F478612
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 741 | 357 | 1482 | 202 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2738541275|2738709784 |
| Length | 232 |
| Sequence | PPLPASLPHAVAPALPAVIGFADLAGIAVFALSGALVAARMRQTLVTMCFFAVITGVGGGSVRDLLIGAPVFWVHDRWVALVCLGMAVLCWLTPHRWWRGAALEWADAVGLGAYAVLGTTKALAYGIPPVPAFMMGVITGCVGGVIRDCVAGRPSIIMRPELYVTAAALAAALCSAGQALHLPKGWVWAVSALAGFALRAAAIRWKLAIPAYGGGKKADLGEQLPPPPAPLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 177 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 178 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 208 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 209 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 210 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 211 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 212 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 215 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 218 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 219 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 223 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 224 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 225 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 226 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 229 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 230 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 231 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 281 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 282 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 283 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 289 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 290 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 296 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 300 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 301 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 309 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 316 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 318 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 319 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 325 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 326 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 327 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 328 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 329 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 330 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 331 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 332 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 333 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 334 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 335 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 336 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 337 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 338 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 339 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 340 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 341 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 342 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 343 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 344 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 345 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 346 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 347 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 348 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 349 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 350 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 351 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 352 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 353 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 354 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 355 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 356 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 357 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.82 |
| Metatranscriptomes | 0.13 |
| Isolates | 4.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.67 |
| Bulb | 0 |
| Endosphere | 8.1 |
| Nodule | 0 |
| Rhizoplane | 5.53 |
| Rhizosphere | 79.49 |
| Stem | 0 |
| Stem Tuber | 0.13 |
| Unclassified | 0.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1017232 | 3300001977 | Bacteria | 1026 |
| 2 | JGI24739J22299_10010583 | 3300001989 | Bacteria | 3423 |
| 3 | JGI25153J46596_10002135 | 3300003215 | Bacteria | 11554 |
| 4 | JGI25153J46596_10009034 | 3300003215 | Bacteria | 4685 |
| 5 | Ga0055537_1000506 | 3300003773 | Bacteria | 23507 |
| 6 | Ga0055524_1000172 | 3300003775 | Bacteria | 73986 |
| 7 | Ga0055531_10005416 | 3300003794 | Bacteria | 7470 |
| 8 | Ga0055531_10005767 | 3300003794 | Bacteria | 7169 |
| 9 | Ga0065165_1007352 | 3300005262 | Bacteria | 5443 |
| 10 | Ga0065165_1008215 | 3300005262 | Bacteria | 4944 |
| 11 | Ga0065704_10156415 | 3300005289 | Bacteria | 1384 |
| 12 | Ga0065712_10116448 | 3300005290 | Bacteria | 1721 |
| 13 | Ga0065715_10000911 | 3300005293 | Bacteria | 11904 |
| 14 | Ga0065715_10028841 | 3300005293 | Bacteria | 1669 |
| 15 | Ga0065715_10043402 | 3300005293 | Bacteria | 1186 |
| 16 | Ga0070658_10000013 | 3300005327 | Bacteria | 267776 |
| 17 | Ga0070658_10099444 | 3300005327 | Bacteria | 2403 |
| 18 | Ga0070658_10131342 | 3300005327 | Bacteria | 2087 |
| 19 | Ga0070658_10412566 | 3300005327 | Bacteria | 1161 |
| 20 | Ga0070676_10006862 | 3300005328 | Bacteria | 6098 |
| 21 | Ga0070676_10079399 | 3300005328 | Bacteria | 1987 |
| 22 | Ga0070690_100006138 | 3300005330 | Bacteria | 6802 |
| 23 | Ga0070670_100000492 | 3300005331 | Bacteria | 31595 |
| 24 | Ga0070670_100033351 | 3300005331 | Bacteria | 4434 |
| 25 | Ga0070670_100061089 | 3300005331 | Bacteria | 3235 |
| 26 | Ga0070670_100120015 | 3300005331 | Bacteria | 2268 |
| 27 | Ga0070677_10003939 | 3300005333 | Bacteria | 4818 |
| 28 | Ga0070677_10038430 | 3300005333 | Bacteria | 1873 |
| 29 | Ga0070666_10003757 | 3300005335 | Bacteria | 9204 |
| 30 | Ga0068868_100027511 | 3300005338 | Bacteria | 4339 |
| 31 | Ga0070660_100014730 | 3300005339 | Bacteria | 5640 |
| 32 | Ga0070660_100015199 | 3300005339 | Bacteria | 5552 |
| 33 | Ga0070660_100133809 | 3300005339 | Bacteria | 1986 |
| 34 | Ga0070660_100139410 | 3300005339 | Bacteria | 1945 |
| 35 | Ga0070689_100382252 | 3300005340 | Bacteria | 1187 |
| 36 | Ga0070661_100008300 | 3300005344 | Bacteria | 7173 |
| 37 | Ga0070661_100016079 | 3300005344 | Bacteria | 5281 |
| 38 | Ga0070661_100070970 | 3300005344 | Bacteria | 2562 |
| 39 | Ga0070668_100049328 | 3300005347 | Bacteria | 3239 |
| 40 | Ga0070668_100061483 | 3300005347 | Bacteria | 2910 |
| 41 | Ga0070669_100045733 | 3300005353 | Bacteria | 3190 |
| 42 | Ga0070675_100003002 | 3300005354 | Bacteria | 12732 |
| 43 | Ga0070675_100007902 | 3300005354 | Bacteria | 8244 |
| 44 | Ga0070675_100059718 | 3300005354 | Bacteria | 3147 |
| 45 | Ga0070675_100150255 | 3300005354 | Bacteria | 1997 |
| 46 | Ga0070671_100000181 | 3300005355 | Bacteria | 42003 |
| 47 | Ga0070671_100013054 | 3300005355 | Bacteria | 6695 |
| 48 | Ga0070671_100014830 | 3300005355 | Bacteria | 6296 |
| 49 | Ga0070674_100057324 | 3300005356 | Bacteria | 2704 |
| 50 | Ga0070674_100080608 | 3300005356 | Bacteria | 2324 |
| 51 | Ga0070674_100088589 | 3300005356 | Bacteria | 2228 |
| 52 | Ga0070674_100204502 | 3300005356 | Bacteria | 1527 |
| 53 | Ga0070673_100018988 | 3300005364 | Bacteria | 4929 |
| 54 | Ga0070673_100022247 | 3300005364 | Bacteria | 4612 |
| 55 | Ga0070673_100024334 | 3300005364 | Bacteria | 4439 |
| 56 | Ga0070673_100188501 | 3300005364 | Bacteria | 1770 |
| 57 | Ga0070659_100003780 | 3300005366 | Bacteria | 10802 |
| 58 | Ga0070659_100083255 | 3300005366 | Bacteria | 2557 |
| 59 | Ga0070659_100289182 | 3300005366 | Bacteria | 1365 |
| 60 | Ga0070667_100008263 | 3300005367 | Bacteria | 8626 |
| 61 | Ga0070667_100009934 | 3300005367 | Bacteria | 7888 |
| 62 | Ga0070667_100015045 | 3300005367 | Bacteria | 6393 |
| 63 | Ga0070667_100047403 | 3300005367 | Bacteria | 3615 |
| 64 | Ga0070709_10022415 | 3300005434 | Bacteria | 3693 |
| 65 | Ga0070714_100208770 | 3300005435 | Bacteria | 1789 |
| 66 | Ga0070714_100395844 | 3300005435 | Bacteria | 1305 |
| 67 | Ga0070713_100078197 | 3300005436 | Bacteria | 2815 |
| 68 | Ga0070701_10122735 | 3300005438 | Bacteria | 1466 |
| 69 | Ga0070711_100499956 | 3300005439 | Bacteria | 1002 |
| 70 | Ga0070700_100275533 | 3300005441 | Bacteria | 1218 |
| 71 | Ga0070663_100015839 | 3300005455 | Bacteria | 4878 |
| 72 | Ga0070663_100024991 | 3300005455 | Bacteria | 4028 |
| 73 | Ga0070663_100323329 | 3300005455 | Bacteria | 1241 |
| 74 | Ga0070678_100004540 | 3300005456 | Bacteria | 7885 |
| 75 | Ga0070662_100003365 | 3300005457 | Bacteria | 9960 |
| 76 | Ga0070662_100017208 | 3300005457 | Bacteria | 4867 |
| 77 | Ga0070662_100061105 | 3300005457 | Bacteria | 2750 |
| 78 | Ga0070662_100260543 | 3300005457 | Bacteria | 1397 |
| 79 | Ga0070662_100400210 | 3300005457 | Bacteria | 1133 |
| 80 | Ga0070681_10991499 | 3300005458 | Bacteria | 760 |
| 81 | Ga0068867_100010663 | 3300005459 | Bacteria | 6482 |
| 82 | Ga0070698_101039224 | 3300005471 | Bacteria | 767 |
| 83 | Ga0070679_100050849 | 3300005530 | Bacteria | 4128 |
| 84 | Ga0070684_100039170 | 3300005535 | Bacteria | 4075 |
| 85 | Ga0070684_100177372 | 3300005535 | Bacteria | 1937 |
| 86 | Ga0068853_100046468 | 3300005539 | Bacteria | 3723 |
| 87 | Ga0070672_100004576 | 3300005543 | Bacteria | 9055 |
| 88 | Ga0070672_100012522 | 3300005543 | Bacteria | 5959 |
| 89 | Ga0070672_100097741 | 3300005543 | Bacteria | 2377 |
| 90 | Ga0070686_100024480 | 3300005544 | Bacteria | 3618 |
| 91 | Ga0070693_100259472 | 3300005547 | Bacteria | 1155 |
| 92 | Ga0070665_100055906 | 3300005548 | Bacteria | 3957 |
| 93 | Ga0068855_101073747 | 3300005563 | Bacteria | 843 |
| 94 | Ga0070664_100016559 | 3300005564 | Bacteria | 6045 |
| 95 | Ga0070664_100182920 | 3300005564 | Bacteria | 1864 |
| 96 | Ga0070664_100570741 | 3300005564 | Bacteria | 1047 |
| 97 | Ga0070664_100761727 | 3300005564 | Bacteria | 904 |
| 98 | Ga0070664_100850569 | 3300005564 | Bacteria | 854 |
| 99 | Ga0068857_100040527 | 3300005577 | Bacteria | 4130 |
| 100 | Ga0068857_100095623 | 3300005577 | Bacteria | 2662 |
| 101 | Ga0068857_100096446 | 3300005577 | Bacteria | 2650 |
| 102 | Ga0068854_100011719 | 3300005578 | Bacteria | 5719 |
| 103 | Ga0068854_100203889 | 3300005578 | Bacteria | 1556 |
| 104 | Ga0068854_100250184 | 3300005578 | Bacteria | 1415 |
| 105 | Ga0068856_100034697 | 3300005614 | Bacteria | 4941 |
| 106 | Ga0068856_100853955 | 3300005614 | Bacteria | 929 |
| 107 | Ga0068852_100018484 | 3300005616 | Bacteria | 5492 |
| 108 | Ga0068852_100037820 | 3300005616 | Bacteria | 4050 |
| 109 | Ga0068852_100533691 | 3300005616 | Bacteria | 1172 |
| 110 | Ga0068859_100151366 | 3300005617 | Bacteria | 2395 |
| 111 | Ga0068859_100275636 | 3300005617 | Bacteria | 1774 |
| 112 | Ga0068859_100416783 | 3300005617 | Bacteria | 1439 |
| 113 | Ga0068864_100001075 | 3300005618 | Bacteria | 22935 |
| 114 | Ga0068864_100027059 | 3300005618 | Bacteria | 4839 |
| 115 | Ga0068864_100111293 | 3300005618 | Bacteria | 2439 |
| 116 | Ga0068866_10217527 | 3300005718 | Bacteria | 1151 |
| 117 | Ga0068861_100162613 | 3300005719 | Bacteria | 1843 |
| 118 | Ga0068861_100809945 | 3300005719 | Bacteria | 880 |
| 119 | Ga0068870_10210419 | 3300005840 | Bacteria | 1184 |
| 120 | Ga0068870_10354909 | 3300005840 | Bacteria | 942 |
| 121 | Ga0068863_100006322 | 3300005841 | Bacteria | 11617 |
| 122 | Ga0068863_100007912 | 3300005841 | Bacteria | 10393 |
| 123 | Ga0068863_100034949 | 3300005841 | Bacteria | 4787 |
| 124 | Ga0068863_100423794 | 3300005841 | Bacteria | 1304 |
| 125 | Ga0068858_100038440 | 3300005842 | Bacteria | 4439 |
| 126 | Ga0068858_100104743 | 3300005842 | Bacteria | 2639 |
| 127 | Ga0068860_100000073 | 3300005843 | Bacteria | 173235 |
| 128 | Ga0068860_100124564 | 3300005843 | Bacteria | 2470 |
| 129 | Ga0068860_100145805 | 3300005843 | Bacteria | 2278 |
| 130 | Ga0068862_100003421 | 3300005844 | Bacteria | 13670 |
| 131 | Ga0068862_100143297 | 3300005844 | Bacteria | 2122 |
| 132 | Ga0081540_1152335 | 3300005983 | Bacteria | 910 |
| 133 | Ga0075368_10001309 | 3300006042 | Bacteria | 7884 |
| 134 | Ga0075363_100029213 | 3300006048 | Bacteria | 2844 |
| 135 | Ga0075364_10064242 | 3300006051 | Bacteria | 2409 |
| 136 | Ga0070716_100029326 | 3300006173 | Bacteria | 2973 |
| 137 | Ga0075362_10000220 | 3300006177 | Bacteria | 15798 |
| 138 | Ga0075362_10000330 | 3300006177 | Bacteria | 13476 |
| 139 | Ga0075367_10011501 | 3300006178 | Bacteria | 4687 |
| 140 | Ga0075369_10004524 | 3300006186 | Bacteria | 5144 |
| 141 | Ga0097621_100065938 | 3300006237 | Bacteria | 2981 |
| 142 | Ga0075370_10000004 | 3300006353 | Bacteria | 121166 |
| 143 | Ga0075370_10029906 | 3300006353 | Bacteria | 3036 |
| 144 | Ga0075370_10044511 | 3300006353 | Bacteria | 2509 |
| 145 | Ga0068871_100114494 | 3300006358 | Bacteria | 2272 |
| 146 | Ga0068871_100129474 | 3300006358 | Bacteria | 2139 |
| 147 | Ga0075428_100123604 | 3300006844 | Bacteria | 2817 |
| 148 | Ga0075431_100021482 | 3300006847 | Bacteria | 6601 |
| 149 | Ga0075433_10255563 | 3300006852 | Bacteria | 1554 |
| 150 | Ga0068865_100005326 | 3300006881 | Bacteria | 7789 |
| 151 | Ga0068865_100482293 | 3300006881 | Bacteria | 1031 |
| 152 | Ga0097620_100151368 | 3300006931 | Bacteria | 2395 |
| 153 | Ga0097620_100275627 | 3300006931 | Bacteria | 1774 |
| 154 | Ga0097620_100416797 | 3300006931 | Bacteria | 1439 |
| 155 | Ga0105251_10071009 | 3300009011 | Bacteria | 1620 |
| 156 | Ga0105240_10194722 | 3300009093 | Bacteria | 2381 |
| 157 | Ga0105240_10415949 | 3300009093 | Bacteria | 1511 |
| 158 | Ga0111539_10164111 | 3300009094 | Bacteria | 2598 |
| 159 | Ga0105245_10000617 | 3300009098 | Bacteria | 32256 |
| 160 | Ga0105245_10030507 | 3300009098 | Bacteria | 4767 |
| 161 | Ga0105245_10109711 | 3300009098 | Bacteria | 2564 |
| 162 | Ga0105243_10229920 | 3300009148 | Bacteria | 1645 |
| 163 | Ga0105243_10360006 | 3300009148 | Bacteria | 1339 |
| 164 | Ga0105242_10011086 | 3300009176 | Bacteria | 6926 |
| 165 | Ga0105248_10033756 | 3300009177 | Bacteria | 5718 |
| 166 | Ga0105248_10039065 | 3300009177 | Bacteria | 5314 |
| 167 | Ga0105248_10188240 | 3300009177 | Bacteria | 2325 |
| 168 | Ga0105248_11140166 | 3300009177 | Bacteria | 881 |
| 169 | Ga0105237_10034177 | 3300009545 | Bacteria | 5149 |
| 170 | Ga0105238_10043188 | 3300009551 | Bacteria | 4562 |
| 171 | Ga0105238_10615353 | 3300009551 | Bacteria | 1095 |
| 172 | Ga0105249_10152648 | 3300009553 | Bacteria | 2225 |
| 173 | Ga0105249_10742420 | 3300009553 | Bacteria | 1043 |
| 174 | Ga0105239_10300790 | 3300010375 | Bacteria | 1807 |
| 175 | Ga0105246_10001949 | 3300011119 | Bacteria | 12432 |
| 176 | Ga0157373_10340437 | 3300013100 | Bacteria | 1069 |
| 177 | Ga0157371_10057012 | 3300013102 | Bacteria | 2770 |
| 178 | Ga0157371_10160174 | 3300013102 | Bacteria | 1607 |
| 179 | Ga0157371_10631345 | 3300013102 | Bacteria | 798 |
| 180 | Ga0157370_10000688 | 3300013104 | Bacteria | 42147 |
| 181 | Ga0157369_10362463 | 3300013105 | Bacteria | 1505 |
| 182 | Ga0157374_10012475 | 3300013296 | Bacteria | 7396 |
| 183 | Ga0157374_10019236 | 3300013296 | Bacteria | 6042 |
| 184 | Ga0157378_10030807 | 3300013297 | Bacteria | 4736 |
| 185 | Ga0163162_10022393 | 3300013306 | Bacteria | 6226 |
| 186 | Ga0163162_10032447 | 3300013306 | Bacteria | 5188 |
| 187 | Ga0157375_10024666 | 3300013308 | Bacteria | 5571 |
| 188 | Ga0157375_10139810 | 3300013308 | Bacteria | 2548 |
| 189 | Ga0157375_10300805 | 3300013308 | Bacteria | 1768 |
| 190 | Ga0163163_10014580 | 3300014325 | Bacteria | 7231 |
| 191 | Ga0163163_10035879 | 3300014325 | Bacteria | 4814 |
| 192 | Ga0157380_10029871 | 3300014326 | Bacteria | 4169 |
| 193 | Ga0157377_10055313 | 3300014745 | Bacteria | 2250 |
| 194 | Ga0157379_10033476 | 3300014968 | Bacteria | 4583 |
| 195 | Ga0157376_10001987 | 3300014969 | Bacteria | 13686 |
| 196 | Ga0163161_10037675 | 3300017792 | Bacteria | 3467 |
| 197 | Ga0163161_10103735 | 3300017792 | Bacteria | 2119 |
| 198 | Ga0206353_11711328 | 3300020082 | Bacteria | 780 |
| 199 | Ga0213874_10070964 | 3300021377 | Bacteria | 1111 |
| 200 | Ga0213874_10207037 | 3300021377 | Bacteria | 708 |
| 201 | Ga0213876_10009762 | 3300021384 | Bacteria | 5164 |
| 202 | Ga0207425_1019851 | 3300025245 | Bacteria | 1443 |
| 203 | Ga0209233_1000052 | 3300025261 | Bacteria | 445813 |
| 204 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 205 | Ga0209455_1013103 | 3300025272 | Unclassified | 1943 |
| 206 | Ga0209673_1006204 | 3300025273 | Bacteria | 5835 |
| 207 | Ga0209675_1011220 | 3300025291 | Bacteria | 2987 |
| 208 | Ga0209758_1000008 | 3300025297 | Bacteria | 1215263 |
| 209 | Ga0209758_1037903 | 3300025297 | Bacteria | 1856 |
| 210 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 211 | Ga0209050_1006894 | 3300025298 | Bacteria | 6579 |
| 212 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 213 | Ga0207426_1036807 | 3300025302 | Bacteria | 1553 |
| 214 | Ga0209257_1000027 | 3300025304 | Bacteria | 703541 |
| 215 | Ga0209257_1003958 | 3300025304 | Bacteria | 12016 |
| 216 | Ga0207697_10003812 | 3300025315 | Bacteria | 7357 |
| 217 | Ga0207697_10008601 | 3300025315 | Bacteria | 4454 |
| 218 | Ga0207682_10003908 | 3300025893 | Bacteria | 6361 |
| 219 | Ga0207682_10067137 | 3300025893 | Bacteria | 1513 |
| 220 | Ga0207680_10026538 | 3300025903 | Bacteria | 3212 |
| 221 | Ga0207680_10145111 | 3300025903 | Bacteria | 1577 |
| 222 | Ga0207680_10229987 | 3300025903 | Bacteria | 1274 |
| 223 | Ga0207680_10236274 | 3300025903 | Bacteria | 1258 |
| 224 | Ga0207680_10349121 | 3300025903 | Bacteria | 1039 |
| 225 | Ga0207647_10010243 | 3300025904 | Bacteria | 6623 |
| 226 | Ga0207645_10072189 | 3300025907 | Bacteria | 2209 |
| 227 | Ga0207645_10099507 | 3300025907 | Bacteria | 1875 |
| 228 | Ga0207645_10164727 | 3300025907 | Bacteria | 1451 |
| 229 | Ga0207643_10237929 | 3300025908 | Bacteria | 1118 |
| 230 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 231 | Ga0207707_10209860 | 3300025912 | Bacteria | 1697 |
| 232 | Ga0207695_10191738 | 3300025913 | Bacteria | 1961 |
| 233 | Ga0207693_10005058 | 3300025915 | Bacteria | 11068 |
| 234 | Ga0207663_10434789 | 3300025916 | Bacteria | 1010 |
| 235 | Ga0207662_10386936 | 3300025918 | Bacteria | 946 |
| 236 | Ga0207657_10000649 | 3300025919 | Bacteria | 36992 |
| 237 | Ga0207657_10001718 | 3300025919 | Bacteria | 23607 |
| 238 | Ga0207657_10030307 | 3300025919 | Bacteria | 4910 |
| 239 | Ga0207657_10111265 | 3300025919 | Bacteria | 2261 |
| 240 | Ga0207657_10141732 | 3300025919 | Bacteria | 1963 |
| 241 | Ga0207649_10011051 | 3300025920 | Bacteria | 4967 |
| 242 | Ga0207649_10072269 | 3300025920 | Bacteria | 2206 |
| 243 | Ga0207649_10428866 | 3300025920 | Bacteria | 994 |
| 244 | Ga0207652_10025221 | 3300025921 | Bacteria | 4940 |
| 245 | Ga0207681_10175710 | 3300025923 | Bacteria | 1627 |
| 246 | Ga0207681_10195931 | 3300025923 | Bacteria | 1548 |
| 247 | Ga0207694_10039339 | 3300025924 | Bacteria | 3639 |
| 248 | Ga0207650_10006715 | 3300025925 | Bacteria | 7846 |
| 249 | Ga0207650_10061920 | 3300025925 | Bacteria | 2795 |
| 250 | Ga0207650_10107817 | 3300025925 | Bacteria | 2152 |
| 251 | Ga0207650_10221783 | 3300025925 | Bacteria | 1522 |
| 252 | Ga0207659_10032487 | 3300025926 | Bacteria | 3583 |
| 253 | Ga0207659_10162253 | 3300025926 | Bacteria | 1756 |
| 254 | Ga0207659_10309337 | 3300025926 | Bacteria | 1300 |
| 255 | Ga0207687_10015554 | 3300025927 | Bacteria | 4991 |
| 256 | Ga0207700_10248720 | 3300025928 | Bacteria | 1518 |
| 257 | Ga0207644_10000248 | 3300025931 | Bacteria | 36674 |
| 258 | Ga0207644_10110394 | 3300025931 | Bacteria | 2078 |
| 259 | Ga0207644_10402331 | 3300025931 | Bacteria | 1119 |
| 260 | Ga0207690_10004910 | 3300025932 | Bacteria | 7890 |
| 261 | Ga0207690_10009466 | 3300025932 | Bacteria | 5786 |
| 262 | Ga0207690_10130590 | 3300025932 | Bacteria | 1838 |
| 263 | Ga0207690_10167693 | 3300025932 | Bacteria | 1642 |
| 264 | Ga0207690_10191751 | 3300025932 | Bacteria | 1546 |
| 265 | Ga0207690_10827564 | 3300025932 | Bacteria | 766 |
| 266 | Ga0207690_10894460 | 3300025932 | Bacteria | 736 |
| 267 | Ga0207706_10003992 | 3300025933 | Bacteria | 13980 |
| 268 | Ga0207706_10079194 | 3300025933 | Bacteria | 2890 |
| 269 | Ga0207706_10105169 | 3300025933 | Bacteria | 2484 |
| 270 | Ga0207706_10521629 | 3300025933 | Bacteria | 1024 |
| 271 | Ga0207686_10025809 | 3300025934 | Bacteria | 3423 |
| 272 | Ga0207709_10512329 | 3300025935 | Bacteria | 938 |
| 273 | Ga0207669_10067829 | 3300025937 | Bacteria | 2225 |
| 274 | Ga0207669_10109958 | 3300025937 | Bacteria | 1844 |
| 275 | Ga0207669_10155935 | 3300025937 | Bacteria | 1606 |
| 276 | Ga0207669_10221279 | 3300025937 | Bacteria | 1389 |
| 277 | Ga0207704_10003601 | 3300025938 | Bacteria | 7033 |
| 278 | Ga0207704_10441495 | 3300025938 | Bacteria | 1037 |
| 279 | Ga0207665_10003929 | 3300025939 | Bacteria | 9952 |
| 280 | Ga0207691_10002167 | 3300025940 | Bacteria | 19199 |
| 281 | Ga0207691_10003700 | 3300025940 | Bacteria | 14833 |
| 282 | Ga0207691_10027836 | 3300025940 | Bacteria | 5297 |
| 283 | Ga0207691_10034524 | 3300025940 | Bacteria | 4702 |
| 284 | Ga0207691_10047057 | 3300025940 | Bacteria | 3961 |
| 285 | Ga0207711_10001678 | 3300025941 | Bacteria | 20395 |
| 286 | Ga0207711_10030926 | 3300025941 | Bacteria | 4516 |
| 287 | Ga0207711_10123949 | 3300025941 | Bacteria | 2310 |
| 288 | Ga0207689_10231276 | 3300025942 | Bacteria | 1528 |
| 289 | Ga0207679_10047252 | 3300025945 | Bacteria | 3126 |
| 290 | Ga0207679_10118094 | 3300025945 | Bacteria | 2106 |
| 291 | Ga0207667_10248640 | 3300025949 | Bacteria | 1819 |
| 292 | Ga0207667_10480013 | 3300025949 | Bacteria | 1262 |
| 293 | Ga0207651_10002021 | 3300025960 | Bacteria | 9537 |
| 294 | Ga0207651_10022275 | 3300025960 | Bacteria | 3870 |
| 295 | Ga0207651_10299255 | 3300025960 | Bacteria | 1337 |
| 296 | Ga0207651_10757659 | 3300025960 | Bacteria | 858 |
| 297 | Ga0207712_10064085 | 3300025961 | Bacteria | 2619 |
| 298 | Ga0207712_10074303 | 3300025961 | Bacteria | 2454 |
| 299 | Ga0207668_10002917 | 3300025972 | Bacteria | 10035 |
| 300 | Ga0207668_10100603 | 3300025972 | Bacteria | 2147 |
| 301 | Ga0207640_10012923 | 3300025981 | Bacteria | 4771 |
| 302 | Ga0207640_10028720 | 3300025981 | Bacteria | 3405 |
| 303 | Ga0207640_10092230 | 3300025981 | Bacteria | 2101 |
| 304 | Ga0207640_10116464 | 3300025981 | Bacteria | 1905 |
| 305 | Ga0207640_10568398 | 3300025981 | Bacteria | 955 |
| 306 | Ga0207658_10000025 | 3300025986 | Bacteria | 182470 |
| 307 | Ga0207658_10010976 | 3300025986 | Bacteria | 6169 |
| 308 | Ga0207658_10016797 | 3300025986 | Bacteria | 5036 |
| 309 | Ga0207658_10031627 | 3300025986 | Bacteria | 3760 |
| 310 | Ga0207658_10078746 | 3300025986 | Bacteria | 2519 |
| 311 | Ga0207658_10628432 | 3300025986 | Bacteria | 967 |
| 312 | Ga0207677_10002568 | 3300026023 | Bacteria | 9543 |
| 313 | Ga0207677_10179830 | 3300026023 | Bacteria | 1663 |
| 314 | Ga0207703_10011283 | 3300026035 | Bacteria | 6950 |
| 315 | Ga0207703_10501356 | 3300026035 | Bacteria | 1139 |
| 316 | Ga0207703_10566482 | 3300026035 | Bacteria | 1072 |
| 317 | Ga0207639_10110971 | 3300026041 | Bacteria | 2235 |
| 318 | Ga0207639_10155231 | 3300026041 | Bacteria | 1922 |
| 319 | Ga0207639_10651781 | 3300026041 | Bacteria | 974 |
| 320 | Ga0207678_10001078 | 3300026067 | Bacteria | 24989 |
| 321 | Ga0207678_10030312 | 3300026067 | Bacteria | 4723 |
| 322 | Ga0207678_10030907 | 3300026067 | Bacteria | 4675 |
| 323 | Ga0207708_10186646 | 3300026075 | Bacteria | 1648 |
| 324 | Ga0207641_10005420 | 3300026088 | Bacteria | 10891 |
| 325 | Ga0207641_10007071 | 3300026088 | Bacteria | 9373 |
| 326 | Ga0207641_10017440 | 3300026088 | Bacteria | 5878 |
| 327 | Ga0207641_10198061 | 3300026088 | Bacteria | 1850 |
| 328 | Ga0207641_10736670 | 3300026088 | Bacteria | 972 |
| 329 | Ga0207648_10001389 | 3300026089 | Bacteria | 26669 |
| 330 | Ga0207648_10035937 | 3300026089 | Bacteria | 4366 |
| 331 | Ga0207648_10088577 | 3300026089 | Bacteria | 2703 |
| 332 | Ga0207648_10335247 | 3300026089 | Bacteria | 1361 |
| 333 | Ga0207676_10042193 | 3300026095 | Bacteria | 3507 |
| 334 | Ga0207676_10186217 | 3300026095 | Bacteria | 1822 |
| 335 | Ga0207676_10230004 | 3300026095 | Bacteria | 1657 |
| 336 | Ga0207676_10376833 | 3300026095 | Bacteria | 1320 |
| 337 | Ga0207674_10119300 | 3300026116 | Bacteria | 2607 |
| 338 | Ga0207674_10146408 | 3300026116 | Bacteria | 2321 |
| 339 | Ga0207674_10240793 | 3300026116 | Bacteria | 1756 |
| 340 | Ga0207675_100200726 | 3300026118 | Bacteria | 1915 |
| 341 | Ga0207683_10008161 | 3300026121 | Bacteria | 8958 |
| 342 | Ga0207698_10006248 | 3300026142 | Bacteria | 7415 |
| 343 | Ga0207698_10165865 | 3300026142 | Bacteria | 1938 |
| 344 | Ga0207698_10209297 | 3300026142 | Bacteria | 1753 |
| 345 | Ga0207698_10415041 | 3300026142 | Bacteria | 1290 |
| 346 | Ga0209813_10000047 | 3300027866 | Bacteria | 49657 |
| 347 | Ga0209974_10008416 | 3300027876 | Bacteria | 3527 |
| 348 | Ga0268266_10018314 | 3300028379 | Bacteria | 5970 |
| 349 | Ga0268266_10240935 | 3300028379 | Bacteria | 1669 |
| 350 | Ga0268265_10005235 | 3300028380 | Bacteria | 8878 |
| 351 | Ga0268265_10928315 | 3300028380 | Bacteria | 856 |
| 352 | Ga0268264_10000120 | 3300028381 | Bacteria | 191138 |
| 353 | Ga0268264_10166378 | 3300028381 | Bacteria | 1991 |
| 354 | Ga0268264_10288244 | 3300028381 | Bacteria | 1541 |
| 355 | Ga0307517_10138896 | 3300028786 | Bacteria | 1715 |
| 356 | Ga0316177_1153317 | 3300030731 | Bacteria | 2388 |
| 357 | Ga0316183_1117248 | 3300030742 | Bacteria | 1330 |
| 358 | Ga0316182_1083502 | 3300030745 | Bacteria | 1235 |
| 359 | Ga0316182_1214910 | 3300030745 | Bacteria | 2078 |
| 360 | Ga0307509_10148774 | 3300031507 | Bacteria | 2262 |
| 361 | Ga0307408_100008693 | 3300031548 | Bacteria | 6706 |
| 362 | Ga0307408_100047116 | 3300031548 | Bacteria | 3085 |
| 363 | Ga0307408_100154374 | 3300031548 | Bacteria | 1816 |
| 364 | Ga0307408_100220527 | 3300031548 | Bacteria | 1547 |
| 365 | Ga0307408_100236868 | 3300031548 | Bacteria | 1498 |
| 366 | Ga0307408_100361530 | 3300031548 | Bacteria | 1235 |
| 367 | Ga0307408_100387756 | 3300031548 | Bacteria | 1196 |
| 368 | Ga0307508_10000202 | 3300031616 | Bacteria | 71789 |
| 369 | Ga0307405_10159235 | 3300031731 | Bacteria | 1597 |
| 370 | Ga0307405_10182625 | 3300031731 | Bacteria | 1507 |
| 371 | Ga0307405_10188176 | 3300031731 | Bacteria | 1488 |
| 372 | Ga0307405_10264871 | 3300031731 | Bacteria | 1286 |
| 373 | Ga0307405_10542526 | 3300031731 | Bacteria | 939 |
| 374 | Ga0307405_10631274 | 3300031731 | Bacteria | 878 |
| 375 | Ga0307413_10001637 | 3300031824 | Bacteria | 8676 |
| 376 | Ga0307413_10005882 | 3300031824 | Bacteria | 5536 |
| 377 | Ga0307413_10019213 | 3300031824 | Bacteria | 3605 |
| 378 | Ga0307413_10025490 | 3300031824 | Bacteria | 3242 |
| 379 | Ga0307413_10032515 | 3300031824 | Bacteria | 2958 |
| 380 | Ga0307413_10052268 | 3300031824 | Bacteria | 2466 |
| 381 | Ga0307413_10074139 | 3300031824 | Bacteria | 2154 |
| 382 | Ga0307413_10142890 | 3300031824 | Bacteria | 1656 |
| 383 | Ga0307413_10149015 | 3300031824 | Bacteria | 1628 |
| 384 | Ga0307413_10249754 | 3300031824 | Bacteria | 1315 |
| 385 | Ga0307413_10428866 | 3300031824 | Bacteria | 1043 |
| 386 | Ga0307413_10519983 | 3300031824 | Bacteria | 959 |
| 387 | Ga0307413_10740647 | 3300031824 | Bacteria | 820 |
| 388 | Ga0307413_11032900 | 3300031824 | Bacteria | 706 |
| 389 | Ga0307410_10000938 | 3300031852 | Bacteria | 12506 |
| 390 | Ga0307410_10002846 | 3300031852 | Bacteria | 8506 |
| 391 | Ga0307410_10004511 | 3300031852 | Bacteria | 7211 |
| 392 | Ga0307410_10006874 | 3300031852 | Bacteria | 6180 |
| 393 | Ga0307410_10013086 | 3300031852 | Bacteria | 4827 |
| 394 | Ga0307410_10050581 | 3300031852 | Bacteria | 2795 |
| 395 | Ga0307410_10053034 | 3300031852 | Bacteria | 2742 |
| 396 | Ga0307410_10088023 | 3300031852 | Bacteria | 2198 |
| 397 | Ga0307410_10123995 | 3300031852 | Bacteria | 1888 |
| 398 | Ga0307410_10170838 | 3300031852 | Bacteria | 1638 |
| 399 | Ga0307410_10223601 | 3300031852 | Bacteria | 1449 |
| 400 | Ga0307410_10302203 | 3300031852 | Bacteria | 1263 |
| 401 | Ga0307410_10454499 | 3300031852 | Bacteria | 1045 |
| 402 | Ga0307410_10642377 | 3300031852 | Bacteria | 889 |
| 403 | Ga0307406_10003339 | 3300031901 | Bacteria | 8747 |
| 404 | Ga0307406_10133676 | 3300031901 | Bacteria | 1745 |
| 405 | Ga0307406_10155829 | 3300031901 | Bacteria | 1635 |
| 406 | Ga0307406_10184864 | 3300031901 | Bacteria | 1521 |
| 407 | Ga0307406_10303759 | 3300031901 | Bacteria | 1227 |
| 408 | Ga0307407_10009484 | 3300031903 | Bacteria | 4536 |
| 409 | Ga0307407_10015968 | 3300031903 | Bacteria | 3728 |
| 410 | Ga0307407_10017792 | 3300031903 | Bacteria | 3577 |
| 411 | Ga0307407_10017824 | 3300031903 | Bacteria | 3574 |
| 412 | Ga0307407_10080941 | 3300031903 | Bacteria | 1964 |
| 413 | Ga0307407_10096670 | 3300031903 | Bacteria | 1823 |
| 414 | Ga0307407_10257615 | 3300031903 | Bacteria | 1198 |
| 415 | Ga0307407_10831008 | 3300031903 | Bacteria | 705 |
| 416 | Ga0307412_10000160 | 3300031911 | Bacteria | 47459 |
| 417 | Ga0307412_10010674 | 3300031911 | Bacteria | 5294 |
| 418 | Ga0307412_10094414 | 3300031911 | Bacteria | 2100 |
| 419 | Ga0307412_10097598 | 3300031911 | Bacteria | 2070 |
| 420 | Ga0307412_10097736 | 3300031911 | Bacteria | 2069 |
| 421 | Ga0307412_10179622 | 3300031911 | Bacteria | 1590 |
| 422 | Ga0307412_10236279 | 3300031911 | Bacteria | 1411 |
| 423 | Ga0307412_10341013 | 3300031911 | Bacteria | 1199 |
| 424 | Ga0307412_10438939 | 3300031911 | Bacteria | 1072 |
| 425 | Ga0307412_10479988 | 3300031911 | Bacteria | 1031 |
| 426 | Ga0307412_10830762 | 3300031911 | Bacteria | 804 |
| 427 | Ga0307412_10876528 | 3300031911 | Bacteria | 785 |
| 428 | Ga0307412_11180674 | 3300031911 | Bacteria | 684 |
| 429 | Ga0307409_100021670 | 3300031995 | Bacteria | 4411 |
| 430 | Ga0307409_100066764 | 3300031995 | Bacteria | 2838 |
| 431 | Ga0307409_100098030 | 3300031995 | Bacteria | 2423 |
| 432 | Ga0307409_100182658 | 3300031995 | Bacteria | 1858 |
| 433 | Ga0307409_100400286 | 3300031995 | Bacteria | 1311 |
| 434 | Ga0307409_100698316 | 3300031995 | Bacteria | 1013 |
| 435 | Ga0307409_100743243 | 3300031995 | Bacteria | 984 |
| 436 | Ga0307409_100969063 | 3300031995 | Bacteria | 867 |
| 437 | Ga0307409_101037911 | 3300031995 | Bacteria | 839 |
| 438 | Ga0307416_100051229 | 3300032002 | Bacteria | 3296 |
| 439 | Ga0307416_100117306 | 3300032002 | Bacteria | 2362 |
| 440 | Ga0307416_100190110 | 3300032002 | Bacteria | 1935 |
| 441 | Ga0307416_100214214 | 3300032002 | Bacteria | 1841 |
| 442 | Ga0307416_100246667 | 3300032002 | Bacteria | 1735 |
| 443 | Ga0307416_100325178 | 3300032002 | Bacteria | 1542 |
| 444 | Ga0307416_100558329 | 3300032002 | Bacteria | 1219 |
| 445 | Ga0307416_100822664 | 3300032002 | Bacteria | 1025 |
| 446 | Ga0307414_10005222 | 3300032004 | Bacteria | 7134 |
| 447 | Ga0307414_10018150 | 3300032004 | Bacteria | 4322 |
| 448 | Ga0307414_10019635 | 3300032004 | Bacteria | 4192 |
| 449 | Ga0307414_10028592 | 3300032004 | Bacteria | 3618 |
| 450 | Ga0307414_10032220 | 3300032004 | Bacteria | 3448 |
| 451 | Ga0307414_10055145 | 3300032004 | Bacteria | 2781 |
| 452 | Ga0307414_10074131 | 3300032004 | Bacteria | 2464 |
| 453 | Ga0307414_10087193 | 3300032004 | Bacteria | 2305 |
| 454 | Ga0307414_10098001 | 3300032004 | Bacteria | 2198 |
| 455 | Ga0307414_10164812 | 3300032004 | Bacteria | 1765 |
| 456 | Ga0307414_10479809 | 3300032004 | Bacteria | 1096 |
| 457 | Ga0307414_11043738 | 3300032004 | Bacteria | 753 |
| 458 | Ga0307414_11250942 | 3300032004 | Bacteria | 688 |
| 459 | Ga0307411_10002507 | 3300032005 | Bacteria | 8158 |
| 460 | Ga0307411_10004374 | 3300032005 | Bacteria | 6756 |
| 461 | Ga0307411_10012563 | 3300032005 | Bacteria | 4629 |
| 462 | Ga0307411_10017175 | 3300032005 | Bacteria | 4113 |
| 463 | Ga0307411_10057520 | 3300032005 | Bacteria | 2569 |
| 464 | Ga0307411_10067103 | 3300032005 | Bacteria | 2412 |
| 465 | Ga0307411_10090689 | 3300032005 | Bacteria | 2132 |
| 466 | Ga0307411_10094360 | 3300032005 | Bacteria | 2097 |
| 467 | Ga0307411_10110113 | 3300032005 | Bacteria | 1968 |
| 468 | Ga0307411_10214875 | 3300032005 | Bacteria | 1487 |
| 469 | Ga0307411_10329611 | 3300032005 | Bacteria | 1236 |
| 470 | Ga0307411_10348994 | 3300032005 | Bacteria | 1205 |
| 471 | Ga0307411_10363765 | 3300032005 | Bacteria | 1184 |
| 472 | Ga0307411_10797019 | 3300032005 | Bacteria | 831 |
| 473 | Ga0307411_10890595 | 3300032005 | Bacteria | 790 |
| 474 | Ga0307415_100016615 | 3300032126 | Bacteria | 4392 |
| 475 | Ga0307415_100019636 | 3300032126 | Bacteria | 4108 |
| 476 | Ga0307415_100021786 | 3300032126 | Bacteria | 3946 |
| 477 | Ga0307415_100053824 | 3300032126 | Bacteria | 2744 |
| 478 | Ga0307415_100103110 | 3300032126 | Bacteria | 2098 |
| 479 | Ga0307415_100136255 | 3300032126 | Bacteria | 1867 |
| 480 | Ga0307415_100160395 | 3300032126 | Bacteria | 1742 |
| 481 | Ga0307415_100988468 | 3300032126 | Bacteria | 781 |
| 482 | Ga0373962_0006091 | 3300035242 | Bacteria | 2917 |
| 483 | Ga0373931_0011449 | 3300035691 | Bacteria | 4286 |
| 484 | Ga0373931_0026115 | 3300035691 | Bacteria | 2969 |
| 485 | Ga0373935_0015956 | 3300035692 | Bacteria | 4546 |
| 486 | Ga0373947_0022965 | 3300035725 | Bacteria | 3624 |
| 487 | Ga0316584_0177381 | 3300036712 | Bacteria | 1578 |
| 488 | Ga0373925_0041069 | 3300037068 | Bacteria | 3427 |
| 489 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 490 | Ga0395899_0005738 | 3300037312 | Bacteria | 9636 |
| 491 | Ga0395899_0043074 | 3300037312 | Bacteria | 3368 |
| 492 | Ga0395899_0220334 | 3300037312 | Bacteria | 1314 |
| 493 | Ga0395900_0005857 | 3300037418 | Bacteria | 12832 |
| 494 | Ga0395900_0050332 | 3300037418 | Bacteria | 4291 |
| 495 | Ga0395900_0167490 | 3300037418 | Bacteria | 2238 |
| 496 | Ga0395900_0773227 | 3300037418 | Bacteria | 890 |
| 497 | Ga0395898_0032653 | 3300037466 | Bacteria | 5197 |
| 498 | Ga0395898_0059934 | 3300037466 | Bacteria | 3701 |
| 499 | Ga0395898_0350597 | 3300037466 | Bacteria | 1407 |
| 500 | Ga0395905_0019855 | 3300037471 | Bacteria | 6368 |
| 501 | Ga0395905_0031268 | 3300037471 | Bacteria | 5012 |
| 502 | Ga0395905_0303911 | 3300037471 | Bacteria | 1483 |
| 503 | Ga0395905_0339251 | 3300037471 | Bacteria | 1394 |
| 504 | Ga0436364_1018154 | 3300037853 | Bacteria | 1369 |
| 505 | Ga0395901_0007192 | 3300038443 | Bacteria | 11225 |
| 506 | Ga0395901_0011893 | 3300038443 | Bacteria | 8827 |
| 507 | Ga0436365_1490276 | 3300039437 | Bacteria | 16241 |
| 508 | Ga0436361_0361280 | 3300039447 | Bacteria | 17737 |
| 509 | Ga0436361_0776450 | 3300039447 | Bacteria | 1600 |
| 510 | Ga0436363_0525845 | 3300039450 | Bacteria | 1264 |
| 511 | Ga0436363_0705429 | 3300039450 | Bacteria | 1397 |
| 512 | Ga0436363_1410486 | 3300039450 | Bacteria | 1125 |
| 513 | Ga0439436_0005396 | 3300041404 | Bacteria | 3914 |
| 514 | Ga0439439_0031173 | 3300041406 | Bacteria | 1357 |
| 515 | Ga0439461_0000783 | 3300041410 | Bacteria | 4667 |
| 516 | Ga0439461_0005881 | 3300041410 | Bacteria | 2114 |
| 517 | Ga0439465_0001400 | 3300041413 | Bacteria | 7801 |
| 518 | Ga0439465_0012515 | 3300041413 | Bacteria | 2651 |
| 519 | Ga0439465_0209385 | 3300041413 | Bacteria | 712 |
| 520 | Ga0451791_0995076 | 3300041451 | Bacteria | 832 |
| 521 | Ga0451802_1025162 | 3300041460 | Bacteria | 986 |
| 522 | Ga0439431_0000263 | 3300041997 | Bacteria | 10800 |
| 523 | Ga0439431_0060933 | 3300041997 | Bacteria | 992 |
| 524 | Ga0439442_001090 | 3300042002 | Bacteria | 5459 |
| 525 | Ga0439445_0000213 | 3300042004 | Bacteria | 10661 |
| 526 | Ga0439432_000507 | 3300042006 | Bacteria | 14445 |
| 527 | Ga0439449_0020476 | 3300042007 | Bacteria | 2479 |
| 528 | Ga0439449_0032072 | 3300042007 | Bacteria | 1958 |
| 529 | Ga0439452_010538 | 3300042010 | Bacteria | 2685 |
| 530 | Ga0439452_033375 | 3300042010 | Bacteria | 1250 |
| 531 | Ga0439457_005686 | 3300042014 | Bacteria | 3104 |
| 532 | Ga0439462_0001782 | 3300042015 | Bacteria | 4872 |
| 533 | Ga0439462_0002180 | 3300042015 | Bacteria | 4511 |
| 534 | Ga0450912_000117 | 3300042116 | Bacteria | 2867 |
| 535 | Ga0450920_003452 | 3300042122 | Bacteria | 2738 |
| 536 | Ga0439446_0057740 | 3300042156 | Bacteria | 1168 |
| 537 | Ga0450908_039128 | 3300042184 | Bacteria | 822 |
| 538 | Ga0439434_0000464 | 3300042435 | Bacteria | 11529 |
| 539 | Ga0439434_0008686 | 3300042435 | Bacteria | 2984 |
| 540 | Ga0451577_0257922 | 3300042876 | Bacteria | 1579 |
| 541 | Ga0466969_0145054 | 3300044656 | Bacteria | 1096 |
| 542 | Ga0466973_0121043 | 3300044659 | Bacteria | 2155 |
| 543 | Ga0466965_0110083 | 3300044683 | Bacteria | 1415 |
| 544 | Ga0466966_0025714 | 3300044684 | Bacteria | 3845 |
| 545 | Ga0466966_0065197 | 3300044684 | Bacteria | 2291 |
| 546 | Ga0466961_0025729 | 3300044693 | Bacteria | 3783 |
| 547 | Ga0466961_0292787 | 3300044693 | Bacteria | 995 |
| 548 | Ga0466963_0044798 | 3300044694 | Bacteria | 2912 |
| 549 | Ga0466963_0079365 | 3300044694 | Bacteria | 2220 |
| 550 | Ga0466963_0501728 | 3300044694 | Bacteria | 857 |
| 551 | Ga0466964_0076125 | 3300044706 | Bacteria | 1430 |
| 552 | Ga0466964_0122322 | 3300044706 | Bacteria | 1175 |
| 553 | Ga0466964_0297428 | 3300044706 | Bacteria | 812 |
| 554 | Ga0466971_0207292 | 3300044719 | Bacteria | 926 |
| 555 | Ga0466970_0097855 | 3300044765 | Bacteria | 1596 |
| 556 | Ga0466970_0159078 | 3300044765 | Bacteria | 1249 |
| 557 | Ga0466957_0004998 | 3300044842 | Bacteria | 7420 |
| 558 | Ga0466957_0703375 | 3300044842 | Bacteria | 713 |
| 559 | Ga0466960_0122520 | 3300044901 | Bacteria | 1363 |
| 560 | Ga0466959_0012314 | 3300045049 | Bacteria | 6176 |
| 561 | Ga0466959_0054113 | 3300045049 | Bacteria | 2933 |
| 562 | Ga0466959_0054679 | 3300045049 | Bacteria | 2916 |
| 563 | Ga0451576_0079413 | 3300045051 | Bacteria | 3414 |
| 564 | Ga0466958_0081025 | 3300045836 | Bacteria | 1997 |
| 565 | Ga0466958_0239690 | 3300045836 | Bacteria | 1159 |
| 566 | Ga0466958_0618871 | 3300045836 | Bacteria | 704 |
| 567 | Ga0466967_0062657 | 3300045976 | Bacteria | 3302 |
| 568 | Ga0495585_0376231 | 3300046492 | Bacteria | 687 |
| 569 | Ga0495596_0212666 | 3300046500 | Bacteria | 751 |
| 570 | Ga0495606_0252381 | 3300046507 | Bacteria | 978 |
| 571 | Ga0495643_0157021 | 3300046522 | Bacteria | 1122 |
| 572 | Ga0495648_0248428 | 3300046524 | Bacteria | 860 |
| 573 | Ga0495663_0001938 | 3300046525 | Bacteria | 6371 |
| 574 | Ga0495663_0005439 | 3300046525 | Bacteria | 3531 |
| 575 | Ga0495663_0012906 | 3300046525 | Bacteria | 2332 |
| 576 | Ga0495663_0020929 | 3300046525 | Bacteria | 1880 |
| 577 | Ga0495642_0020745 | 3300046528 | Bacteria | 2583 |
| 578 | Ga0495598_0001583 | 3300046537 | Bacteria | 4559 |
| 579 | Ga0495598_0004737 | 3300046537 | Bacteria | 2966 |
| 580 | Ga0495621_0000192 | 3300046539 | Bacteria | 14020 |
| 581 | Ga0495621_0000663 | 3300046539 | Bacteria | 8695 |
| 582 | Ga0495621_0001981 | 3300046539 | Bacteria | 5387 |
| 583 | Ga0495621_0040803 | 3300046539 | Bacteria | 1627 |
| 584 | Ga0495656_0045745 | 3300046615 | Bacteria | 1849 |
| 585 | Ga0495668_0023283 | 3300046616 | Bacteria | 3535 |
| 586 | Ga0495668_0351566 | 3300046616 | Bacteria | 809 |
| 587 | Ga0495659_0137784 | 3300046664 | Bacteria | 972 |
| 588 | Ga0495669_0001958 | 3300046684 | Bacteria | 8461 |
| 589 | Ga0495669_0018660 | 3300046684 | Bacteria | 2984 |
| 590 | Ga0495669_0115404 | 3300046684 | Bacteria | 1256 |
| 591 | Ga0495670_0004749 | 3300046691 | Bacteria | 6673 |
| 592 | Ga0495670_0009667 | 3300046691 | Bacteria | 4739 |
| 593 | Ga0495670_0011968 | 3300046691 | Bacteria | 4269 |
| 594 | Ga0495670_0012922 | 3300046691 | Bacteria | 4104 |
| 595 | Ga0495670_0022080 | 3300046691 | Bacteria | 3142 |
| 596 | Ga0495670_0072902 | 3300046691 | Bacteria | 1740 |
| 597 | Ga0495670_0164929 | 3300046691 | Bacteria | 1165 |
| 598 | Ga0495670_0457927 | 3300046691 | Bacteria | 691 |
| 599 | Ga0495671_0012364 | 3300046692 | Bacteria | 4666 |
| 600 | Ga0495677_0011626 | 3300047445 | Bacteria | 3218 |
| 601 | Ga0495677_0026603 | 3300047445 | Bacteria | 2098 |
| 602 | Ga0495677_0088994 | 3300047445 | Bacteria | 1162 |
| 603 | Ga0495677_0219876 | 3300047445 | Bacteria | 740 |
| 604 | Ga0495686_0011963 | 3300047472 | Bacteria | 6098 |
| 605 | Ga0495686_0033202 | 3300047472 | Bacteria | 3334 |
| 606 | Ga0496100_0011477 | 3300048903 | Bacteria | 5044 |
| 607 | Ga0496100_0133797 | 3300048903 | Bacteria | 1749 |
| 608 | Ga0496101_0006133 | 3300048904 | Bacteria | 7715 |
| 609 | Ga0496101_0788591 | 3300048904 | Bacteria | 749 |
| 610 | Ga0496102_0011902 | 3300048905 | Bacteria | 7511 |
| 611 | Ga0496102_0410000 | 3300048905 | Bacteria | 1273 |
| 612 | Ga0496103_0007460 | 3300048906 | Bacteria | 6520 |
| 613 | Ga0496104_0052883 | 3300048907 | Bacteria | 3836 |
| 614 | Ga0496105_0176987 | 3300048908 | Bacteria | 1747 |
| 615 | Ga0496106_0096457 | 3300048909 | Bacteria | 2288 |
| 616 | Ga0496107_0136152 | 3300048910 | Bacteria | 1814 |
| 617 | Ga0496108_0009287 | 3300048911 | Bacteria | 7959 |
| 618 | Ga0496108_0093207 | 3300048911 | Bacteria | 2562 |
| 619 | Ga0496108_0148969 | 3300048911 | Bacteria | 2019 |
| 620 | Ga0496108_0160072 | 3300048911 | Bacteria | 1945 |
| 621 | Ga0496108_0160524 | 3300048911 | Bacteria | 1942 |
| 622 | Ga0496109_0025022 | 3300048912 | Bacteria | 5315 |
| 623 | Ga0496109_0189105 | 3300048912 | Bacteria | 1934 |
| 624 | Ga0496109_0270701 | 3300048912 | Bacteria | 1600 |
| 625 | Ga0496109_0296127 | 3300048912 | Bacteria | 1525 |
| 626 | Ga0496109_0579821 | 3300048912 | Bacteria | 1057 |
| 627 | Ga0496109_0861740 | 3300048912 | Bacteria | 844 |
| 628 | Ga0496110_0001263 | 3300048913 | Bacteria | 18090 |
| 629 | Ga0496110_0062492 | 3300048913 | Bacteria | 3289 |
| 630 | Ga0496110_0062554 | 3300048913 | Bacteria | 3287 |
| 631 | Ga0496110_0227642 | 3300048913 | Bacteria | 1695 |
| 632 | Ga0496111_0048679 | 3300048914 | Bacteria | 3053 |
| 633 | Ga0496111_0091696 | 3300048914 | Bacteria | 2227 |
| 634 | Ga0496111_0154839 | 3300048914 | Bacteria | 1701 |
| 635 | Ga0496112_0002632 | 3300048915 | Bacteria | 14504 |
| 636 | Ga0496112_0030831 | 3300048915 | Bacteria | 5194 |
| 637 | Ga0496112_0210169 | 3300048915 | Bacteria | 1903 |
| 638 | Ga0496113_0006758 | 3300048916 | Bacteria | 7312 |
| 639 | Ga0496114_0000162 | 3300048917 | Bacteria | 47188 |
| 640 | Ga0496114_0058111 | 3300048917 | Bacteria | 3229 |
| 641 | Ga0496114_0238578 | 3300048917 | Bacteria | 1598 |
| 642 | Ga0496115_0004744 | 3300048918 | Bacteria | 9860 |
| 643 | Ga0496115_0119673 | 3300048918 | Bacteria | 2166 |
| 644 | Ga0496117_0022181 | 3300048920 | Bacteria | 5098 |
| 645 | Ga0496118_0022469 | 3300048921 | Bacteria | 5512 |
| 646 | Ga0496120_0077568 | 3300048923 | Bacteria | 1808 |
| 647 | Ga0496123_0024686 | 3300048926 | Bacteria | 4560 |
| 648 | Ga0496123_0053440 | 3300048926 | Bacteria | 2669 |
| 649 | Ga0496123_0058940 | 3300048926 | Bacteria | 2486 |
| 650 | Ga0496124_0001482 | 3300048927 | Bacteria | 34498 |
| 651 | Ga0496124_0001624 | 3300048927 | Bacteria | 32235 |
| 652 | Ga0496124_0034492 | 3300048927 | Bacteria | 4440 |
| 653 | Ga0496124_0305370 | 3300048927 | Bacteria | 1147 |
| 654 | Ga0496124_0425799 | 3300048927 | Bacteria | 913 |
| 655 | Ga0496124_0535388 | 3300048927 | Bacteria | 777 |
| 656 | Ga0496125_0042523 | 3300048928 | Bacteria | 3868 |
| 657 | Ga0496125_0536931 | 3300048928 | Bacteria | 651 |
| 658 | Ga0496126_0028362 | 3300048929 | Bacteria | 5337 |
| 659 | Ga0496126_0051801 | 3300048929 | Bacteria | 3735 |
| 660 | Ga0495678_102688 | 3300049459 | Bacteria | 988 |
| 661 | Ga0501298_023378 | 3300049521 | Bacteria | 1171 |
| 662 | Ga0501043_0004097 | 3300049579 | Bacteria | 11901 |
| 663 | Ga0501046_0025504 | 3300049580 | Bacteria | 4838 |
| 664 | Ga0501047_0001134 | 3300049581 | Bacteria | 26429 |
| 665 | Ga0501207_040193 | 3300049654 | Bacteria | 811 |
| 666 | Ga0501217_017279 | 3300049661 | Bacteria | 1662 |
| 667 | Ga0501223_006963 | 3300049663 | Bacteria | 2322 |
| 668 | Ga0501227_016740 | 3300049665 | Bacteria | 1649 |
| 669 | Ga0501233_010058 | 3300049668 | Bacteria | 1856 |
| 670 | Ga0501233_100753 | 3300049668 | Bacteria | 764 |
| 671 | Ga0501235_005040 | 3300049669 | Bacteria | 2866 |
| 672 | Ga0501249_030956 | 3300049679 | Bacteria | 1192 |
| 673 | Ga0501251_035999 | 3300049681 | Bacteria | 729 |
| 674 | Ga0501259_012502 | 3300049688 | Bacteria | 1417 |
| 675 | Ga0501225_0020960 | 3300049705 | Bacteria | 1806 |
| 676 | Ga0501234_008200 | 3300049707 | Bacteria | 1632 |
| 677 | Ga0501241_041569 | 3300049758 | Bacteria | 892 |
| 678 | Ga0501273_000883 | 3300049770 | Bacteria | 2642 |
| 679 | Ga0501283_009534 | 3300049779 | Bacteria | 1417 |
| 680 | Ga0501035_0142777 | 3300049822 | Bacteria | 2081 |
| 681 | Ga0501045_0299979 | 3300049824 | Bacteria | 1196 |
| 682 | nmdc:mga03683_31_c1 | 3300050489 | Bacteria | 69502 |
| 683 | nmdc:mga03n38_163525_c1 | 3300050490 | Bacteria | 1129 |
| 684 | nmdc:mga03n38_9541_c1 | 3300050490 | Bacteria | 3536 |
| 685 | nmdc:mga00v17_28068_c1 | 3300050491 | Bacteria | 3293 |
| 686 | nmdc:mga0yw44_69188_c1 | 3300050492 | Bacteria | 2186 |
| 687 | nmdc:mga0k408_391960_c1 | 3300050493 | Bacteria | 827 |
| 688 | nmdc:mga0k408_91977_c1 | 3300050493 | Bacteria | 1783 |
| 689 | nmdc:mga06z11_9233_c1 | 3300050494 | Bacteria | 4149 |
| 690 | nmdc:mga04h51_416_c1 | 3300050495 | Bacteria | 10244 |
| 691 | nmdc:mga07m45_107_c1 | 3300050496 | Bacteria | 33126 |
| 692 | nmdc:mga07m45_19_c1 | 3300050496 | Bacteria | 133476 |
| 693 | nmdc:mga07m45_77159_c1 | 3300050496 | Bacteria | 1900 |
| 694 | nmdc:mga08y16_192802_c1 | 3300050511 | Bacteria | 2113 |
| 695 | nmdc:mga0a205_670661_c1 | 3300050515 | Bacteria | 887 |
| 696 | nmdc:mga0sz30_2396_c1 | 3300050516 | Bacteria | 6690 |
| 697 | nmdc:mga0sz30_3472_c1 | 3300050516 | Bacteria | 5681 |
| 698 | Ga0500641_0005368 | 3300053096 | Bacteria | 4540 |
| 699 | Ga0500641_0038642 | 3300053096 | Bacteria | 1919 |
| 700 | Ga0500594_0007662 | 3300053118 | Bacteria | 2448 |
| 701 | Ga0500595_023751 | 3300053119 | Bacteria | 2151 |
| 702 | Ga0500608_000087 | 3300053122 | Bacteria | 37903 |
| 703 | Ga0500658_0002026 | 3300053134 | Bacteria | 7912 |
| 704 | Ga0500559_0034887 | 3300053136 | Bacteria | 2170 |
| 705 | Ga0500568_0017564 | 3300053139 | Bacteria | 3157 |
| 706 | Ga0500604_0073920 | 3300053151 | Bacteria | 1091 |
| 707 | Ga0500616_0118193 | 3300053153 | Bacteria | 1270 |
| 708 | Ga0500567_000445 | 3300053723 | Bacteria | 13930 |
| 709 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 710 | Ga0500645_015063 | 3300053730 | Bacteria | 2456 |
| 711 | Ga0466962_0114792 | 3300061719 | Bacteria | 1297 |
| 712 | 2738709784 | 2738541275 | Bacteria | 4830863 |
| 713 | 2600226864 | 2599185359 | Bacteria | 4772316 |
| 714 | 2643727672 | 2643221541 | Bacteria | 5498788 |
| 715 | 2644041169 | 2643221606 | Bacteria | 5588032 |
| 716 | 2644125495 | 2643221622 | Bacteria | 4212502 |
| 717 | 2644394708 | 2643221671 | Bacteria | 5496681 |
| 718 | 2738848209 | 2738541301 | Bacteria | 4834102 |
| 719 | 2738863938 | 2738541304 | Bacteria | 4833665 |
| 720 | 2739296456 | 2738543022 | Bacteria | 4835059 |
| 721 | 2739358134 | 2738543033 | Bacteria | 4833336 |
| 722 | 2739649379 | 2739367664 | Bacteria | 4114334 |
| 723 | 2740027852 | 2739367865 | Bacteria | 4114482 |
| 724 | 2753765958 | 2751185897 | Bacteria | 5322941 |
| 725 | 2819715688 | 2818991466 | Bacteria | 4748179 |
| 726 | 2830078228 | 2830075706 | Bacteria | 3855215 |
| 727 | 2848298263 | 2848297114 | Bacteria | 3608511 |
| 728 | 2879163376 | 2879163058 | Bacteria | 4223965 |
| 729 | 2885427321 | 2885427238 | Bacteria | 2291351 |
| 730 | 2896429364 | 2896429255 | Bacteria | 2557483 |
| 731 | 2928028553 | 2928027323 | Bacteria | 4382488 |
| 732 | 2928101341 | 2928100450 | Bacteria | 4837635 |
| 733 | 2928529707 | 2928526807 | Bacteria | 4760224 |
| 734 | 2928960248 | 2928959182 | Bacteria | 4725774 |
| 735 | 2928970807 | 2928968154 | Bacteria | 4633371 |
| 736 | 2946789713 | 2946787523 | Bacteria | 4366789 |
| 737 | 2984555870 | 2984555340 | Bacteria | 4247089 |
| 738 | 2984566023 | 2984564862 | Bacteria | 4339992 |
| 739 | 2990266415 | 2990265787 | Bacteria | 3943888 |
| 740 | 2993357032 | 2993356040 | Bacteria | 4247105 |
| 741 | 2993695792 | 2993693658 | Bacteria | 4040749 |
| 742 | JGI24746J21847_1017232 | |||
| 743 | JGI24739J22299_10010583 | |||
| 744 | JGI25153J46596_10002135 | |||
| 745 | JGI25153J46596_10009034 | |||
| 746 | Ga0055537_1000506 | |||
| 747 | Ga0055524_1000172 | |||
| 748 | Ga0055531_10005416 | |||
| 749 | Ga0055531_10005767 | |||
| 750 | Ga0065165_1007352 | |||
| 751 | Ga0065165_1008215 | |||
| 752 | Ga0065704_10156415 | |||
| 753 | Ga0065712_10116448 | |||
| 754 | Ga0065715_10000911 | |||
| 755 | Ga0065715_10028841 | |||
| 756 | Ga0065715_10043402 | |||
| 757 | Ga0070658_10000013 | |||
| 758 | Ga0070658_10099444 | |||
| 759 | Ga0070658_10131342 | |||
| 760 | Ga0070658_10412566 | |||
| 761 | Ga0070676_10006862 | |||
| 762 | Ga0070676_10079399 | |||
| 763 | Ga0070690_100006138 | |||
| 764 | Ga0070670_100000492 | |||
| 765 | Ga0070670_100033351 | |||
| 766 | Ga0070670_100061089 | |||
| 767 | Ga0070670_100120015 | |||
| 768 | Ga0070677_10003939 | |||
| 769 | Ga0070677_10038430 | |||
| 770 | Ga0070666_10003757 | |||
| 771 | Ga0068868_100027511 | |||
| 772 | Ga0070660_100014730 | |||
| 773 | Ga0070660_100015199 | |||
| 774 | Ga0070660_100133809 | |||
| 775 | Ga0070660_100139410 | |||
| 776 | Ga0070689_100382252 | |||
| 777 | Ga0070661_100008300 | |||
| 778 | Ga0070661_100016079 | |||
| 779 | Ga0070661_100070970 | |||
| 780 | Ga0070668_100049328 | |||
| 781 | Ga0070668_100061483 | |||
| 782 | Ga0070669_100045733 | |||
| 783 | Ga0070675_100003002 | |||
| 784 | Ga0070675_100007902 | |||
| 785 | Ga0070675_100059718 | |||
| 786 | Ga0070675_100150255 | |||
| 787 | Ga0070671_100000181 | |||
| 788 | Ga0070671_100013054 | |||
| 789 | Ga0070671_100014830 | |||
| 790 | Ga0070674_100057324 | |||
| 791 | Ga0070674_100080608 | |||
| 792 | Ga0070674_100088589 | |||
| 793 | Ga0070674_100204502 | |||
| 794 | Ga0070673_100018988 | |||
| 795 | Ga0070673_100022247 | |||
| 796 | Ga0070673_100024334 | |||
| 797 | Ga0070673_100188501 | |||
| 798 | Ga0070659_100003780 | |||
| 799 | Ga0070659_100083255 | |||
| 800 | Ga0070659_100289182 | |||
| 801 | Ga0070667_100008263 | |||
| 802 | Ga0070667_100009934 | |||
| 803 | Ga0070667_100015045 | |||
| 804 | Ga0070667_100047403 | |||
| 805 | Ga0070709_10022415 | |||
| 806 | Ga0070714_100208770 | |||
| 807 | Ga0070714_100395844 | |||
| 808 | Ga0070713_100078197 | |||
| 809 | Ga0070701_10122735 | |||
| 810 | Ga0070711_100499956 | |||
| 811 | Ga0070700_100275533 | |||
| 812 | Ga0070663_100015839 | |||
| 813 | Ga0070663_100024991 | |||
| 814 | Ga0070663_100323329 | |||
| 815 | Ga0070678_100004540 | |||
| 816 | Ga0070662_100003365 | |||
| 817 | Ga0070662_100017208 | |||
| 818 | Ga0070662_100061105 | |||
| 819 | Ga0070662_100260543 | |||
| 820 | Ga0070662_100400210 | |||
| 821 | Ga0070681_10991499 | |||
| 822 | Ga0068867_100010663 | |||
| 823 | Ga0070698_101039224 | |||
| 824 | Ga0070679_100050849 | |||
| 825 | Ga0070684_100039170 | |||
| 826 | Ga0070684_100177372 | |||
| 827 | Ga0068853_100046468 | |||
| 828 | Ga0070672_100004576 | |||
| 829 | Ga0070672_100012522 | |||
| 830 | Ga0070672_100097741 | |||
| 831 | Ga0070686_100024480 | |||
| 832 | Ga0070693_100259472 | |||
| 833 | Ga0070665_100055906 | |||
| 834 | Ga0068855_101073747 | |||
| 835 | Ga0070664_100016559 | |||
| 836 | Ga0070664_100182920 | |||
| 837 | Ga0070664_100570741 | |||
| 838 | Ga0070664_100761727 | |||
| 839 | Ga0070664_100850569 | |||
| 840 | Ga0068857_100040527 | |||
| 841 | Ga0068857_100095623 | |||
| 842 | Ga0068857_100096446 | |||
| 843 | Ga0068854_100011719 | |||
| 844 | Ga0068854_100203889 | |||
| 845 | Ga0068854_100250184 | |||
| 846 | Ga0068856_100034697 | |||
| 847 | Ga0068856_100853955 | |||
| 848 | Ga0068852_100018484 | |||
| 849 | Ga0068852_100037820 | |||
| 850 | Ga0068852_100533691 | |||
| 851 | Ga0068859_100151366 | |||
| 852 | Ga0068859_100275636 | |||
| 853 | Ga0068859_100416783 | |||
| 854 | Ga0068864_100001075 | |||
| 855 | Ga0068864_100027059 | |||
| 856 | Ga0068864_100111293 | |||
| 857 | Ga0068866_10217527 | |||
| 858 | Ga0068861_100162613 | |||
| 859 | Ga0068861_100809945 | |||
| 860 | Ga0068870_10210419 | |||
| 861 | Ga0068870_10354909 | |||
| 862 | Ga0068863_100006322 | |||
| 863 | Ga0068863_100007912 | |||
| 864 | Ga0068863_100034949 | |||
| 865 | Ga0068863_100423794 | |||
| 866 | Ga0068858_100038440 | |||
| 867 | Ga0068858_100104743 | |||
| 868 | Ga0068860_100000073 | |||
| 869 | Ga0068860_100124564 | |||
| 870 | Ga0068860_100145805 | |||
| 871 | Ga0068862_100003421 | |||
| 872 | Ga0068862_100143297 | |||
| 873 | Ga0081540_1152335 | |||
| 874 | Ga0075368_10001309 | |||
| 875 | Ga0075363_100029213 | |||
| 876 | Ga0075364_10064242 | |||
| 877 | Ga0070716_100029326 | |||
| 878 | Ga0075362_10000220 | |||
| 879 | Ga0075362_10000330 | |||
| 880 | Ga0075367_10011501 | |||
| 881 | Ga0075369_10004524 | |||
| 882 | Ga0097621_100065938 | |||
| 883 | Ga0075370_10000004 | |||
| 884 | Ga0075370_10029906 | |||
| 885 | Ga0075370_10044511 | |||
| 886 | Ga0068871_100114494 | |||
| 887 | Ga0068871_100129474 | |||
| 888 | Ga0075428_100123604 | |||
| 889 | Ga0075431_100021482 | |||
| 890 | Ga0075433_10255563 | |||
| 891 | Ga0068865_100005326 | |||
| 892 | Ga0068865_100482293 | |||
| 893 | Ga0097620_100151368 | |||
| 894 | Ga0097620_100275627 | |||
| 895 | Ga0097620_100416797 | |||
| 896 | Ga0105251_10071009 | |||
| 897 | Ga0105240_10194722 | |||
| 898 | Ga0105240_10415949 | |||
| 899 | Ga0111539_10164111 | |||
| 900 | Ga0105245_10000617 | |||
| 901 | Ga0105245_10030507 | |||
| 902 | Ga0105245_10109711 | |||
| 903 | Ga0105243_10229920 | |||
| 904 | Ga0105243_10360006 | |||
| 905 | Ga0105242_10011086 | |||
| 906 | Ga0105248_10033756 | |||
| 907 | Ga0105248_10039065 | |||
| 908 | Ga0105248_10188240 | |||
| 909 | Ga0105248_11140166 | |||
| 910 | Ga0105237_10034177 | |||
| 911 | Ga0105238_10043188 | |||
| 912 | Ga0105238_10615353 | |||
| 913 | Ga0105249_10152648 | |||
| 914 | Ga0105249_10742420 | |||
| 915 | Ga0105239_10300790 | |||
| 916 | Ga0105246_10001949 | |||
| 917 | Ga0157373_10340437 | |||
| 918 | Ga0157371_10057012 | |||
| 919 | Ga0157371_10160174 | |||
| 920 | Ga0157371_10631345 | |||
| 921 | Ga0157370_10000688 | |||
| 922 | Ga0157369_10362463 | |||
| 923 | Ga0157374_10012475 | |||
| 924 | Ga0157374_10019236 | |||
| 925 | Ga0157378_10030807 | |||
| 926 | Ga0163162_10022393 | |||
| 927 | Ga0163162_10032447 | |||
| 928 | Ga0157375_10024666 | |||
| 929 | Ga0157375_10139810 | |||
| 930 | Ga0157375_10300805 | |||
| 931 | Ga0163163_10014580 | |||
| 932 | Ga0163163_10035879 | |||
| 933 | Ga0157380_10029871 | |||
| 934 | Ga0157377_10055313 | |||
| 935 | Ga0157379_10033476 | |||
| 936 | Ga0157376_10001987 | |||
| 937 | Ga0163161_10037675 | |||
| 938 | Ga0163161_10103735 | |||
| 939 | Ga0206353_11711328 | |||
| 940 | Ga0213874_10070964 | |||
| 941 | Ga0213874_10207037 | |||
| 942 | Ga0213876_10009762 | |||
| 943 | Ga0207425_1019851 | |||
| 944 | Ga0209233_1000052 | |||
| 945 | Ga0209565_1000007 | |||
| 946 | Ga0209455_1013103 | |||
| 947 | Ga0209673_1006204 | |||
| 948 | Ga0209675_1011220 | |||
| 949 | Ga0209758_1000008 | |||
| 950 | Ga0209758_1037903 | |||
| 951 | Ga0209050_1000010 | |||
| 952 | Ga0209050_1006894 | |||
| 953 | Ga0209256_1000008 | |||
| 954 | Ga0207426_1036807 | |||
| 955 | Ga0209257_1000027 | |||
| 956 | Ga0209257_1003958 | |||
| 957 | Ga0207697_10003812 | |||
| 958 | Ga0207697_10008601 | |||
| 959 | Ga0207682_10003908 | |||
| 960 | Ga0207682_10067137 | |||
| 961 | Ga0207680_10026538 | |||
| 962 | Ga0207680_10145111 | |||
| 963 | Ga0207680_10229987 | |||
| 964 | Ga0207680_10236274 | |||
| 965 | Ga0207680_10349121 | |||
| 966 | Ga0207647_10010243 | |||
| 967 | Ga0207645_10072189 | |||
| 968 | Ga0207645_10099507 | |||
| 969 | Ga0207645_10164727 | |||
| 970 | Ga0207643_10237929 | |||
| 971 | Ga0207705_10000002 | |||
| 972 | Ga0207707_10209860 | |||
| 973 | Ga0207695_10191738 | |||
| 974 | Ga0207693_10005058 | |||
| 975 | Ga0207663_10434789 | |||
| 976 | Ga0207662_10386936 | |||
| 977 | Ga0207657_10000649 | |||
| 978 | Ga0207657_10001718 | |||
| 979 | Ga0207657_10030307 | |||
| 980 | Ga0207657_10111265 | |||
| 981 | Ga0207657_10141732 | |||
| 982 | Ga0207649_10011051 | |||
| 983 | Ga0207649_10072269 | |||
| 984 | Ga0207649_10428866 | |||
| 985 | Ga0207652_10025221 | |||
| 986 | Ga0207681_10175710 | |||
| 987 | Ga0207681_10195931 | |||
| 988 | Ga0207694_10039339 | |||
| 989 | Ga0207650_10006715 | |||
| 990 | Ga0207650_10061920 | |||
| 991 | Ga0207650_10107817 | |||
| 992 | Ga0207650_10221783 | |||
| 993 | Ga0207659_10032487 | |||
| 994 | Ga0207659_10162253 | |||
| 995 | Ga0207659_10309337 | |||
| 996 | Ga0207687_10015554 | |||
| 997 | Ga0207700_10248720 | |||
| 998 | Ga0207644_10000248 | |||
| 999 | Ga0207644_10110394 | |||
| 1000 | Ga0207644_10402331 | |||
| 1001 | Ga0207690_10004910 | |||
| 1002 | Ga0207690_10009466 | |||
| 1003 | Ga0207690_10130590 | |||
| 1004 | Ga0207690_10167693 | |||
| 1005 | Ga0207690_10191751 | |||
| 1006 | Ga0207690_10827564 | |||
| 1007 | Ga0207690_10894460 | |||
| 1008 | Ga0207706_10003992 | |||
| 1009 | Ga0207706_10079194 | |||
| 1010 | Ga0207706_10105169 | |||
| 1011 | Ga0207706_10521629 | |||
| 1012 | Ga0207686_10025809 | |||
| 1013 | Ga0207709_10512329 | |||
| 1014 | Ga0207669_10067829 | |||
| 1015 | Ga0207669_10109958 | |||
| 1016 | Ga0207669_10155935 | |||
| 1017 | Ga0207669_10221279 | |||
| 1018 | Ga0207704_10003601 | |||
| 1019 | Ga0207704_10441495 | |||
| 1020 | Ga0207665_10003929 | |||
| 1021 | Ga0207691_10002167 | |||
| 1022 | Ga0207691_10003700 | |||
| 1023 | Ga0207691_10027836 | |||
| 1024 | Ga0207691_10034524 | |||
| 1025 | Ga0207691_10047057 | |||
| 1026 | Ga0207711_10001678 | |||
| 1027 | Ga0207711_10030926 | |||
| 1028 | Ga0207711_10123949 | |||
| 1029 | Ga0207689_10231276 | |||
| 1030 | Ga0207679_10047252 | |||
| 1031 | Ga0207679_10118094 | |||
| 1032 | Ga0207667_10248640 | |||
| 1033 | Ga0207667_10480013 | |||
| 1034 | Ga0207651_10002021 | |||
| 1035 | Ga0207651_10022275 | |||
| 1036 | Ga0207651_10299255 | |||
| 1037 | Ga0207651_10757659 | |||
| 1038 | Ga0207712_10064085 | |||
| 1039 | Ga0207712_10074303 | |||
| 1040 | Ga0207668_10002917 | |||
| 1041 | Ga0207668_10100603 | |||
| 1042 | Ga0207640_10012923 | |||
| 1043 | Ga0207640_10028720 | |||
| 1044 | Ga0207640_10092230 | |||
| 1045 | Ga0207640_10116464 | |||
| 1046 | Ga0207640_10568398 | |||
| 1047 | Ga0207658_10000025 | |||
| 1048 | Ga0207658_10010976 | |||
| 1049 | Ga0207658_10016797 | |||
| 1050 | Ga0207658_10031627 | |||
| 1051 | Ga0207658_10078746 | |||
| 1052 | Ga0207658_10628432 | |||
| 1053 | Ga0207677_10002568 | |||
| 1054 | Ga0207677_10179830 | |||
| 1055 | Ga0207703_10011283 | |||
| 1056 | Ga0207703_10501356 | |||
| 1057 | Ga0207703_10566482 | |||
| 1058 | Ga0207639_10110971 | |||
| 1059 | Ga0207639_10155231 | |||
| 1060 | Ga0207639_10651781 | |||
| 1061 | Ga0207678_10001078 | |||
| 1062 | Ga0207678_10030312 | |||
| 1063 | Ga0207678_10030907 | |||
| 1064 | Ga0207708_10186646 | |||
| 1065 | Ga0207641_10005420 | |||
| 1066 | Ga0207641_10007071 | |||
| 1067 | Ga0207641_10017440 | |||
| 1068 | Ga0207641_10198061 | |||
| 1069 | Ga0207641_10736670 | |||
| 1070 | Ga0207648_10001389 | |||
| 1071 | Ga0207648_10035937 | |||
| 1072 | Ga0207648_10088577 | |||
| 1073 | Ga0207648_10335247 | |||
| 1074 | Ga0207676_10042193 | |||
| 1075 | Ga0207676_10186217 | |||
| 1076 | Ga0207676_10230004 | |||
| 1077 | Ga0207676_10376833 | |||
| 1078 | Ga0207674_10119300 | |||
| 1079 | Ga0207674_10146408 | |||
| 1080 | Ga0207674_10240793 | |||
| 1081 | Ga0207675_100200726 | |||
| 1082 | Ga0207683_10008161 | |||
| 1083 | Ga0207698_10006248 | |||
| 1084 | Ga0207698_10165865 | |||
| 1085 | Ga0207698_10209297 | |||
| 1086 | Ga0207698_10415041 | |||
| 1087 | Ga0209813_10000047 | |||
| 1088 | Ga0209974_10008416 | |||
| 1089 | Ga0268266_10018314 | |||
| 1090 | Ga0268266_10240935 | |||
| 1091 | Ga0268265_10005235 | |||
| 1092 | Ga0268265_10928315 | |||
| 1093 | Ga0268264_10000120 | |||
| 1094 | Ga0268264_10166378 | |||
| 1095 | Ga0268264_10288244 | |||
| 1096 | Ga0307517_10138896 | |||
| 1097 | Ga0316177_1153317 | |||
| 1098 | Ga0316183_1117248 | |||
| 1099 | Ga0316182_1083502 | |||
| 1100 | Ga0316182_1214910 | |||
| 1101 | Ga0307509_10148774 | |||
| 1102 | Ga0307408_100008693 | |||
| 1103 | Ga0307408_100047116 | |||
| 1104 | Ga0307408_100154374 | |||
| 1105 | Ga0307408_100220527 | |||
| 1106 | Ga0307408_100236868 | |||
| 1107 | Ga0307408_100361530 | |||
| 1108 | Ga0307408_100387756 | |||
| 1109 | Ga0307508_10000202 | |||
| 1110 | Ga0307405_10159235 | |||
| 1111 | Ga0307405_10182625 | |||
| 1112 | Ga0307405_10188176 | |||
| 1113 | Ga0307405_10264871 | |||
| 1114 | Ga0307405_10542526 | |||
| 1115 | Ga0307405_10631274 | |||
| 1116 | Ga0307413_10001637 | |||
| 1117 | Ga0307413_10005882 | |||
| 1118 | Ga0307413_10019213 | |||
| 1119 | Ga0307413_10025490 | |||
| 1120 | Ga0307413_10032515 | |||
| 1121 | Ga0307413_10052268 | |||
| 1122 | Ga0307413_10074139 | |||
| 1123 | Ga0307413_10142890 | |||
| 1124 | Ga0307413_10149015 | |||
| 1125 | Ga0307413_10249754 | |||
| 1126 | Ga0307413_10428866 | |||
| 1127 | Ga0307413_10519983 | |||
| 1128 | Ga0307413_10740647 | |||
| 1129 | Ga0307413_11032900 | |||
| 1130 | Ga0307410_10000938 | |||
| 1131 | Ga0307410_10002846 | |||
| 1132 | Ga0307410_10004511 | |||
| 1133 | Ga0307410_10006874 | |||
| 1134 | Ga0307410_10013086 | |||
| 1135 | Ga0307410_10050581 | |||
| 1136 | Ga0307410_10053034 | |||
| 1137 | Ga0307410_10088023 | |||
| 1138 | Ga0307410_10123995 | |||
| 1139 | Ga0307410_10170838 | |||
| 1140 | Ga0307410_10223601 | |||
| 1141 | Ga0307410_10302203 | |||
| 1142 | Ga0307410_10454499 | |||
| 1143 | Ga0307410_10642377 | |||
| 1144 | Ga0307406_10003339 | |||
| 1145 | Ga0307406_10133676 | |||
| 1146 | Ga0307406_10155829 | |||
| 1147 | Ga0307406_10184864 | |||
| 1148 | Ga0307406_10303759 | |||
| 1149 | Ga0307407_10009484 | |||
| 1150 | Ga0307407_10015968 | |||
| 1151 | Ga0307407_10017792 | |||
| 1152 | Ga0307407_10017824 | |||
| 1153 | Ga0307407_10080941 | |||
| 1154 | Ga0307407_10096670 | |||
| 1155 | Ga0307407_10257615 | |||
| 1156 | Ga0307407_10831008 | |||
| 1157 | Ga0307412_10000160 | |||
| 1158 | Ga0307412_10010674 | |||
| 1159 | Ga0307412_10094414 | |||
| 1160 | Ga0307412_10097598 | |||
| 1161 | Ga0307412_10097736 | |||
| 1162 | Ga0307412_10179622 | |||
| 1163 | Ga0307412_10236279 | |||
| 1164 | Ga0307412_10341013 | |||
| 1165 | Ga0307412_10438939 | |||
| 1166 | Ga0307412_10479988 | |||
| 1167 | Ga0307412_10830762 | |||
| 1168 | Ga0307412_10876528 | |||
| 1169 | Ga0307412_11180674 | |||
| 1170 | Ga0307409_100021670 | |||
| 1171 | Ga0307409_100066764 | |||
| 1172 | Ga0307409_100098030 | |||
| 1173 | Ga0307409_100182658 | |||
| 1174 | Ga0307409_100400286 | |||
| 1175 | Ga0307409_100698316 | |||
| 1176 | Ga0307409_100743243 | |||
| 1177 | Ga0307409_100969063 | |||
| 1178 | Ga0307409_101037911 | |||
| 1179 | Ga0307416_100051229 | |||
| 1180 | Ga0307416_100117306 | |||
| 1181 | Ga0307416_100190110 | |||
| 1182 | Ga0307416_100214214 | |||
| 1183 | Ga0307416_100246667 | |||
| 1184 | Ga0307416_100325178 | |||
| 1185 | Ga0307416_100558329 | |||
| 1186 | Ga0307416_100822664 | |||
| 1187 | Ga0307414_10005222 | |||
| 1188 | Ga0307414_10018150 | |||
| 1189 | Ga0307414_10019635 | |||
| 1190 | Ga0307414_10028592 | |||
| 1191 | Ga0307414_10032220 | |||
| 1192 | Ga0307414_10055145 | |||
| 1193 | Ga0307414_10074131 | |||
| 1194 | Ga0307414_10087193 | |||
| 1195 | Ga0307414_10098001 | |||
| 1196 | Ga0307414_10164812 | |||
| 1197 | Ga0307414_10479809 | |||
| 1198 | Ga0307414_11043738 | |||
| 1199 | Ga0307414_11250942 | |||
| 1200 | Ga0307411_10002507 | |||
| 1201 | Ga0307411_10004374 | |||
| 1202 | Ga0307411_10012563 | |||
| 1203 | Ga0307411_10017175 | |||
| 1204 | Ga0307411_10057520 | |||
| 1205 | Ga0307411_10067103 | |||
| 1206 | Ga0307411_10090689 | |||
| 1207 | Ga0307411_10094360 | |||
| 1208 | Ga0307411_10110113 | |||
| 1209 | Ga0307411_10214875 | |||
| 1210 | Ga0307411_10329611 | |||
| 1211 | Ga0307411_10348994 | |||
| 1212 | Ga0307411_10363765 | |||
| 1213 | Ga0307411_10797019 | |||
| 1214 | Ga0307411_10890595 | |||
| 1215 | Ga0307415_100016615 | |||
| 1216 | Ga0307415_100019636 | |||
| 1217 | Ga0307415_100021786 | |||
| 1218 | Ga0307415_100053824 | |||
| 1219 | Ga0307415_100103110 | |||
| 1220 | Ga0307415_100136255 | |||
| 1221 | Ga0307415_100160395 | |||
| 1222 | Ga0307415_100988468 | |||
| 1223 | Ga0373962_0006091 | |||
| 1224 | Ga0373931_0011449 | |||
| 1225 | Ga0373931_0026115 | |||
| 1226 | Ga0373935_0015956 | |||
| 1227 | Ga0373947_0022965 | |||
| 1228 | Ga0316584_0177381 | |||
| 1229 | Ga0373925_0041069 | |||
| 1230 | Ga0395899_0000018 | |||
| 1231 | Ga0395899_0005738 | |||
| 1232 | Ga0395899_0043074 | |||
| 1233 | Ga0395899_0220334 | |||
| 1234 | Ga0395900_0005857 | |||
| 1235 | Ga0395900_0050332 | |||
| 1236 | Ga0395900_0167490 | |||
| 1237 | Ga0395900_0773227 | |||
| 1238 | Ga0395898_0032653 | |||
| 1239 | Ga0395898_0059934 | |||
| 1240 | Ga0395898_0350597 | |||
| 1241 | Ga0395905_0019855 | |||
| 1242 | Ga0395905_0031268 | |||
| 1243 | Ga0395905_0303911 | |||
| 1244 | Ga0395905_0339251 | |||
| 1245 | Ga0436364_1018154 | |||
| 1246 | Ga0395901_0007192 | |||
| 1247 | Ga0395901_0011893 | |||
| 1248 | Ga0436365_1490276 | |||
| 1249 | Ga0436361_0361280 | |||
| 1250 | Ga0436361_0776450 | |||
| 1251 | Ga0436363_0525845 | |||
| 1252 | Ga0436363_0705429 | |||
| 1253 | Ga0436363_1410486 | |||
| 1254 | Ga0439436_0005396 | |||
| 1255 | Ga0439439_0031173 | |||
| 1256 | Ga0439461_0000783 | |||
| 1257 | Ga0439461_0005881 | |||
| 1258 | Ga0439465_0001400 | |||
| 1259 | Ga0439465_0012515 | |||
| 1260 | Ga0439465_0209385 | |||
| 1261 | Ga0451791_0995076 | |||
| 1262 | Ga0451802_1025162 | |||
| 1263 | Ga0439431_0000263 | |||
| 1264 | Ga0439431_0060933 | |||
| 1265 | Ga0439442_001090 | |||
| 1266 | Ga0439445_0000213 | |||
| 1267 | Ga0439432_000507 | |||
| 1268 | Ga0439449_0020476 | |||
| 1269 | Ga0439449_0032072 | |||
| 1270 | Ga0439452_010538 | |||
| 1271 | Ga0439452_033375 | |||
| 1272 | Ga0439457_005686 | |||
| 1273 | Ga0439462_0001782 | |||
| 1274 | Ga0439462_0002180 | |||
| 1275 | Ga0450912_000117 | |||
| 1276 | Ga0450920_003452 | |||
| 1277 | Ga0439446_0057740 | |||
| 1278 | Ga0450908_039128 | |||
| 1279 | Ga0439434_0000464 | |||
| 1280 | Ga0439434_0008686 | |||
| 1281 | Ga0451577_0257922 | |||
| 1282 | Ga0466969_0145054 | |||
| 1283 | Ga0466973_0121043 | |||
| 1284 | Ga0466965_0110083 | |||
| 1285 | Ga0466966_0025714 | |||
| 1286 | Ga0466966_0065197 | |||
| 1287 | Ga0466961_0025729 | |||
| 1288 | Ga0466961_0292787 | |||
| 1289 | Ga0466963_0044798 | |||
| 1290 | Ga0466963_0079365 | |||
| 1291 | Ga0466963_0501728 | |||
| 1292 | Ga0466964_0076125 | |||
| 1293 | Ga0466964_0122322 | |||
| 1294 | Ga0466964_0297428 | |||
| 1295 | Ga0466971_0207292 | |||
| 1296 | Ga0466970_0097855 | |||
| 1297 | Ga0466970_0159078 | |||
| 1298 | Ga0466957_0004998 | |||
| 1299 | Ga0466957_0703375 | |||
| 1300 | Ga0466960_0122520 | |||
| 1301 | Ga0466959_0012314 | |||
| 1302 | Ga0466959_0054113 | |||
| 1303 | Ga0466959_0054679 | |||
| 1304 | Ga0451576_0079413 | |||
| 1305 | Ga0466958_0081025 | |||
| 1306 | Ga0466958_0239690 | |||
| 1307 | Ga0466958_0618871 | |||
| 1308 | Ga0466967_0062657 | |||
| 1309 | Ga0495585_0376231 | |||
| 1310 | Ga0495596_0212666 | |||
| 1311 | Ga0495606_0252381 | |||
| 1312 | Ga0495643_0157021 | |||
| 1313 | Ga0495648_0248428 | |||
| 1314 | Ga0495663_0001938 | |||
| 1315 | Ga0495663_0005439 | |||
| 1316 | Ga0495663_0012906 | |||
| 1317 | Ga0495663_0020929 | |||
| 1318 | Ga0495642_0020745 | |||
| 1319 | Ga0495598_0001583 | |||
| 1320 | Ga0495598_0004737 | |||
| 1321 | Ga0495621_0000192 | |||
| 1322 | Ga0495621_0000663 | |||
| 1323 | Ga0495621_0001981 | |||
| 1324 | Ga0495621_0040803 | |||
| 1325 | Ga0495656_0045745 | |||
| 1326 | Ga0495668_0023283 | |||
| 1327 | Ga0495668_0351566 | |||
| 1328 | Ga0495659_0137784 | |||
| 1329 | Ga0495669_0001958 | |||
| 1330 | Ga0495669_0018660 | |||
| 1331 | Ga0495669_0115404 | |||
| 1332 | Ga0495670_0004749 | |||
| 1333 | Ga0495670_0009667 | |||
| 1334 | Ga0495670_0011968 | |||
| 1335 | Ga0495670_0012922 | |||
| 1336 | Ga0495670_0022080 | |||
| 1337 | Ga0495670_0072902 | |||
| 1338 | Ga0495670_0164929 | |||
| 1339 | Ga0495670_0457927 | |||
| 1340 | Ga0495671_0012364 | |||
| 1341 | Ga0495677_0011626 | |||
| 1342 | Ga0495677_0026603 | |||
| 1343 | Ga0495677_0088994 | |||
| 1344 | Ga0495677_0219876 | |||
| 1345 | Ga0495686_0011963 | |||
| 1346 | Ga0495686_0033202 | |||
| 1347 | Ga0496100_0011477 | |||
| 1348 | Ga0496100_0133797 | |||
| 1349 | Ga0496101_0006133 | |||
| 1350 | Ga0496101_0788591 | |||
| 1351 | Ga0496102_0011902 | |||
| 1352 | Ga0496102_0410000 | |||
| 1353 | Ga0496103_0007460 | |||
| 1354 | Ga0496104_0052883 | |||
| 1355 | Ga0496105_0176987 | |||
| 1356 | Ga0496106_0096457 | |||
| 1357 | Ga0496107_0136152 | |||
| 1358 | Ga0496108_0009287 | |||
| 1359 | Ga0496108_0093207 | |||
| 1360 | Ga0496108_0148969 | |||
| 1361 | Ga0496108_0160072 | |||
| 1362 | Ga0496108_0160524 | |||
| 1363 | Ga0496109_0025022 | |||
| 1364 | Ga0496109_0189105 | |||
| 1365 | Ga0496109_0270701 | |||
| 1366 | Ga0496109_0296127 | |||
| 1367 | Ga0496109_0579821 | |||
| 1368 | Ga0496109_0861740 | |||
| 1369 | Ga0496110_0001263 | |||
| 1370 | Ga0496110_0062492 | |||
| 1371 | Ga0496110_0062554 | |||
| 1372 | Ga0496110_0227642 | |||
| 1373 | Ga0496111_0048679 | |||
| 1374 | Ga0496111_0091696 | |||
| 1375 | Ga0496111_0154839 | |||
| 1376 | Ga0496112_0002632 | |||
| 1377 | Ga0496112_0030831 | |||
| 1378 | Ga0496112_0210169 | |||
| 1379 | Ga0496113_0006758 | |||
| 1380 | Ga0496114_0000162 | |||
| 1381 | Ga0496114_0058111 | |||
| 1382 | Ga0496114_0238578 | |||
| 1383 | Ga0496115_0004744 | |||
| 1384 | Ga0496115_0119673 | |||
| 1385 | Ga0496117_0022181 | |||
| 1386 | Ga0496118_0022469 | |||
| 1387 | Ga0496120_0077568 | |||
| 1388 | Ga0496123_0024686 | |||
| 1389 | Ga0496123_0053440 | |||
| 1390 | Ga0496123_0058940 | |||
| 1391 | Ga0496124_0001482 | |||
| 1392 | Ga0496124_0001624 | |||
| 1393 | Ga0496124_0034492 | |||
| 1394 | Ga0496124_0305370 | |||
| 1395 | Ga0496124_0425799 | |||
| 1396 | Ga0496124_0535388 | |||
| 1397 | Ga0496125_0042523 | |||
| 1398 | Ga0496125_0536931 | |||
| 1399 | Ga0496126_0028362 | |||
| 1400 | Ga0496126_0051801 | |||
| 1401 | Ga0495678_102688 | |||
| 1402 | Ga0501298_023378 | |||
| 1403 | Ga0501043_0004097 | |||
| 1404 | Ga0501046_0025504 | |||
| 1405 | Ga0501047_0001134 | |||
| 1406 | Ga0501207_040193 | |||
| 1407 | Ga0501217_017279 | |||
| 1408 | Ga0501223_006963 | |||
| 1409 | Ga0501227_016740 | |||
| 1410 | Ga0501233_010058 | |||
| 1411 | Ga0501233_100753 | |||
| 1412 | Ga0501235_005040 | |||
| 1413 | Ga0501249_030956 | |||
| 1414 | Ga0501251_035999 | |||
| 1415 | Ga0501259_012502 | |||
| 1416 | Ga0501225_0020960 | |||
| 1417 | Ga0501234_008200 | |||
| 1418 | Ga0501241_041569 | |||
| 1419 | Ga0501273_000883 | |||
| 1420 | Ga0501283_009534 | |||
| 1421 | Ga0501035_0142777 | |||
| 1422 | Ga0501045_0299979 | |||
| 1423 | nmdc:mga03683_31_c1 | |||
| 1424 | nmdc:mga03n38_163525_c1 | |||
| 1425 | nmdc:mga03n38_9541_c1 | |||
| 1426 | nmdc:mga00v17_28068_c1 | |||
| 1427 | nmdc:mga0yw44_69188_c1 | |||
| 1428 | nmdc:mga0k408_391960_c1 | |||
| 1429 | nmdc:mga0k408_91977_c1 | |||
| 1430 | nmdc:mga06z11_9233_c1 | |||
| 1431 | nmdc:mga04h51_416_c1 | |||
| 1432 | nmdc:mga07m45_107_c1 | |||
| 1433 | nmdc:mga07m45_19_c1 | |||
| 1434 | nmdc:mga07m45_77159_c1 | |||
| 1435 | nmdc:mga08y16_192802_c1 | |||
| 1436 | nmdc:mga0a205_670661_c1 | |||
| 1437 | nmdc:mga0sz30_2396_c1 | |||
| 1438 | nmdc:mga0sz30_3472_c1 | |||
| 1439 | Ga0500641_0005368 | |||
| 1440 | Ga0500641_0038642 | |||
| 1441 | Ga0500594_0007662 | |||
| 1442 | Ga0500595_023751 | |||
| 1443 | Ga0500608_000087 | |||
| 1444 | Ga0500658_0002026 | |||
| 1445 | Ga0500559_0034887 | |||
| 1446 | Ga0500568_0017564 | |||
| 1447 | Ga0500604_0073920 | |||
| 1448 | Ga0500616_0118193 | |||
| 1449 | Ga0500567_000445 | |||
| 1450 | Ga0500625_000009 | |||
| 1451 | Ga0500645_015063 | |||
| 1452 | Ga0466962_0114792 | |||
| 1453 | 2738709784 | |||
| 1454 | 2600226864 | |||
| 1455 | 2643727672 | |||
| 1456 | 2644041169 | |||
| 1457 | 2644125495 | |||
| 1458 | 2644394708 | |||
| 1459 | 2738848209 | |||
| 1460 | 2738863938 | |||
| 1461 | 2739296456 | |||
| 1462 | 2739358134 | |||
| 1463 | 2739649379 | |||
| 1464 | 2740027852 | |||
| 1465 | 2753765958 | |||
| 1466 | 2819715688 | |||
| 1467 | 2830078228 | |||
| 1468 | 2848298263 | |||
| 1469 | 2879163376 | |||
| 1470 | 2885427321 | |||
| 1471 | 2896429364 | |||
| 1472 | 2928028553 | |||
| 1473 | 2928101341 | |||
| 1474 | 2928529707 | |||
| 1475 | 2928960248 | |||
| 1476 | 2928970807 | |||
| 1477 | 2946789713 | |||
| 1478 | 2984555870 | |||
| 1479 | 2984566023 | |||
| 1480 | 2990266415 | |||
| 1481 | 2993357032 | |||
| 1482 | 2993695792 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wuf-assembly1.cif.gz_A | structural basis for conductance through tric cation channels | 0.9604 | 11 | 202 |
| 5h36-assembly1.cif.gz_E | crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides | 0.9573 | 8 | 199 |
| 5h36-assembly1.cif.gz_E | crystal structures of the tric trimeric intracellular cation channel orthologue from rhodobacter sphaeroides | 0.943 | 8 | 199 |
| 5wuf-assembly1.cif.gz_A | structural basis for conductance through tric cation channels | 0.9413 | 11 | 202 |
| 5wtr-assembly2.cif.gz_F | crystal structure of a prokaryotic tric channel in 0.5 m kcl | 0.9285 | 11 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AFP0_4_80_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.9243 | 13 | 85 | 1.10.10.1740 |
| af_P0AGM2_4_80_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.9013 | 13 | 85 | 1.10.10.1740 |
| af_P0AGM2_90_165_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.8968 | 13 | 85 | 1.10.10.1740 |
| af_P0AFP0_4_80_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.8687 | 13 | 85 | 1.10.10.1740 |
| af_P0AGM2_90_165_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.8544 | 13 | 85 | 1.10.10.1740 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520WYX6-F1-model_v4 | Trimeric intracellular cation channel family protein | 0.979 | 5 | 206 |
GO:0005886
|
| AF-A0A552UJ46-F1-model_v4 | Trimeric intracellular cation channel family protein | 0.9778 | 11 | 206 |
GO:0005886
|
| AF-A0A252A423-F1-model_v4 | Glycine transporter domain-containing protein | 0.977 | 9 | 206 |
GO:0005886
|
| AF-A0A1F8II99-F1-model_v4 | deleted | 0.9769 | 26 | 206 |
|
| AF-W0A5T5-F1-model_v4 | Glycine transporter domain-containing protein | 0.9768 | 10 | 205 |
GO:0005886
|