria 2986
486 Ga0466967_0111509 3300045976 Bacteria 2514
487 Ga0466967_0117263 3300045976 Bacteria 2454
488 Ga0466967_0264843 3300045976 Bacteria 1645
489 Ga0466967_0307686 3300045976 Bacteria 1526
490 Ga0466967_0706372 3300045976 Bacteria 999
491 Ga0466967_0807862 3300045976 Bacteria 931
492 Ga0495603_0851946 3300046455 Bacteria 519
493 Ga0495629_0209368 3300046459 Bacteria 1347
494 Ga0495641_0475916 3300046461 Bacteria 569
495 Ga0495653_0356539 3300046463 Bacteria 939
496 Ga0495608_0400818 3300046511 Bacteria 839
497 Ga0495608_0467459 3300046511 Bacteria 766
498 Ga0495630_1441756 3300046517 Bacteria 517
499 Ga0495668_0302631 3300046616 Bacteria 877
500 Ga0495635_0443007 3300046663 Bacteria 859
501 Ga0495657_0206951 3300046675 Bacteria 1194
502 Ga0495658_0075169 3300046683 Bacteria 1971
503 Ga0495658_0902036 3300046683 Bacteria 565
504 Ga0496100_0056976 3300048903 Bacteria 2558
505 Ga0496100_0315877 3300048903 Bacteria 1172
506 Ga0496100_0377429 3300048903 Bacteria 1076
507 Ga0496100_0405950 3300048903 Bacteria 1038
508 Ga0496100_1523044 3300048903 Bacteria 528
509 Ga0496101_0083239 3300048904 Bacteria 2368
510 Ga0496101_0480324 3300048904 Bacteria 981
511 Ga0496101_0586595 3300048904 Bacteria 881
512 Ga0496101_0636460 3300048904 Bacteria 843
513 Ga0496101_0689820 3300048904 Bacteria 806
514 Ga0496102_0019473 3300048905 Bacteria 5977
515 Ga0496102_0098057 3300048905 Bacteria 2719
516 Ga0496102_0147811 3300048905 Bacteria 2206
517 Ga0496102_0231514 3300048905 Bacteria 1742
518 Ga0496102_0773849 3300048905 Bacteria 882
519 Ga0496102_0805699 3300048905 Bacteria 861
520 Ga0496103_0023832 3300048906 Bacteria 3692
521 Ga0496103_0091252 3300048906 Bacteria 1922
522 Ga0496104_0026178 3300048907 Bacteria 5382
523 Ga0496104_0958743 3300048907 Bacteria 760
524 Ga0496105_0002771 3300048908 Bacteria 12807
525 Ga0496105_0447015 3300048908 Bacteria 1021
526 Ga0496105_0748912 3300048908 Bacteria 746
527 Ga0496106_0007373 3300048909 Bacteria 8129
528 Ga0496106_0040050 3300048909 Bacteria 3508
529 Ga0496106_0702001 3300048909 Bacteria 806
530 Ga0496106_1131354 3300048909 Bacteria 612
531 Ga0496106_1556231 3300048909 Bacteria 507
532 Ga0496107_0149993 3300048910 Bacteria 1724
533 Ga0496107_0167050 3300048910 Bacteria 1632
534 Ga0496107_0402337 3300048910 Bacteria 1018
535 Ga0496108_0079866 3300048911 Bacteria 2770
536 Ga0496108_0196303 3300048911 Bacteria 1750
537 Ga0496108_0418146 3300048911 Bacteria 1171
538 Ga0496108_0775399 3300048911 Bacteria 828
539 Ga0496108_1270636 3300048911 Bacteria 620
540 Ga0496109_0035141 3300048912 Bacteria 4519
541 Ga0496109_0064919 3300048912 Bacteria 3341
542 Ga0496109_0423123 3300048912 Bacteria 1258
543 Ga0496109_0428523 3300048912 Bacteria 1249
544 Ga0496109_1701834 3300048912 Bacteria 564
545 Ga0496110_0002595 3300048913 Bacteria 13596
546 Ga0496110_0059780 3300048913 Bacteria 3360
547 Ga0496110_0215357 3300048913 Bacteria 1746
548 Ga0496110_0950086 3300048913 Bacteria 766
549 Ga0496110_1338560 3300048913 Bacteria 625
550 Ga0496111_0009392 3300048914 Bacteria 6523
551 Ga0496111_0116348 3300048914 Bacteria 1972
552 Ga0496111_0134928 3300048914 Bacteria 1828
553 Ga0496111_0567270 3300048914 Bacteria 832
554 Ga0496112_0187586 3300048915 Bacteria 2031
555 Ga0496112_0387114 3300048915 Bacteria 1339
556 Ga0496113_0427908 3300048916 Bacteria 1063
557 Ga0496114_0011349 3300048917 Bacteria 7117
558 Ga0496114_0134392 3300048917 Bacteria 2138
559 Ga0496114_0246992 3300048917 Bacteria 1570
560 Ga0496114_0542330 3300048917 Bacteria 1028
561 Ga0496114_0615148 3300048917 Bacteria 957
562 Ga0496115_0004214 3300048918 Bacteria 10393
563 Ga0496115_0068931 3300048918 Bacteria 2864
564 Ga0496126_0697313 3300048929 Bacteria 789
565 Ga0501311_043080 3300049527 Bacteria 689
566 Ga0501031_0175562 3300049568 Bacteria 1400
567 Ga0501031_0212758 3300049568 Bacteria 1259
568 Ga0501032_0018161 3300049569 Bacteria 4928
569 Ga0501032_0289173 3300049569 Bacteria 1060
570 Ga0501034_0010542 3300049571 Bacteria 9622
571 Ga0501034_0013920 3300049571 Bacteria 8282
572 Ga0501034_0020224 3300049571 Bacteria 6797
573 Ga0501034_0646671 3300049571 Bacteria 959
574 Ga0501034_1358591 3300049571 Bacteria 586
575 Ga0501036_0009708 3300049572 Bacteria 7922
576 Ga0501036_0013175 3300049572 Bacteria 6869
577 Ga0501036_1630956 3300049572 Bacteria 520
578 Ga0501037_0000891 3300049573 Bacteria 22290
579 Ga0501037_0018608 3300049573 Bacteria 5119
580 Ga0501038_0000348 3300049574 Bacteria 39647
581 Ga0501038_0009867 3300049574 Bacteria 8739
582 Ga0501039_0000697 3300049575 Bacteria 24120
583 Ga0501040_0648147 3300049576 Bacteria 763
584 Ga0501042_0212990 3300049578 Bacteria 1394
585 Ga0501043_0000253 3300049579 Bacteria 48525
586 Ga0501043_0572195 3300049579 Bacteria 837
587 Ga0501043_0724991 3300049579 Bacteria 724
588 Ga0501046_0243555 3300049580 Bacteria 1325
589 Ga0501047_0007375 3300049581 Bacteria 10342
590 Ga0501047_0068434 3300049581 Bacteria 3420
591 Ga0501067_0000678 3300049583 Bacteria 18332
592 Ga0501067_0002429 3300049583 Bacteria 10297
593 Ga0501067_0009183 3300049583 Bacteria 5477
594 Ga0501067_0029770 3300049583 Bacteria 3026
595 Ga0501067_0032690 3300049583 Bacteria 2887
596 Ga0501067_0042417 3300049583 Bacteria 2526
597 Ga0501068_0004192 3300049584 Bacteria 7820
598 Ga0501068_0024655 3300049584 Bacteria 3533
599 Ga0501068_0037010 3300049584 Bacteria 2921
600 Ga0501068_0110723 3300049584 Bacteria 1707
601 Ga0501069_0037163 3300049585 Bacteria 2687
602 Ga0501069_0059707 3300049585 Bacteria 2128
603 Ga0501069_0075028 3300049585 Bacteria 1899
604 Ga0501069_0083386 3300049585 Bacteria 1802
605 Ga0501069_0354875 3300049585 Bacteria 864
606 Ga0501069_0409158 3300049585 Bacteria 803
607 Ga0501070_0000353 3300049586 Bacteria 41701
608 Ga0501070_0015754 3300049586 Bacteria 6357
609 Ga0501070_0016529 3300049586 Bacteria 6197
610 Ga0501070_0020365 3300049586 Bacteria 5565
611 Ga0501070_0065225 3300049586 Bacteria 3015
612 Ga0501070_0066935 3300049586 Bacteria 2975
613 Ga0501070_0087971 3300049586 Bacteria 2571
614 Ga0501070_0311474 3300049586 Bacteria 1281
615 Ga0501071_0004517 3300049587 Bacteria 8824
616 Ga0501071_0058142 3300049587 Bacteria 2795
617 Ga0501071_0719935 3300049587 Bacteria 768
618 Ga0501072_0004108 3300049588 Bacteria 11019
619 Ga0501072_0037471 3300049588 Bacteria 3803
620 Ga0501072_0147688 3300049588 Bacteria 1874
621 Ga0501072_0618701 3300049588 Bacteria 853
622 Ga0501073_0001258 3300049589 Bacteria 18570
623 Ga0501073_0021394 3300049589 Bacteria 4662
624 Ga0501073_0075376 3300049589 Bacteria 2348
625 Ga0501073_0160229 3300049589 Bacteria 1559
626 Ga0501073_0833518 3300049589 Bacteria 635
627 Ga0501074_0001497 3300049590 Bacteria 15733
628 Ga0501074_0003132 3300049590 Bacteria 11665
629 Ga0501074_0043487 3300049590 Bacteria 3251
630 Ga0501074_0334359 3300049590 Bacteria 1075
631 Ga0501074_0925587 3300049590 Bacteria 613
632 Ga0501075_0907513 3300049591 Bacteria 670
633 Ga0501076_0305052 3300049592 Bacteria 1305
634 Ga0501076_0595328 3300049592 Bacteria 912
635 Ga0501077_0010149 3300049593 Bacteria 5865
636 Ga0501077_0064437 3300049593 Bacteria 2325
637 Ga0501077_0189872 3300049593 Bacteria 1305
638 Ga0501202_074107 3300049652 Bacteria 789
639 Ga0501214_100910 3300049659 Bacteria 508
640 Ga0501249_213572 3300049679 Bacteria 511
641 Ga0501261_050517 3300049690 Bacteria 680
642 Ga0501079_0032020 3300049741 Bacteria 4041
643 Ga0501079_0036053 3300049741 Bacteria 3809
644 Ga0501079_0226213 3300049741 Bacteria 1462
645 Ga0501079_1415325 3300049741 Bacteria 547
646 Ga0501080_0017701 3300049742 Bacteria 6593
647 Ga0501080_0018510 3300049742 Bacteria 6443
648 Ga0501080_0038963 3300049742 Bacteria 4436
649 Ga0501083_0025463 3300049744 Bacteria 4096
650 Ga0501083_0028741 3300049744 Bacteria 3830
651 Ga0501035_0028310 3300049822 Bacteria 5116
652 Ga0501035_0621508 3300049822 Bacteria 878
653 Ga0501035_1377876 3300049822 Bacteria 541
654 Ga0501044_0007753 3300049823 Bacteria 11802
655 Ga0501044_0022323 3300049823 Bacteria 6745
656 Ga0501044_0422306 3300049823 Bacteria 1243
657 nmdc:mga03683_180023_c1 3300050489 Bacteria 964
658 nmdc:mga03683_86461_c1 3300050489 Bacteria 1361
659 nmdc:mga03n38_110195_c1 3300050490 Bacteria 1340
660 nmdc:mga03n38_116812_c1 3300050490 Bacteria 1306
661 nmdc:mga03n38_162121_c1 3300050490 Bacteria 1133
662 nmdc:mga03n38_177120_c1 3300050490 Bacteria 1090
663 nmdc:mga00v17_108393_c1 3300050491 Bacteria 1760
664 nmdc:mga00v17_150955_c1 3300050491 Bacteria 1493
665 nmdc:mga00v17_15186_c1 3300050491 Bacteria 4317
666 nmdc:mga00v17_252386_c1 3300050491 Bacteria 1144
667 nmdc:mga00v17_84439_c1 3300050491 Bacteria 1987
668 nmdc:mga0yw44_1196889_c1 3300050492 Bacteria 513
669 nmdc:mga0yw44_13929_c1 3300050492 Bacteria 4251
670 nmdc:mga0yw44_15410_c1 3300050492 Bacteria 4093
671 nmdc:mga0yw44_158020_c1 3300050492 Bacteria 1483
672 nmdc:mga0yw44_21006_c1 3300050492 Bacteria 3635
673 nmdc:mga0yw44_247756_c1 3300050492 Bacteria 1185
674 nmdc:mga0yw44_358956_c1 3300050492 Bacteria 982
675 nmdc:mga0yw44_409835_c1 3300050492 Bacteria 917
676 nmdc:mga0yw44_50317_c1 3300050492 Bacteria 2519
677 nmdc:mga0yw44_8565_c1 3300050492 Bacteria 5105
678 nmdc:mga06z11_341035_c1 3300050494 Bacteria 896
679 nmdc:mga06z11_377281_c1 3300050494 Bacteria 852
680 nmdc:mga06z11_6237_c1 3300050494 Bacteria 4833
681 nmdc:mga06z11_75785_c1 3300050494 Bacteria 1792
682 nmdc:mga04h51_53074_c1 3300050495 Bacteria 1367
683 nmdc:mga07m45_12509_c1 3300050496 Bacteria 4487
684 nmdc:mga07m45_456655_c1 3300050496 Bacteria 741
685 nmdc:mga08y16_1888501_c1 3300050511 Bacteria 548
686 nmdc:mga08y16_752758_c1 3300050511 Bacteria 970
687 nmdc:mga0sz30_18344_c1 3300050516 Bacteria 2799
688 Ga0495655_0051101 3300053083 Bacteria 1094
689 Ga0495595_0091767 3300053084 Bacteria 1458
690 Ga0495619_0063186 3300053085 Bacteria 2466
691 Ga0495619_0378117 3300053085 Bacteria 979
692 Ga0500644_0000329 3300053088 Bacteria 24275
693 Ga0500641_0018688 3300053096 Bacteria 2611
694 Ga0500554_085459 3300053102 Bacteria 1044
695 Ga0500556_0000643 3300053104 Bacteria 21878
696 Ga0501084_0013225 3300054114 Bacteria 6829
697 Ga0501084_0042200 3300054114 Bacteria 3815
698 Ga0590077_017003 3300059426 Bacteria 1528
699 Ga0587066_182540 3300059490 Bacteria 541
700 Ga0587073_0189052 3300059492 Bacteria 610
701 Ga0587073_0191714 3300059492 Bacteria 607
702 Ga0587077_246108 3300059493 Bacteria 515
703 Ga0587077_246122 3300059493 Bacteria 515
704 Ga0587082_167340 3300059504 Bacteria 531
705 Ga0587083_0192187 3300059505 Bacteria 578
706 Ga0587085_081591 3300059506 Bacteria 652
707 Ga0587085_135053 3300059506 Bacteria 555
708 Ga0587088_164171 3300059508 Bacteria 546
709 Ga0587090_076223 3300059510 Bacteria 664
710 Ga0587091_092076 3300059511 Bacteria 698
711 Ga0587095_034190 3300059514 Bacteria 536
712 Ga0587099_049757 3300059622 Bacteria 557
713 Ga0587115_023364 3300059626 Bacteria 876
714 Ga0587128_104349 3300059630 Bacteria 598
715 Ga0587068_115766 3300059641 Bacteria 577
716 Ga0587075_151591 3300059644 Bacteria 502
717 Ga0587078_089980 3300059646 Bacteria 502
718 Ga0587079_249018 3300059647 Bacteria 505
719 Ga0587107_116818 3300059652 Bacteria 546
720 Ga0587114_055217 3300059655 Bacteria 683
721 Ga0587114_061666 3300059655 Bacteria 659
722 Ga0587071_092387 3300060344 Bacteria 689
723 Ga0587111_0155319 3300060346 Bacteria 618
724 Ga0501082_0040867 3300060353 Bacteria 3998
725 Ga0501082_0057467 3300060353 Bacteria 3352
726 Ga0466962_0016355 3300061719 Bacteria 3576
727 Ga0466962_0209169 3300061719 Bacteria 954
728 Ga0530510_0451906 3300061734 Bacteria 971
729 Ga0530510_0711482 3300061734 Bacteria 765
730 2643828289 2643221561 Bacteria 4984412
731 2644036455 2643221604 Bacteria 5014917
732 2644090687 2643221615 Bacteria 5487866
733 2644099108 2643221617 Bacteria 5139111
734 2644114989 2643221620 Bacteria 5134593
735 2644320491 2643221657 Bacteria 5490246
736 2644444147 2643221679 Bacteria 3839507
737 2644535104 2643221696 Bacteria 5431823
738 2738867843 2738541305 Bacteria 4910150
739 2740167617 2739367898 Bacteria 4367674
740 2984576869 2984576629 Bacteria 4248407
741 2984579331 2984576629 Bacteria 4248407
742 2990256942 2990256926 Bacteria 4252839
743 2990258617 2990256926 Bacteria 4252839
744 8054613190 8054609563 Bacteria 5170090
745 8056058728 8056054917 Bacteria 5736694
746 8057575333 8057568493 Bacteria 7221719
747 Ga0157370_10230874
748 LJQas_1020289
749 JGI24740J21852_10101825
750 JGI24740J21852_10173194
751 JGI24743J22301_10005496
752 JGI24735J21928_10002795
753 JGI24735J21928_10113378
754 JGI24745J21846_1039873
755 JGI24738J21930_10001988
756 JGI24738J21930_10079012
757 JGI24744J21845_10004441
758 JGI24033J26618_1032824
759 JGI24033J26618_1034548
760 JGI24742J22300_10057329
761 Ga0058863_11896839
762 Ga0058863_11929540
763 Ga0058861_11972693
764 Ga0058862_12866861
765 Ga0070658_10657144
766 Ga0070658_10933335
767 Ga0070683_100018860
768 Ga0070683_100026889
769 Ga0070683_100036698
770 Ga0070683_100289884
771 Ga0070683_100295501
772 Ga0070683_100502654
773 Ga0070683_101297708
774 Ga0070683_101690397
775 Ga0070670_100255569
776 Ga0068869_100287126
777 Ga0068869_100725058
778 Ga0070666_10388229
779 Ga0070682_100005510
780 Ga0070682_100161079
781 Ga0070682_100250925
782 Ga0070682_100323635
783 Ga0070682_100356227
784 Ga0070682_100658378
785 Ga0068868_100059347
786 Ga0068868_100273477
787 Ga0068868_100505120
788 Ga0070660_100029719
789 Ga0070689_100162830
790 Ga0070689_101215962
791 Ga0070661_100509954
792 Ga0070668_100284144
793 Ga0070668_101174869
794 Ga0070669_100117855
795 Ga0070675_100105688
796 Ga0070675_100992909
797 Ga0070675_101852025
798 Ga0070674_100226288
799 Ga0070674_100742570
800 Ga0070674_100769870
801 Ga0070673_100071410
802 Ga0070673_100580385
803 Ga0070659_100115181
804 Ga0070659_101390880
805 Ga0070667_100176567
806 Ga0070667_101284641
807 Ga0070701_10112907
808 Ga0070701_10199231
809 Ga0070705_100011684
810 Ga0070700_100002030
811 Ga0070700_100067475
812 Ga0070663_100529011
813 Ga0070663_100757312
814 Ga0070663_101768414
815 Ga0070678_100203448
816 Ga0070678_101316115
817 Ga0068867_100045040
818 Ga0070685_10905615
819 Ga0070707_100249991
820 Ga0070698_100007249
821 Ga0070679_100037607
822 Ga0070684_100010736
823 Ga0070684_100037528
824 Ga0070684_100242291
825 Ga0070684_100709929
826 Ga0070684_100732020
827 Ga0070672_100002294
828 Ga0070686_100077185
829 Ga0070696_100272392
830 Ga0070693_100021942
831 Ga0070693_100142660
832 Ga0070665_100000877
833 Ga0070665_100191194
834 Ga0070665_101572533
835 Ga0068855_100745400
836 Ga0068855_101778776
837 Ga0070664_100573858
838 Ga0070664_101473545
839 Ga0068857_100013196
840 Ga0068857_101510683
841 Ga0068854_100024098
842 Ga0068854_102042875
843 Ga0068856_100143587
844 Ga0068856_100491883
845 Ga0068856_101346579
846 Ga0068852_100020037
847 Ga0068852_100229088
848 Ga0068852_100462633
849 Ga0068852_102006963
850 Ga0068852_102026676
851 Ga0068864_100107866
852 Ga0068864_100162370
853 Ga0068864_100690214
854 Ga0068866_10022387
855 Ga0068866_10072327
856 Ga0068866_10128477
857 Ga0068866_10135225
858 Ga0068861_100113306
859 Ga0068861_100857248
860 Ga0068861_100910411
861 Ga0068861_101383284
862 Ga0068870_10001361
863 Ga0068870_10236945
864 Ga0068870_10327225
865 Ga0068858_100036515
866 Ga0068858_100358859
867 Ga0068860_100000301
868 Ga0068860_102139410
869 Ga0068862_100536140
870 Ga0068862_102045844
871 Ga0081455_10428324
872 Ga0081539_10336780
873 Ga0075365_10003466
874 Ga0075365_10008946
875 Ga0075365_10012149
876 Ga0075365_10044427
877 Ga0075365_10065083
878 Ga0075365_10077992
879 Ga0075365_10084250
880 Ga0075365_10189353
881 Ga0075368_10078931
882 Ga0075363_100015504
883 Ga0075363_100022891
884 Ga0075363_100152196
885 Ga0075363_100264566
886 Ga0075363_100615519
887 Ga0075364_10129396
888 Ga0075364_10183507
889 Ga0075364_10216073
890 Ga0075364_10315947
891 Ga0075364_10362364
892 Ga0075362_10005527
893 Ga0075362_10114798
894 Ga0075362_10215211
895 Ga0075367_10059592
896 Ga0075367_10105542
897 Ga0075367_10447630
898 Ga0075366_10898808
899 Ga0097621_100284746
900 Ga0097621_100834390
901 Ga0075370_10006873
902 Ga0075370_10139568
903 Ga0075370_10356145
904 Ga0075370_10360225
905 Ga0075370_10637540
906 Ga0068871_100332734
907 Ga0068865_100205441
908 Ga0068865_100254338
909 Ga0068865_100300870
910 Ga0068865_100425535
911 Ga0068865_101128579
912 Ga0075435_100739443
913 Ga0111539_10156430
914 Ga0111539_10363998
915 Ga0111539_10827757
916 Ga0105245_10048719
917 Ga0105245_10379999
918 Ga0105245_11931000
919 Ga0105247_10359134
920 Ga0105243_10013478
921 Ga0105243_10040099
922 Ga0105243_10048180
923 Ga0105243_10312206
924 Ga0105243_10329976
925 Ga0105243_10442848
926 Ga0105243_11303401
927 Ga0105241_10496897
928 Ga0105241_11005729
929 Ga0105242_10145880
930 Ga0105242_10442577
931 Ga0105242_10616313
932 Ga0105248_10036933
933 Ga0105248_10037756
934 Ga0105237_10176632
935 Ga0105237_11070037
936 Ga0105238_10053478
937 Ga0105238_10233124
938 Ga0105238_11450858
939 Ga0105249_10049526
940 Ga0105249_10088808
941 Ga0105249_10936973
942 Ga0105249_11042222
943 Ga0105249_12106143
944 Ga0105239_10047792
945 Ga0105239_10423831
946 Ga0105239_10509039
947 Ga0105246_10005742
948 Ga0105246_10295357
949 Ga0105246_11055070
950 Ga0157321_1019385
951 Ga0157329_1004607
952 Ga0157338_1028125
953 Ga0157371_10225848
954 Ga0157371_10500741
955 Ga0157371_11144917
956 Ga0157369_10594257
957 Ga0157369_10686482
958 Ga0157378_10039562
959 Ga0157378_10173702
960 Ga0157378_11630945
961 Ga0163162_10083818
962 Ga0163162_10484926
963 Ga0163162_11360277
964 Ga0163162_11897315
965 Ga0157372_10036207
966 Ga0157372_10351120
967 Ga0157372_10533554
968 Ga0157372_10569236
969 Ga0157372_10853496
970 Ga0157372_11833845
971 Ga0157372_12475312
972 Ga0157375_10082103
973 Ga0157375_10091362
974 Ga0157375_11564194
975 Ga0163163_10008911
976 Ga0163163_10141023
977 Ga0163163_12234536
978 Ga0157380_10001167
979 Ga0157380_10027489
980 Ga0157380_10085056
981 Ga0157380_10724494
982 Ga0157380_10965333
983 Ga0182008_10081035
984 Ga0182008_10245820
985 Ga0157379_10062503
986 Ga0157379_11730857
987 Ga0157376_11184050
988 Ga0182007_10342040
989 Ga0182005_1240250
990 Ga0163161_10019285
991 Ga0163161_10037252
992 Ga0197907_10056086
993 Ga0197907_10244688
994 Ga0197907_10620040
995 Ga0206356_10679922
996 Ga0206349_1252062
997 Ga0206349_1378472
998 Ga0206355_1079244
999 Ga0206355_1568330
1000 Ga0206351_10988822
1001 Ga0206352_10183314
1002 Ga0206352_11003452
1003 Ga0206352_11276507
1004 Ga0206354_10645953
1005 Ga0206354_11268698
1006 Ga0206354_11398516
1007 Ga0206354_11439178
1008 Ga0206354_11505572
1009 Ga0206353_10446549
1010 Ga0206353_11236499
1011 Ga0206353_11966952
1012 Ga0213876_10611574
1013 Ga0224712_10407212
1014 Ga0224712_10442318
1015 Ga0224712_10687091
1016 Ga0207697_10469029
1017 Ga0207656_10318721
1018 Ga0207642_10251383
1019 Ga0207642_10492043
1020 Ga0207688_10015355
1021 Ga0207688_10072435
1022 Ga0207688_10197947
1023 Ga0207688_10286793
1024 Ga0207647_10274450
1025 Ga0207643_10000778
1026 Ga0207643_10013077
1027 Ga0207643_10118746
1028 Ga0207643_10786684
1029 Ga0207705_10344999
1030 Ga0207705_10734229
1031 Ga0207654_11221145
1032 Ga0207707_10516377
1033 Ga0207671_10537106
1034 Ga0207671_10902846
1035 Ga0207660_10265553
1036 Ga0207657_10070914
1037 Ga0207657_10158895
1038 Ga0207657_10750551
1039 Ga0207652_10005068
1040 Ga0207652_11660820
1041 Ga0207681_10295226
1042 Ga0207694_10109311
1043 Ga0207694_10397070
1044 Ga0207694_10623599
1045 Ga0207650_10701305
1046 Ga0207659_10082150
1047 Ga0207659_11803663
1048 Ga0207687_10040893
1049 Ga0207687_10089742
1050 Ga0207687_10106507
1051 Ga0207690_10064848
1052 Ga0207690_10382817
1053 Ga0207686_10156361
1054 Ga0207709_10026257
1055 Ga0207709_10055484
1056 Ga0207709_10059081
1057 Ga0207709_10377564
1058 Ga0207709_10658695
1059 Ga0207669_10262505
1060 Ga0207669_11246656
1061 Ga0207704_10022323
1062 Ga0207704_10026695
1063 Ga0207691_10002791
1064 Ga0207691_10427708
1065 Ga0207691_10951644
1066 Ga0207711_10272225
1067 Ga0207689_10173353
1068 Ga0207661_10030989
1069 Ga0207661_10096113
1070 Ga0207661_10114304
1071 Ga0207661_10115388
1072 Ga0207679_10775163
1073 Ga0207667_10794831
1074 Ga0207712_11413925
1075 Ga0207668_10540433
1076 Ga0207668_11480506
1077 Ga0207640_10081567
1078 Ga0207658_10091600
1079 Ga0207658_10734253
1080 Ga0207677_10212648
1081 Ga0207677_11350642
1082 Ga0207677_11629952
1083 Ga0207639_10371271
1084 Ga0207678_10239150
1085 Ga0207708_10001770
1086 Ga0207708_10042833
1087 Ga0207708_10217092
1088 Ga0207702_10616373
1089 Ga0207648_10007609
1090 Ga0207648_10720819
1091 Ga0207648_11940245
1092 Ga0207676_10085276
1093 Ga0207674_10027535
1094 Ga0207674_10957742
1095 Ga0207675_100190534
1096 Ga0207675_100735893
1097 Ga0207675_101371527
1098 Ga0207683_10032144
1099 Ga0207683_10054927
1100 Ga0207698_10018852
1101 Ga0207698_10020726
1102 Ga0207698_11332284
1103 Ga0209983_1105397
1104 Ga0209813_10000742
1105 Ga0209813_10018740
1106 Ga0209813_10291899
1107 Ga0209974_10062941
1108 Ga0207428_10574259
1109 Ga0268266_10000947
1110 Ga0268264_10000269
1111 Ga0268264_11773337
1112 Ga0314311_1153184
1113 Ga0316183_1040990
1114 Ga0316181_1256185
1115 Ga0307408_101004360
1116 Ga0307408_101649149
1117 Ga0307408_102016963
1118 Ga0307408_102129668
1119 Ga0307408_102209368
1120 Ga0316576_10421113
1121 Ga0316578_10524243
1122 Ga0307405_10205373
1123 Ga0307405_12111062
1124 Ga0307413_10324864
1125 Ga0307413_11065420
1126 Ga0307410_10018619
1127 Ga0307410_10358603
1128 Ga0307410_10389589
1129 Ga0307406_10043969
1130 Ga0307406_10440260
1131 Ga0307406_11281504
1132 Ga0307407_10027674
1133 Ga0307407_11396499
1134 Ga0307412_10125779
1135 Ga0307412_10142228
1136 Ga0307409_100016688
1137 Ga0307409_100143913
1138 Ga0307409_100178300
1139 Ga0307409_100503955
1140 Ga0307416_100033220
1141 Ga0307416_100076071
1142 Ga0307416_100267284
1143 Ga0307416_100867409
1144 Ga0307416_101244781
1145 Ga0307414_10096868
1146 Ga0307414_10165423
1147 Ga0307414_10373188
1148 Ga0307414_11481559
1149 Ga0307411_10998348
1150 Ga0307415_100001157
1151 Ga0307415_100109628
1152 Ga0307415_100126543
1153 Ga0307415_101039204
1154 Ga0307415_101151381
1155 Ga0373958_0183816
1156 Ga0316584_0480293
1157 Ga0395899_0084830
1158 Ga0395899_0431846
1159 Ga0395900_0144564
1160 Ga0395900_0289034
1161 Ga0395898_0008300
1162 Ga0395898_0711768
1163 Ga0436364_1134014
1164 Ga0395901_0048226
1165 Ga0395901_0392618
1166 Ga0395901_0955111
1167 Ga0436365_0571723
1168 Ga0436365_1006813
1169 Ga0436365_1822162
1170 Ga0436361_0450335
1171 Ga0439438_076010
1172 Ga0439465_0022610
1173 Ga0451789_0914727
1174 Ga0451797_0009395
1175 Ga0451797_0331062
1176 Ga0451797_0511918
1177 Ga0451798_0372281
1178 Ga0451802_1652602
1179 Ga0451806_221579
1180 Ga0451807_1160485
1181 Ga0451851_0454981
1182 Ga0451855_2056453
1183 Ga0451853_0191011
1184 Ga0439431_0003912
1185 Ga0439433_0075789
1186 Ga0439442_105199
1187 Ga0439445_0006632
1188 Ga0439448_0288351
1189 Ga0439458_0066654
1190 Ga0439434_0000865
1191 Ga0466969_0031989
1192 Ga0466972_0108498
1193 Ga0466965_0016178
1194 Ga0466966_0313032
1195 Ga0466966_0802413
1196 Ga0466961_0029506
1197 Ga0466961_0074522
1198 Ga0466961_0620583
1199 Ga0466963_0019903
1200 Ga0466963_0084046
1201 Ga0466963_0093242
1202 Ga0466963_0175366
1203 Ga0466964_0013813
1204 Ga0466964_0023975
1205 Ga0466964_0212205
1206 Ga0466971_0037930
1207 Ga0466971_0313446
1208 Ga0466971_0356459
1209 Ga0466970_0002635
1210 Ga0466970_0017227
1211 Ga0466970_0087397
1212 Ga0466970_0093050
1213 Ga0466970_0473618
1214 Ga0466957_0069625
1215 Ga0466957_0149675
1216 Ga0466957_0614228
1217 Ga0466960_0008036
1218 Ga0466960_0015741
1219 Ga0466960_0126124
1220 Ga0466960_0270710
1221 Ga0466959_0054179
1222 Ga0466959_0275070
1223 Ga0466959_0513393
1224 Ga0451576_0827144
1225 Ga0466958_0031701
1226 Ga0466958_0721409
1227 Ga0466967_0012708
1228 Ga0466967_0014095
1229 Ga0466967_0067209
1230 Ga0466967_0074800
1231 Ga0466967_0077833
1232 Ga0466967_0111509
1233 Ga0466967_0117263
1234 Ga0466967_0264843
1235 Ga0466967_0307686
1236 Ga0466967_0706372
1237 Ga0466967_0807862
1238 Ga0495603_0851946
1239 Ga0495629_0209368
1240 Ga0495641_0475916
1241 Ga0495653_0356539
1242 Ga0495608_0400818
1243 Ga0495608_0467459
1244 Ga0495630_1441756
1245 Ga0495668_0302631
1246 Ga0495635_0443007
1247 Ga0495657_0206951
1248 Ga0495658_0075169
1249 Ga0495658_0902036
1250 Ga0496100_0056976
1251 Ga0496100_0315877
1252 Ga0496100_0377429
1253 Ga0496100_0405950
1254 Ga0496100_1523044
1255 Ga0496101_0083239
1256 Ga0496101_0480324
1257 Ga0496101_0586595
1258 Ga0496101_0636460
1259 Ga0496101_0689820
1260 Ga0496102_0019473
1261 Ga0496102_0098057
1262 Ga0496102_0147811
1263 Ga0496102_0231514
1264 Ga0496102_0773849
1265 Ga0496102_0805699
1266 Ga0496103_0023832
1267 Ga0496103_0091252
1268 Ga0496104_0026178
1269 Ga0496104_0958743
1270 Ga0496105_0002771
1271 Ga0496105_0447015
1272 Ga0496105_0748912
1273 Ga0496106_0007373
1274 Ga0496106_0040050
1275 Ga0496106_0702001
1276 Ga0496106_1131354
1277 Ga0496106_1556231
1278 Ga0496107_0149993
1279 Ga0496107_0167050
1280 Ga0496107_0402337
1281 Ga0496108_0079866
1282 Ga0496108_0196303
1283 Ga0496108_0418146
1284 Ga0496108_0775399
1285 Ga0496108_1270636
1286 Ga0496109_0035141
1287 Ga0496109_0064919
1288 Ga0496109_0423123
1289 Ga0496109_0428523
1290 Ga0496109_1701834
1291 Ga0496110_0002595
1292 Ga0496110_0059780
1293 Ga0496110_0215357
1294 Ga0496110_0950086
1295 Ga0496110_1338560
1296 Ga0496111_0009392
1297 Ga0496111_0116348
1298 Ga0496111_0134928
1299 Ga0496111_0567270
1300 Ga0496112_0187586
1301 Ga0496112_0387114
1302 Ga0496113_0427908
1303 Ga0496114_0011349
1304 Ga0496114_0134392
1305 Ga0496114_0246992
1306 Ga0496114_0542330
1307 Ga0496114_0615148
1308 Ga0496115_0004214
1309 Ga0496115_0068931
1310 Ga0496126_0697313
1311 Ga0501311_043080
1312 Ga0501031_0175562
1313 Ga0501031_0212758
1314 Ga0501032_0018161
1315 Ga0501032_0289173
1316 Ga0501034_0010542
1317 Ga0501034_0013920
1318 Ga0501034_0020224
1319 Ga0501034_0646671
1320 Ga0501034_1358591
1321 Ga0501036_0009708
1322 Ga0501036_0013175
1323 Ga0501036_1630956
1324 Ga0501037_0000891
1325 Ga0501037_0018608
1326 Ga0501038_0000348
1327 Ga0501038_0009867
1328 Ga0501039_0000697
1329 Ga0501040_0648147
1330 Ga0501042_0212990
1331 Ga0501043_0000253
1332 Ga0501043_0572195
1333 Ga0501043_0724991
1334 Ga0501046_0243555
1335 Ga0501047_0007375
1336 Ga0501047_0068434
1337 Ga0501067_0000678
1338 Ga0501067_0002429
1339 Ga0501067_0009183
1340 Ga0501067_0029770
1341 Ga0501067_0032690
1342 Ga0501067_0042417
1343 Ga0501068_0004192
1344 Ga0501068_0024655
1345 Ga0501068_0037010
1346 Ga0501068_0110723
1347 Ga0501069_0037163
1348 Ga0501069_0059707
1349 Ga0501069_0075028
1350 Ga0501069_0083386
1351 Ga0501069_0354875
1352 Ga0501069_0409158
1353 Ga0501070_0000353
1354 Ga0501070_0015754
1355 Ga0501070_0016529
1356 Ga0501070_0020365
1357 Ga0501070_0065225
1358 Ga0501070_0066935
1359 Ga0501070_0087971
1360 Ga0501070_0311474
1361 Ga0501071_0004517
1362 Ga0501071_0058142
1363 Ga0501071_0719935
1364 Ga0501072_0004108
1365 Ga0501072_0037471
1366 Ga0501072_0147688
1367 Ga0501072_0618701
1368 Ga0501073_0001258
1369 Ga0501073_0021394
1370 Ga0501073_0075376
1371 Ga0501073_0160229
1372 Ga0501073_0833518
1373 Ga0501074_0001497
1374 Ga0501074_0003132
1375 Ga0501074_0043487
1376 Ga0501074_0334359
1377 Ga0501074_0925587
1378 Ga0501075_0907513
1379 Ga0501076_0305052
1380 Ga0501076_0595328
1381 Ga0501077_0010149
1382 Ga0501077_0064437
1383 Ga0501077_0189872
1384 Ga0501202_074107
1385 Ga0501214_100910
1386 Ga0501249_213572
1387 Ga0501261_050517
1388 Ga0501079_0032020
1389 Ga0501079_0036053
1390 Ga0501079_0226213
1391 Ga0501079_1415325
1392 Ga0501080_0017701
1393 Ga0501080_0018510
1394 Ga0501080_0038963
1395 Ga0501083_0025463
1396 Ga0501083_0028741
1397 Ga0501035_0028310
1398 Ga0501035_0621508
1399 Ga0501035_1377876
1400 Ga0501044_0007753
1401 Ga0501044_0022323
1402 Ga0501044_0422306
1403 nmdc:mga03683_180023_c1
1404 nmdc:mga03683_86461_c1
1405 nmdc:mga03n38_110195_c1
1406 nmdc:mga03n38_116812_c1
1407 nmdc:mga03n38_162121_c1
1408 nmdc:mga03n38_177120_c1
1409 nmdc:mga00v17_108393_c1
1410 nmdc:mga00v17_150955_c1
1411 nmdc:mga00v17_15186_c1
1412 nmdc:mga00v17_252386_c1
1413 nmdc:mga00v17_84439_c1
1414 nmdc:mga0yw44_1196889_c1
1415 nmdc:mga0yw44_13929_c1
1416 nmdc:mga0yw44_15410_c1
1417 nmdc:mga0yw44_158020_c1
1418 nmdc:mga0yw44_21006_c1
1419 nmdc:mga0yw44_247756_c1
1420 nmdc:mga0yw44_358956_c1
1421 nmdc:mga0yw44_409835_c1
1422 nmdc:mga0yw44_50317_c1
1423 nmdc:mga0yw44_8565_c1
1424 nmdc:mga06z11_341035_c1
1425 nmdc:mga06z11_377281_c1
1426 nmdc:mga06z11_6237_c1
1427 nmdc:mga06z11_75785_c1
1428 nmdc:mga04h51_53074_c1
1429 nmdc:mga07m45_12509_c1
1430 nmdc:mga07m45_456655_c1
1431 nmdc:mga08y16_1888501_c1
1432 nmdc:mga08y16_752758_c1
1433 nmdc:mga0sz30_18344_c1
1434 Ga0495655_0051101
1435 Ga0495595_0091767
1436 Ga0495619_0063186
1437 Ga0495619_0378117
1438 Ga0500644_0000329
1439 Ga0500641_0018688
1440 Ga0500554_085459
1441 Ga0500556_0000643
1442 Ga0501084_0013225
1443 Ga0501084_0042200
1444 Ga0590077_017003
1445 Ga0587066_182540
1446 Ga0587073_0189052
1447 Ga0587073_0191714
1448 Ga0587077_246108
1449 Ga0587077_246122
1450 Ga0587082_167340
1451 Ga0587083_0192187
1452 Ga0587085_081591
1453 Ga0587085_135053
1454 Ga0587088_164171
1455 Ga0587090_076223
1456 Ga0587091_092076
1457 Ga0587095_034190
1458 Ga0587099_049757
1459 Ga0587115_023364
1460 Ga0587128_104349
1461 Ga0587068_115766
1462 Ga0587075_151591
1463 Ga0587078_089980
1464 Ga0587079_249018
1465 Ga0587107_116818
1466 Ga0587114_055217
1467 Ga0587114_061666
1468 Ga0587071_092387
1469 Ga0587111_0155319
1470 Ga0501082_0040867
1471 Ga0501082_0057467
1472 Ga0466962_0016355
1473 Ga0466962_0209169
1474 Ga0530510_0451906
1475 Ga0530510_0711482
1476 2643828289
1477 2644036455
1478 2644090687
1479 2644099108
1480 2644114989
1481 2644320491
1482 2644444147
1483 2644535104
1484 2738867843
1485 2740167617
1486 2984576869
1487 2984579331
1488 2990256942
1489 2990258617
1490 8054613190
1491 8056058728
1492 8057575333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09055

Sod_Ni

Nickel-containing superoxide dismutase

23

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ncq-assembly1.cif.gz_B-2 crystal structure of nisod h1a mutant 0.9755 22 131
1t6i-assembly1.cif.gz_A nickel superoxide dismutase (nisod) apo structure 0.9738 21 133
4ncq-assembly1.cif.gz_C-2 crystal structure of nisod h1a mutant 0.9724 22 131
1t6q-assembly1.cif.gz_B-2 nickel superoxide dismutase (nisod) cn-treated apo structure 0.9671 20 133
1t6i-assembly1.cif.gz_A nickel superoxide dismutase (nisod) apo structure 0.9653 21 133
ID Description Score Start End Superfamily
1t6iA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9752 21 133 1.20.120.400
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9751 21 131 1.20.120.400
1t6qA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9712 21 131 1.20.120.400
1t6iA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9665 21 133 1.20.120.400
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9579 21 131 1.20.120.400
ID Description Score Start End GO Terms
AF-A0A6I2X3L6-F1-model_v4 Superoxide dismutase, Ni 1.006 57 131 GO:0004784
GO:0016151
AF-A0A7K0YH35-F1-model_v4 deleted 0.9995 49 131
AF-A0A6J6MP41-F1-model_v4 Unannotated protein 0.9977 40 131 GO:0004784
GO:0016151
AF-A0A7K0WLI2-F1-model_v4 deleted 0.9975 37 131
AF-A0A536BVV8-F1-model_v4 Superoxide dismutase, Ni (EC 1.15.1.1) 0.981 23 132 GO:0004784
GO:0016151

Map