F478556

General Info

Members Datasets Scaffolds Average Seq Length
740 325 739 450

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_3031_c1|nmdc:mga05p37_3031_c1_9936_11516
Length 515
Sequence MEKPRLSFWQIWNMSFGFLGIQFGWGLQLANMSAIYTYLGADPDRIPILWLAGPMTGLIVQPIIGSMSDRTWNRLGRRRPYFLVGAILSSIALFFMPDSTALWIAASLLWILDASINVSMEPFRAFVADKLNVEQRTVGFVMQSFFIGIGATLANGLPYLFRQLGVTGRTASGIPLTVQYSFKIGAAAFLLCVLWTVLTSKEYPPENLEEFRRKQAETRGTGGIVGKLINVVREMPQTMKQLAVVQVFTWLGLFCMWMFFGLMTSRHVFGARDPSSARFAEGGEWGGICFAVYSIVCLIVALAFNPMSNTMLCLVTVAIYSVIESFTVFVIHSPWSLTRFVGMAMASCVLVLLVRWMSKAASRKTFHASSLVCGGIGLLSTYLIHDQYVLLLTMVGVGIAWASILSMPYAILSGALPAARMGVYMGIFNFFIVIPEIVASLTFQPLVRYVFNNNPLYVVMLGGASLLVAAALVARVRDVADRITPEVVLAADEHEPFVVPESVQPVPSTGLVDES

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
131 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
228 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
229 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
287 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
288 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
289 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
290 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
291 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
292 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
293 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
294 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
295 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
296 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
297 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
298 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
299 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
300 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
301 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
302 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
303 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
310 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
311 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
324 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 0.81
Rhizosphere 96.76
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000004 3300000549 Bacteria 34891
2 JGI25406J46586_10000597 3300003203 Bacteria 17002
3 JGI25406J46586_10004308 3300003203 Bacteria 6642
4 Ga0065714_10002198 3300005288 Bacteria 90565
5 Ga0065704_10001544 3300005289 Bacteria 8135
6 Ga0065704_10108457 3300005289 Bacteria 2028
7 Ga0065712_10000119 3300005290 Bacteria 137052
8 Ga0065712_10007765 3300005290 Bacteria 4418
9 Ga0065712_10022415 3300005290 Bacteria 1688
10 Ga0065715_10002646 3300005293 Bacteria 4585
11 Ga0065715_10095431 3300005293 Bacteria 4082
12 Ga0065707_10003824 3300005295 Bacteria 3523
13 Ga0065707_10011320 3300005295 Bacteria 3457
14 Ga0070658_10001325 3300005327 Bacteria 21112
15 Ga0070658_10082619 3300005327 Bacteria 2640
16 Ga0070658_10099506 3300005327 Bacteria 2403
17 Ga0070676_10032770 3300005328 Bacteria 2979
18 Ga0070683_100014240 3300005329 Bacteria 6951
19 Ga0070683_100103421 3300005329 Bacteria 2684
20 Ga0070690_100004860 3300005330 Bacteria 7506
21 Ga0070670_100002232 3300005331 Bacteria 15924
22 Ga0070670_100007508 3300005331 Bacteria 9256
23 Ga0070670_100013610 3300005331 Bacteria 6971
24 Ga0070670_100151984 3300005331 Bacteria 2004
25 Ga0068869_100081597 3300005334 Bacteria 2415
26 Ga0070666_10011613 3300005335 Bacteria 5533
27 Ga0070666_10040261 3300005335 Bacteria 3119
28 Ga0070680_100002058 3300005336 Bacteria 14834
29 Ga0070680_100059074 3300005336 Bacteria 3137
30 Ga0070682_100000145 3300005337 Bacteria 56593
31 Ga0070682_100038766 3300005337 Bacteria 2924
32 Ga0070682_100148475 3300005337 Unclassified 1606
33 Ga0068868_100127419 3300005338 Bacteria 2081
34 Ga0070660_100038191 3300005339 Bacteria 3644
35 Ga0070660_100081044 3300005339 Bacteria 2548
36 Ga0070689_100011051 3300005340 Bacteria 6454
37 Ga0070689_100011882 3300005340 Bacteria 6250
38 Ga0070687_100006970 3300005343 Bacteria 4675
39 Ga0070687_100022676 3300005343 Bacteria 2972
40 Ga0070687_100033052 3300005343 Bacteria 2550
41 Ga0070661_100005989 3300005344 Bacteria 8369
42 Ga0070692_10012394 3300005345 Bacteria 3945
43 Ga0070668_100121682 3300005347 Bacteria 2087
44 Ga0070669_100000581 3300005353 Bacteria 27178
45 Ga0070669_100002722 3300005353 Bacteria 12752
46 Ga0070669_100003088 3300005353 Bacteria 11988
47 Ga0070669_100008824 3300005353 Bacteria 7194
48 Ga0070669_100017526 3300005353 Bacteria 5108
49 Ga0070675_100001987 3300005354 Bacteria 15166
50 Ga0070675_100020546 3300005354 Bacteria 5269
51 Ga0070671_100017291 3300005355 Bacteria 5839
52 Ga0070671_100024213 3300005355 Bacteria 4969
53 Ga0070674_100013539 3300005356 Bacteria 5046
54 Ga0070674_100017320 3300005356 Bacteria 4529
55 Ga0070673_100015463 3300005364 Bacteria 5361
56 Ga0070673_100025636 3300005364 Bacteria 4343
57 Ga0070688_100007920 3300005365 Bacteria 5745
58 Ga0070659_100049173 3300005366 Bacteria 3315
59 Ga0070667_100200823 3300005367 Bacteria 1769
60 Ga0070703_10000258 3300005406 Bacteria 25659
61 Ga0070703_10021176 3300005406 Bacteria 1898
62 Ga0070709_10000023 3300005434 Bacteria 132636
63 Ga0070709_10014270 3300005434 Bacteria 4492
64 Ga0070714_100002411 3300005435 Bacteria 13776
65 Ga0070714_100027183 3300005435 Bacteria 4735
66 Ga0070714_100083861 3300005435 Bacteria 2780
67 Ga0070713_100002665 3300005436 Bacteria 11632
68 Ga0070701_10000533 3300005438 Bacteria 13103
69 Ga0070701_10072572 3300005438 Bacteria 1844
70 Ga0070701_10083807 3300005438 Bacteria 1732
71 Ga0070711_100000024 3300005439 Bacteria 117125
72 Ga0070700_100000099 3300005441 Bacteria 56217
73 Ga0070700_100013610 3300005441 Bacteria 4573
74 Ga0070700_100055814 3300005441 Bacteria 2473
75 Ga0070694_100040127 3300005444 Unclassified 3120
76 Ga0070708_100000091 3300005445 Bacteria 59200
77 Ga0070708_100014111 3300005445 Bacteria 6568
78 Ga0070708_100014189 3300005445 Bacteria 6547
79 Ga0070708_100017065 3300005445 Bacteria 6045
80 Ga0070662_100000088 3300005457 Bacteria 50362
81 Ga0070662_100042818 3300005457 Bacteria 3236
82 Ga0070662_100047570 3300005457 Unclassified 3086
83 Ga0070662_100058417 3300005457 Bacteria 2807
84 Ga0070681_10000048 3300005458 Bacteria 82548
85 Ga0070681_10000650 3300005458 Bacteria 28674
86 Ga0070681_10003381 3300005458 Bacteria 14926
87 Ga0070681_10018466 3300005458 Bacteria 6970
88 Ga0070681_10075881 3300005458 Unclassified 3321
89 Ga0070681_10271704 3300005458 Bacteria 1607
90 Ga0068867_100003151 3300005459 Bacteria 11630
91 Ga0068867_100006105 3300005459 Bacteria 8529
92 Ga0070685_10008928 3300005466 Bacteria 5171
93 Ga0070706_100000015 3300005467 Bacteria 188425
94 Ga0070706_100000266 3300005467 Bacteria 63768
95 Ga0070706_100001562 3300005467 Bacteria 23916
96 Ga0070706_100037799 3300005467 Bacteria 4457
97 Ga0070706_100100835 3300005467 Bacteria 2683
98 Ga0070707_100158595 3300005468 Bacteria 2204
99 Ga0070707_100159966 3300005468 Bacteria 2194
100 Ga0070698_100004135 3300005471 Bacteria 15960
101 Ga0070698_100013222 3300005471 Bacteria 8734
102 Ga0070698_100016011 3300005471 Bacteria 7920
103 Ga0070698_100027818 3300005471 Bacteria 5875
104 Ga0070698_100173391 3300005471 Bacteria 2097
105 Ga0070698_100226695 3300005471 Bacteria 1802
106 Ga0070699_100000021 3300005518 Bacteria 164544
107 Ga0070699_100050066 3300005518 Bacteria 3616
108 Ga0070699_100099321 3300005518 Bacteria 2551
109 Ga0070699_100135596 3300005518 Bacteria 2171
110 Ga0070699_100231806 3300005518 Bacteria 1647
111 Ga0070679_100000079 3300005530 Bacteria 72586
112 Ga0070679_100015360 3300005530 Bacteria 7357
113 Ga0070679_100021013 3300005530 Bacteria 6370
114 Ga0070684_100008305 3300005535 Bacteria 8111
115 Ga0070684_100116615 3300005535 Bacteria 2399
116 Ga0070697_100000366 3300005536 Bacteria 35335
117 Ga0070697_100000694 3300005536 Bacteria 25190
118 Ga0070697_100008900 3300005536 Bacteria 7841
119 Ga0070697_100032897 3300005536 Bacteria 4175
120 Ga0070697_100086956 3300005536 Bacteria 2580
121 Ga0070697_100104179 3300005536 Bacteria 2359
122 Ga0070697_100113280 3300005536 Bacteria 2263
123 Ga0070697_100146986 3300005536 Unclassified 1985
124 Ga0070697_100268444 3300005536 Bacteria 1462
125 Ga0068853_100000011 3300005539 Bacteria 246709
126 Ga0068853_100006085 3300005539 Bacteria 9553
127 Ga0070672_100001164 3300005543 Bacteria 16038
128 Ga0070672_100012675 3300005543 Bacteria 5932
129 Ga0070686_100007820 3300005544 Bacteria 5975
130 Ga0070695_100038698 3300005545 Bacteria 3012
131 Ga0070695_100096163 3300005545 Bacteria 1986
132 Ga0070696_100002421 3300005546 Bacteria 12364
133 Ga0070696_100084178 3300005546 Bacteria 2256
134 Ga0070696_100085918 3300005546 Bacteria 2233
135 Ga0070693_100004171 3300005547 Bacteria 6819
136 Ga0070693_100013626 3300005547 Bacteria 4146
137 Ga0070693_100032371 3300005547 Bacteria 2875
138 Ga0070693_100032742 3300005547 Bacteria 2862
139 Ga0070665_100036053 3300005548 Bacteria 4976
140 Ga0070665_100037131 3300005548 Bacteria 4900
141 Ga0070665_100049517 3300005548 Bacteria 4215
142 Ga0070665_100074853 3300005548 Bacteria 3392
143 Ga0070704_100026646 3300005549 Bacteria 3824
144 Ga0068855_100302784 3300005563 Bacteria 1770
145 Ga0070664_100050391 3300005564 Bacteria 3523
146 Ga0070664_100144177 3300005564 Bacteria 2099
147 Ga0070664_100231305 3300005564 Bacteria 1657
148 Ga0068857_100007858 3300005577 Bacteria 9199
149 Ga0068857_100019588 3300005577 Bacteria 5943
150 Ga0068857_100023990 3300005577 Bacteria 5369
151 Ga0068857_100052018 3300005577 Bacteria 3634
152 Ga0068857_100059506 3300005577 Bacteria 3393
153 Ga0068857_100071833 3300005577 Bacteria 3084
154 Ga0068854_100033576 3300005578 Unclassified 3578
155 Ga0068854_100096313 3300005578 Bacteria 2211
156 Ga0068856_100006040 3300005614 Bacteria 11906
157 Ga0070702_100017626 3300005615 Bacteria 3688
158 Ga0070702_100061313 3300005615 Bacteria 2190
159 Ga0070702_100121564 3300005615 Bacteria 1636
160 Ga0068852_100137429 3300005616 Unclassified 2258
161 Ga0068859_100029764 3300005617 Bacteria 5479
162 Ga0068859_100043506 3300005617 Bacteria 4513
163 Ga0068859_100167063 3300005617 Unclassified 2280
164 Ga0068859_100267687 3300005617 Bacteria 1801
165 Ga0068859_100270501 3300005617 Bacteria 1791
166 Ga0068864_100021543 3300005618 Bacteria 5399
167 Ga0068864_100089887 3300005618 Bacteria 2706
168 Ga0068864_100244746 3300005618 Bacteria 1663
169 Ga0068866_10108567 3300005718 Bacteria 1544
170 Ga0068861_100001695 3300005719 Bacteria 14147
171 Ga0068861_100004364 3300005719 Bacteria 9487
172 Ga0068861_100006547 3300005719 Bacteria 7948
173 Ga0068861_100009333 3300005719 Bacteria 6771
174 Ga0068861_100014416 3300005719 Bacteria 5549
175 Ga0068861_100021342 3300005719 Bacteria 4654
176 Ga0068870_10009123 3300005840 Bacteria 4494
177 Ga0068863_100134993 3300005841 Unclassified 2357
178 Ga0068858_100059034 3300005842 Bacteria 3545
179 Ga0068858_100062291 3300005842 Bacteria 3449
180 Ga0068858_100092522 3300005842 Bacteria 2815
181 Ga0068858_100100933 3300005842 Bacteria 2691
182 Ga0068860_100005979 3300005843 Bacteria 12248
183 Ga0068860_100025860 3300005843 Bacteria 5662
184 Ga0068860_100059954 3300005843 Bacteria 3617
185 Ga0068862_100000865 3300005844 Bacteria 29644
186 Ga0068862_100013332 3300005844 Bacteria 6800
187 Ga0068862_100017780 3300005844 Bacteria 5918
188 Ga0068862_100024013 3300005844 Bacteria 5110
189 Ga0068862_100048770 3300005844 Unclassified 3615
190 Ga0068862_100059699 3300005844 Bacteria 3275
191 Ga0068862_100123294 3300005844 Bacteria 2286
192 Ga0081540_1034260 3300005983 Bacteria 2742
193 Ga0081539_10000073 3300005985 Bacteria 231470
194 Ga0081539_10000898 3300005985 Bacteria 56680
195 Ga0081539_10001369 3300005985 Bacteria 42259
196 Ga0081539_10007977 3300005985 Bacteria 9414
197 Ga0081539_10054186 3300005985 Bacteria 2241
198 Ga0070717_10004414 3300006028 Bacteria 10153
199 Ga0075365_10016339 3300006038 Bacteria 4512
200 Ga0070715_10000002 3300006163 Bacteria 389554
201 Ga0070716_100000010 3300006173 Bacteria 157261
202 Ga0070712_100071862 3300006175 Bacteria 2477
203 Ga0075367_10011831 3300006178 Bacteria 4634
204 Ga0075366_10000251 3300006195 Bacteria 23598
205 Ga0097621_100017758 3300006237 Bacteria 5413
206 Ga0068871_100003645 3300006358 Bacteria 10581
207 Ga0068871_100124043 3300006358 Bacteria 2184
208 Ga0068871_100144608 3300006358 Bacteria 2023
209 Ga0068871_100192142 3300006358 Bacteria 1759
210 Ga0075428_100011220 3300006844 Bacteria 9971
211 Ga0075428_100013356 3300006844 Bacteria 9133
212 Ga0075430_100006705 3300006846 Bacteria 9712
213 Ga0075430_100011532 3300006846 Bacteria 7512
214 Ga0075430_100013476 3300006846 Bacteria 6969
215 Ga0075430_100015750 3300006846 Bacteria 6439
216 Ga0075430_100019708 3300006846 Bacteria 5738
217 Ga0075430_100043930 3300006846 Bacteria 3779
218 Ga0075430_100093201 3300006846 Bacteria 2518
219 Ga0075430_100128861 3300006846 Bacteria 2109
220 Ga0075431_100003521 3300006847 Bacteria 15169
221 Ga0075431_100019334 3300006847 Bacteria 6943
222 Ga0075431_100053313 3300006847 Bacteria 4170
223 Ga0075431_100056685 3300006847 Bacteria 4041
224 Ga0075431_100098481 3300006847 Bacteria 3019
225 Ga0075431_100202087 3300006847 Bacteria 2033
226 Ga0075433_10011742 3300006852 Bacteria 7053
227 Ga0075433_10036926 3300006852 Bacteria 4211
228 Ga0075433_10055537 3300006852 Bacteria 3457
229 Ga0075433_10090815 3300006852 Bacteria 2700
230 Ga0075433_10146047 3300006852 Bacteria 2102
231 Ga0075434_100007923 3300006871 Bacteria 9845
232 Ga0075434_100087780 3300006871 Bacteria 3111
233 Ga0075434_100103085 3300006871 Bacteria 2861
234 Ga0075434_100130516 3300006871 Bacteria 2531
235 Ga0075434_100221205 3300006871 Bacteria 1913
236 Ga0075429_100011715 3300006880 Bacteria 7606
237 Ga0075429_100045841 3300006880 Bacteria 3804
238 Ga0075429_100053028 3300006880 Bacteria 3529
239 Ga0075429_100194729 3300006880 Bacteria 1775
240 Ga0068865_100025715 3300006881 Bacteria 3876
241 Ga0068865_100034608 3300006881 Bacteria 3391
242 Ga0068865_100050625 3300006881 Bacteria 2870
243 Ga0068865_100068133 3300006881 Bacteria 2515
244 Ga0075436_100000006 3300006914 Bacteria 306066
245 Ga0075436_100007044 3300006914 Bacteria 7697
246 Ga0075436_100022879 3300006914 Bacteria 4293
247 Ga0075436_100063125 3300006914 Bacteria 2560
248 Ga0075436_100068084 3300006914 Bacteria 2460
249 Ga0097620_100029764 3300006931 Bacteria 5479
250 Ga0097620_100043504 3300006931 Bacteria 4513
251 Ga0097620_100167063 3300006931 Unclassified 2280
252 Ga0097620_100267708 3300006931 Bacteria 1801
253 Ga0097620_100270484 3300006931 Bacteria 1791
254 Ga0075435_100002065 3300007076 Bacteria 13165
255 Ga0075435_100052016 3300007076 Bacteria 3300
256 Ga0075435_100072136 3300007076 Bacteria 2821
257 Ga0075435_100099353 3300007076 Bacteria 2410
258 Ga0105251_10089602 3300009011 Bacteria 1414
259 Ga0105240_10000186 3300009093 Bacteria 126271
260 Ga0105240_10017556 3300009093 Bacteria 9640
261 Ga0105240_10036231 3300009093 Bacteria 6348
262 Ga0105240_10083110 3300009093 Bacteria 3930
263 Ga0105240_10178981 3300009093 Bacteria 2504
264 Ga0111539_10000333 3300009094 Bacteria 57916
265 Ga0111539_10005719 3300009094 Bacteria 16078
266 Ga0111539_10012815 3300009094 Bacteria 10494
267 Ga0111539_10045812 3300009094 Bacteria 5234
268 Ga0111539_10072169 3300009094 Bacteria 4072
269 Ga0111539_10196841 3300009094 Bacteria 2350
270 Ga0105245_10059275 3300009098 Bacteria 3447
271 Ga0105247_10001245 3300009101 Bacteria 18879
272 Ga0114129_10009296 3300009147 Bacteria 14018
273 Ga0114129_10035088 3300009147 Bacteria 7086
274 Ga0114129_10046930 3300009147 Bacteria 6070
275 Ga0114129_10046934 3300009147 Bacteria 6070
276 Ga0114129_10062700 3300009147 Bacteria 5193
277 Ga0114129_10069480 3300009147 Bacteria 4910
278 Ga0114129_10102962 3300009147 Bacteria 3948
279 Ga0114129_10107181 3300009147 Bacteria 3859
280 Ga0114129_10114211 3300009147 Bacteria 3723
281 Ga0114129_10116295 3300009147 Bacteria 3685
282 Ga0114129_10209077 3300009147 Bacteria 2639
283 Ga0114129_10390341 3300009147 Bacteria 1836
284 Ga0114129_10459301 3300009147 Bacteria 1669
285 Ga0114129_10495538 3300009147 Bacteria 1596
286 Ga0114129_10614550 3300009147 Bacteria 1407
287 Ga0105243_10000349 3300009148 Bacteria 49476
288 Ga0105241_10037066 3300009174 Unclassified 3672
289 Ga0105241_10060016 3300009174 Bacteria 2925
290 Ga0105241_10175575 3300009174 Bacteria 1773
291 Ga0105242_10001577 3300009176 Bacteria 17916
292 Ga0105242_10051803 3300009176 Bacteria 3347
293 Ga0105242_10141489 3300009176 Bacteria 2088
294 Ga0105248_10006052 3300009177 Bacteria 13277
295 Ga0105248_10016065 3300009177 Bacteria 8240
296 Ga0105248_10022916 3300009177 Bacteria 6934
297 Ga0105248_10056492 3300009177 Bacteria 4404
298 Ga0105248_10126036 3300009177 Bacteria 2889
299 Ga0105237_10077187 3300009545 Bacteria 3321
300 Ga0105237_10153476 3300009545 Bacteria 2299
301 Ga0105238_10000193 3300009551 Bacteria 67265
302 Ga0105238_10001447 3300009551 Bacteria 23857
303 Ga0105249_10000407 3300009553 Bacteria 41419
304 Ga0105249_10001505 3300009553 Bacteria 20441
305 Ga0105249_10004552 3300009553 Bacteria 11978
306 Ga0105249_10014919 3300009553 Bacteria 6874
307 Ga0105249_10043675 3300009553 Bacteria 4076
308 Ga0105249_10099497 3300009553 Bacteria 2733
309 Ga0105239_10013822 3300010375 Bacteria 8958
310 Ga0105239_10148508 3300010375 Bacteria 2615
311 Ga0105239_10199354 3300010375 Bacteria 2242
312 Ga0105239_10271134 3300010375 Bacteria 1909
313 Ga0105246_10021264 3300011119 Bacteria 4173
314 Ga0105246_10087284 3300011119 Bacteria 2239
315 Ga0157373_10038367 3300013100 Unclassified 3434
316 Ga0157373_10044151 3300013100 Bacteria 3182
317 Ga0157373_10080386 3300013100 Bacteria 2298
318 Ga0157371_10015567 3300013102 Bacteria 5702
319 Ga0157370_10027101 3300013104 Bacteria 5651
320 Ga0157370_10129570 3300013104 Bacteria 2354
321 Ga0157369_10003038 3300013105 Bacteria 20027
322 Ga0157369_10077923 3300013105 Bacteria 3551
323 Ga0157374_10001619 3300013296 Bacteria 18883
324 Ga0157374_10100933 3300013296 Bacteria 2767
325 Ga0157378_10000094 3300013297 Bacteria 84481
326 Ga0157378_10008075 3300013297 Bacteria 9185
327 Ga0157378_10134123 3300013297 Bacteria 2295
328 Ga0163162_10013334 3300013306 Bacteria 8029
329 Ga0163162_10020999 3300013306 Bacteria 6424
330 Ga0163162_10047730 3300013306 Bacteria 4290
331 Ga0163162_10049121 3300013306 Bacteria 4228
332 Ga0163162_10066928 3300013306 Unclassified 3642
333 Ga0163162_10252759 3300013306 Bacteria 1894
334 Ga0157372_10027079 3300013307 Bacteria 6240
335 Ga0157372_10115014 3300013307 Unclassified 3084
336 Ga0157375_10000943 3300013308 Bacteria 25210
337 Ga0157375_10008016 3300013308 Bacteria 9248
338 Ga0157375_10023014 3300013308 Bacteria 5743
339 Ga0157375_10040454 3300013308 Bacteria 4493
340 Ga0157375_10052445 3300013308 Bacteria 4010
341 Ga0157375_10053440 3300013308 Unclassified 3974
342 Ga0157375_10065650 3300013308 Bacteria 3618
343 Ga0157375_10109318 3300013308 Bacteria 2861
344 Ga0163163_10000696 3300014325 Bacteria 28562
345 Ga0163163_10076031 3300014325 Bacteria 3352
346 Ga0163163_10091911 3300014325 Bacteria 3049
347 Ga0163163_10123771 3300014325 Bacteria 2622
348 Ga0163163_10168698 3300014325 Bacteria 2235
349 Ga0163163_10281418 3300014325 Bacteria 1715
350 Ga0157380_10000250 3300014326 Bacteria 32403
351 Ga0157380_10006205 3300014326 Bacteria 8390
352 Ga0157380_10090955 3300014326 Bacteria 2518
353 Ga0157377_10065686 3300014745 Bacteria 2085
354 Ga0157379_10019834 3300014968 Bacteria 5940
355 Ga0157379_10042065 3300014968 Bacteria 4078
356 Ga0157379_10131855 3300014968 Bacteria 2250
357 Ga0157379_10145582 3300014968 Bacteria 2137
358 Ga0157376_10102763 3300014969 Bacteria 2501
359 Ga0213872_10001600 3300021361 Bacteria 14378
360 Ga0213876_10000031 3300021384 Bacteria 213087
361 Ga0213876_10000295 3300021384 Bacteria 45211
362 Ga0213875_10010731 3300021388 Bacteria 4582
363 Ga0224570_100607 3300022730 Bacteria 2854
364 Ga0224572_1002888 3300024225 Bacteria 2835
365 Ga0207697_10000190 3300025315 Bacteria 32223
366 Ga0207697_10002830 3300025315 Bacteria 8827
367 Ga0207653_10000334 3300025885 Bacteria 24824
368 Ga0207653_10005723 3300025885 Bacteria 3876
369 Ga0207710_10002083 3300025900 Bacteria 9475
370 Ga0207688_10037931 3300025901 Bacteria 2674
371 Ga0207688_10041810 3300025901 Bacteria 2550
372 Ga0207680_10062908 3300025903 Bacteria 2269
373 Ga0207647_10000808 3300025904 Bacteria 24255
374 Ga0207685_10000030 3300025905 Bacteria 89606
375 Ga0207699_10000008 3300025906 Bacteria 358402
376 Ga0207699_10022728 3300025906 Bacteria 3403
377 Ga0207645_10001781 3300025907 Bacteria 17423
378 Ga0207645_10024826 3300025907 Bacteria 3883
379 Ga0207643_10005175 3300025908 Bacteria 6974
380 Ga0207643_10009782 3300025908 Bacteria 5148
381 Ga0207643_10110189 3300025908 Bacteria 1622
382 Ga0207705_10020405 3300025909 Bacteria 4737
383 Ga0207705_10196097 3300025909 Bacteria 1529
384 Ga0207684_10000083 3300025910 Bacteria 176092
385 Ga0207684_10002321 3300025910 Bacteria 19314
386 Ga0207684_10016018 3300025910 Bacteria 6438
387 Ga0207684_10036389 3300025910 Bacteria 4178
388 Ga0207684_10057563 3300025910 Bacteria 3298
389 Ga0207684_10128153 3300025910 Bacteria 2178
390 Ga0207654_10082444 3300025911 Bacteria 1939
391 Ga0207707_10000015 3300025912 Bacteria 259670
392 Ga0207707_10018498 3300025912 Bacteria 6073
393 Ga0207707_10034305 3300025912 Bacteria 4439
394 Ga0207707_10081821 3300025912 Bacteria 2819
395 Ga0207695_10000281 3300025913 Bacteria 126279
396 Ga0207695_10013523 3300025913 Bacteria 9727
397 Ga0207695_10237259 3300025913 Bacteria 1726
398 Ga0207671_10002504 3300025914 Bacteria 19603
399 Ga0207671_10024229 3300025914 Bacteria 4567
400 Ga0207693_10040532 3300025915 Bacteria 3668
401 Ga0207693_10042582 3300025915 Bacteria 3574
402 Ga0207663_10000012 3300025916 Bacteria 167739
403 Ga0207660_10068881 3300025917 Bacteria 2568
404 Ga0207660_10111099 3300025917 Bacteria 2063
405 Ga0207662_10000992 3300025918 Bacteria 13239
406 Ga0207662_10001313 3300025918 Bacteria 11980
407 Ga0207662_10005114 3300025918 Bacteria 6959
408 Ga0207662_10075226 3300025918 Bacteria 2051
409 Ga0207662_10165823 3300025918 Bacteria 1414
410 Ga0207657_10024758 3300025919 Bacteria 5549
411 Ga0207657_10027742 3300025919 Bacteria 5180
412 Ga0207649_10035092 3300025920 Bacteria 3011
413 Ga0207649_10072843 3300025920 Bacteria 2199
414 Ga0207652_10002603 3300025921 Bacteria 15145
415 Ga0207646_10112880 3300025922 Bacteria 2439
416 Ga0207646_10133037 3300025922 Bacteria 2239
417 Ga0207681_10004151 3300025923 Bacteria 8976
418 Ga0207681_10024632 3300025923 Bacteria 3863
419 Ga0207681_10025857 3300025923 Bacteria 3781
420 Ga0207681_10029013 3300025923 Bacteria 3588
421 Ga0207681_10047651 3300025923 Bacteria 2889
422 Ga0207681_10074069 3300025923 Bacteria 2384
423 Ga0207694_10000150 3300025924 Bacteria 71968
424 Ga0207694_10004881 3300025924 Bacteria 10416
425 Ga0207650_10099355 3300025925 Bacteria 2237
426 Ga0207700_10001659 3300025928 Bacteria 12652
427 Ga0207700_10181193 3300025928 Bacteria 1764
428 Ga0207664_10002367 3300025929 Bacteria 12455
429 Ga0207664_10196822 3300025929 Bacteria 1738
430 Ga0207644_10016062 3300025931 Bacteria 5034
431 Ga0207644_10048849 3300025931 Bacteria 3027
432 Ga0207644_10053911 3300025931 Bacteria 2895
433 Ga0207706_10000527 3300025933 Bacteria 40589
434 Ga0207706_10007513 3300025933 Bacteria 10084
435 Ga0207706_10048274 3300025933 Bacteria 3765
436 Ga0207706_10216389 3300025933 Unclassified 1678
437 Ga0207686_10002076 3300025934 Bacteria 11039
438 Ga0207709_10000896 3300025935 Bacteria 22507
439 Ga0207709_10003673 3300025935 Bacteria 9035
440 Ga0207709_10180753 3300025935 Bacteria 1489
441 Ga0207670_10006870 3300025936 Bacteria 6332
442 Ga0207669_10010393 3300025937 Bacteria 4479
443 Ga0207704_10124958 3300025938 Bacteria 1769
444 Ga0207665_10000010 3300025939 Bacteria 157219
445 Ga0207691_10049983 3300025940 Bacteria 3829
446 Ga0207691_10060961 3300025940 Bacteria 3427
447 Ga0207691_10065326 3300025940 Bacteria 3294
448 Ga0207691_10158067 3300025940 Bacteria 1990
449 Ga0207711_10006273 3300025941 Bacteria 10030
450 Ga0207711_10054349 3300025941 Bacteria 3436
451 Ga0207689_10010447 3300025942 Bacteria 7993
452 Ga0207689_10010745 3300025942 Bacteria 7879
453 Ga0207689_10013421 3300025942 Bacteria 6994
454 Ga0207689_10052950 3300025942 Bacteria 3343
455 Ga0207689_10092824 3300025942 Bacteria 2480
456 Ga0207661_10051129 3300025944 Bacteria 3296
457 Ga0207679_10009018 3300025945 Bacteria 6374
458 Ga0207679_10022647 3300025945 Bacteria 4281
459 Ga0207679_10025447 3300025945 Bacteria 4070
460 Ga0207679_10058237 3300025945 Bacteria 2861
461 Ga0207679_10194129 3300025945 Bacteria 1691
462 Ga0207667_10040300 3300025949 Bacteria 4974
463 Ga0207667_10255884 3300025949 Bacteria 1791
464 Ga0207651_10213341 3300025960 Bacteria 1555
465 Ga0207712_10000737 3300025961 Bacteria 24808
466 Ga0207712_10000878 3300025961 Bacteria 21874
467 Ga0207712_10001491 3300025961 Bacteria 15886
468 Ga0207712_10017399 3300025961 Bacteria 4667
469 Ga0207712_10139610 3300025961 Bacteria 1858
470 Ga0207668_10128492 3300025972 Bacteria 1931
471 Ga0207640_10230789 3300025981 Bacteria 1424
472 Ga0207658_10018382 3300025986 Bacteria 4827
473 Ga0207677_10043608 3300026023 Bacteria 2983
474 Ga0207677_10054384 3300026023 Bacteria 2731
475 Ga0207639_10000019 3300026041 Bacteria 246728
476 Ga0207639_10028051 3300026041 Unclassified 4106
477 Ga0207639_10062495 3300026041 Bacteria 2880
478 Ga0207678_10070087 3300026067 Bacteria 3006
479 Ga0207678_10092136 3300026067 Bacteria 2590
480 Ga0207708_10024183 3300026075 Unclassified 4593
481 Ga0207708_10026489 3300026075 Bacteria 4389
482 Ga0207702_10043753 3300026078 Bacteria 3761
483 Ga0207648_10000296 3300026089 Bacteria 54157
484 Ga0207648_10012629 3300026089 Bacteria 7900
485 Ga0207648_10024695 3300026089 Bacteria 5361
486 Ga0207648_10173314 3300026089 Unclassified 1907
487 Ga0207676_10031044 3300026095 Bacteria 4015
488 Ga0207676_10050181 3300026095 Bacteria 3251
489 Ga0207676_10138172 3300026095 Bacteria 2082
490 Ga0207674_10006330 3300026116 Bacteria 13942
491 Ga0207674_10010797 3300026116 Bacteria 10297
492 Ga0207674_10034076 3300026116 Bacteria 5325
493 Ga0207674_10065914 3300026116 Bacteria 3649
494 Ga0207674_10098551 3300026116 Bacteria 2906
495 Ga0207674_10287799 3300026116 Bacteria 1592
496 Ga0207675_100001216 3300026118 Bacteria 25684
497 Ga0207675_100003058 3300026118 Bacteria 16405
498 Ga0207675_100024358 3300026118 Bacteria 5628
499 Ga0207675_100084477 3300026118 Bacteria 2979
500 Ga0207683_10008228 3300026121 Bacteria 8922
501 Ga0207428_10000665 3300027907 Bacteria 40252
502 Ga0207428_10003354 3300027907 Bacteria 15564
503 Ga0207428_10045502 3300027907 Bacteria 3534
504 Ga0207428_10077553 3300027907 Bacteria 2601
505 Ga0265356_1001451 3300028017 Bacteria 3506
506 Ga0268266_10025358 3300028379 Bacteria 5043
507 Ga0268266_10026792 3300028379 Bacteria 4905
508 Ga0268266_10133048 3300028379 Bacteria 2226
509 Ga0268265_10001765 3300028380 Bacteria 17368
510 Ga0268265_10089173 3300028380 Bacteria 2459
511 Ga0268264_10053326 3300028381 Unclassified 3373
512 Ga0268264_10070007 3300028381 Bacteria 2969
513 Ga0268264_10070920 3300028381 Bacteria 2950
514 Ga0265332_10030549 3300031238 Bacteria 2353
515 Ga0265325_10000457 3300031241 Bacteria 29473
516 Ga0265325_10011149 3300031241 Bacteria 5174
517 Ga0265339_10005958 3300031249 Bacteria 8060
518 Ga0265327_10022303 3300031251 Bacteria 3791
519 Ga0265327_10076793 3300031251 Bacteria 1659
520 Ga0265316_10001737 3300031344 Bacteria 23108
521 Ga0265316_10067967 3300031344 Bacteria 2755
522 Ga0307513_10004115 3300031456 Bacteria 19495
523 Ga0307408_100003574 3300031548 Bacteria 10593
524 Ga0307408_100008937 3300031548 Bacteria 6618
525 Ga0307408_100162349 3300031548 Bacteria 1776
526 Ga0307408_100204466 3300031548 Bacteria 1601
527 Ga0265313_10018326 3300031595 Bacteria 3935
528 Ga0316576_10014082 3300031727 Bacteria 5334
529 Ga0307405_10031153 3300031731 Bacteria 3136
530 Ga0307405_10034757 3300031731 Bacteria 3003
531 Ga0307413_10009277 3300031824 Bacteria 4701
532 Ga0307413_10062488 3300031824 Bacteria 2304
533 Ga0307410_10000762 3300031852 Bacteria 13535
534 Ga0307410_10002630 3300031852 Bacteria 8746
535 Ga0307410_10061201 3300031852 Bacteria 2576
536 Ga0307410_10172888 3300031852 Bacteria 1629
537 Ga0307406_10003162 3300031901 Bacteria 8958
538 Ga0307406_10007552 3300031901 Bacteria 6034
539 Ga0307406_10092021 3300031901 Bacteria 2044
540 Ga0307406_10121851 3300031901 Bacteria 1815
541 Ga0307407_10107650 3300031903 Bacteria 1744
542 Ga0307412_10003206 3300031911 Bacteria 9090
543 Ga0307412_10050550 3300031911 Bacteria 2744
544 Ga0307409_100006099 3300031995 Bacteria 7044
545 Ga0307409_100020708 3300031995 Bacteria 4490
546 Ga0307409_100030746 3300031995 Bacteria 3864
547 Ga0307409_100051939 3300031995 Bacteria 3140
548 Ga0307409_100101220 3300031995 Bacteria 2390
549 Ga0307416_100003301 3300032002 Bacteria 9438
550 Ga0307416_100067954 3300032002 Bacteria 2942
551 Ga0307416_100099182 3300032002 Bacteria 2529
552 Ga0307416_100100048 3300032002 Bacteria 2520
553 Ga0307414_10001981 3300032004 Bacteria 10622
554 Ga0307414_10236942 3300032004 Bacteria 1508
555 Ga0307411_10003967 3300032005 Bacteria 6991
556 Ga0307411_10095498 3300032005 Bacteria 2087
557 Ga0307415_100006040 3300032126 Bacteria 6489
558 Ga0373926_0001478 3300035083 Bacteria 7174
559 Ga0373944_0012820 3300035089 Bacteria 2316
560 Ga0373951_0012962 3300035091 Bacteria 1874
561 Ga0373939_0027816 3300035114 Bacteria 1605
562 Ga0373941_0016135 3300035115 Bacteria 2025
563 Ga0373945_0019222 3300035116 Bacteria 2331
564 Ga0373956_0048735 3300035119 Bacteria 1898
565 Ga0373943_0002406 3300035170 Bacteria 8483
566 Ga0373946_0009803 3300035171 Bacteria 3537
567 Ga0316574_0022811 3300035398 Bacteria 3732
568 Ga0373935_0020467 3300035692 Bacteria 4044
569 Ga0373927_0001502 3300035695 Bacteria 17563
570 Ga0373927_0007658 3300035695 Bacteria 7307
571 Ga0373927_0009011 3300035695 Bacteria 6700
572 Ga0373927_0130569 3300035695 Bacteria 1641
573 Ga0373947_0013582 3300035725 Bacteria 4665
574 Ga0373947_0014764 3300035725 Bacteria 4481
575 Ga0373937_0050393 3300036401 Bacteria 3814
576 Ga0316584_0039502 3300036712 Bacteria 3513
577 Ga0373925_0013499 3300037068 Bacteria 5913
578 Ga0395899_0085733 3300037312 Bacteria 2289
579 Ga0395900_0001406 3300037418 Bacteria 28805
580 Ga0395898_0027895 3300037466 Bacteria 5662
581 Ga0395898_0134230 3300037466 Bacteria 2370
582 Ga0395905_0008205 3300037471 Bacteria 10315
583 Ga0395905_0060560 3300037471 Bacteria 3540
584 Ga0395905_0223554 3300037471 Bacteria 1762
585 Ga0436364_1339265 3300037853 Bacteria 10176
586 Ga0395901_0022256 3300038443 Bacteria 6494
587 Ga0436365_0882969 3300039437 Bacteria 184313
588 Ga0436365_1601972 3300039437 Bacteria 65837
589 Ga0436365_1783306 3300039437 Bacteria 2057
590 Ga0436361_0881637 3300039447 Bacteria 23287
591 Ga0436363_0991061 3300039450 Bacteria 8326
592 Ga0439458_0008559 3300042157 Bacteria 2280
593 Ga0451577_0000005 3300042876 Bacteria 712599
594 Ga0451577_0004971 3300042876 Bacteria 13796
595 Ga0451577_0020861 3300042876 Bacteria 6005
596 Ga0451577_0088818 3300042876 Bacteria 2758
597 Ga0466969_0022523 3300044656 Bacteria 3252
598 Ga0453683_0012241 3300044673 Bacteria 5629
599 Ga0466961_0008116 3300044693 Bacteria 6684
600 Ga0466961_0027151 3300044693 Bacteria 3681
601 Ga0466963_0056409 3300044694 Bacteria 2614
602 Ga0453684_0001014 3300044712 Bacteria 90517
603 Ga0453684_0010740 3300044712 Bacteria 15557
604 Ga0453684_0022578 3300044712 Bacteria 9324
605 Ga0466959_0059697 3300045049 Bacteria 2777
606 Ga0451576_0060963 3300045051 Bacteria 3935
607 Ga0466967_0049638 3300045976 Bacteria 3670
608 Ga0495629_0015341 3300046459 Bacteria 5502
609 Ga0495641_0005278 3300046461 Bacteria 8783
610 Ga0495580_0023592 3300046472 Bacteria 4515
611 Ga0495580_0025509 3300046472 Bacteria 4320
612 Ga0495580_0042715 3300046472 Bacteria 3228
613 Ga0495582_0030464 3300046473 Bacteria 2962
614 Ga0495639_0000589 3300046475 Bacteria 16934
615 Ga0495594_0099485 3300046499 Bacteria 1635
616 Ga0495630_0001355 3300046517 Bacteria 16842
617 Ga0495630_0052697 3300046517 Bacteria 3046
618 Ga0495630_0148017 3300046517 Bacteria 1786
619 Ga0495643_0000069 3300046522 Bacteria 172047
620 Ga0495663_0000834 3300046525 Bacteria 10567
621 Ga0495666_0065026 3300046526 Bacteria 1740
622 Ga0495665_0002050 3300046531 Bacteria 10911
623 Ga0495665_0026803 3300046531 Bacteria 3095
624 Ga0495586_0040548 3300046535 Bacteria 2506
625 Ga0495598_0000152 3300046537 Bacteria 11830
626 Ga0495621_0000280 3300046539 Bacteria 12303
627 Ga0495634_0024532 3300046642 Bacteria 4230
628 Ga0495588_0002108 3300046674 Bacteria 8537
629 Ga0495658_0001117 3300046683 Bacteria 14199
630 Ga0495658_0001171 3300046683 Bacteria 13838
631 Ga0495669_0033350 3300046684 Bacteria 2266
632 Ga0495613_0010333 3300046689 Bacteria 6933
633 Ga0495581_0000780 3300047315 Bacteria 16930
634 Ga0495581_0012547 3300047315 Bacteria 4909
635 Ga0495672_0000500 3300047320 Bacteria 45343
636 Ga0495676_0074834 3300047321 Bacteria 2592
637 Ga0495593_0000587 3300047673 Bacteria 20755
638 Ga0495614_0000014 3300048089 Bacteria 56596
639 Ga0495614_0056773 3300048089 Bacteria 1681
640 Ga0496102_0070132 3300048905 Bacteria 3218
641 Ga0496112_0063908 3300048915 Bacteria 3631
642 Ga0496112_0245131 3300048915 Bacteria 1744
643 Ga0496112_0293806 3300048915 Bacteria 1571
644 Ga0496112_0381775 3300048915 Bacteria 1350
645 Ga0496113_0194176 3300048916 Bacteria 1612
646 Ga0501298_010840 3300049521 Bacteria 1574
647 Ga0501031_0000122 3300049568 Bacteria 42868
648 Ga0501032_0027405 3300049569 Bacteria 3915
649 Ga0501033_0022595 3300049570 Bacteria 4745
650 Ga0501038_0002371 3300049574 Bacteria 17541
651 Ga0501038_0120263 3300049574 Bacteria 2167
652 Ga0501039_0058291 3300049575 Bacteria 2991
653 Ga0501041_0032028 3300049577 Bacteria 3178
654 Ga0501046_0061178 3300049580 Bacteria 2945
655 Ga0501046_0219975 3300049580 Bacteria 1406
656 Ga0501073_0056674 3300049589 Bacteria 2741
657 Ga0501075_0051560 3300049591 Bacteria 3094
658 Ga0501076_0051770 3300049592 Bacteria 3251
659 Ga0501077_0053904 3300049593 Bacteria 2554
660 Ga0501198_005752 3300049649 Bacteria 1752
661 Ga0501202_004237 3300049652 Bacteria 2506
662 Ga0501207_002489 3300049654 Bacteria 2385
663 Ga0501216_002400 3300049660 Bacteria 2656
664 Ga0501217_000124 3300049661 Bacteria 10177
665 Ga0501217_012307 3300049661 Bacteria 1904
666 Ga0501223_003737 3300049663 Bacteria 3290
667 Ga0501224_002117 3300049664 Bacteria 2691
668 Ga0501227_002821 3300049665 Bacteria 3813
669 Ga0501227_019704 3300049665 Bacteria 1540
670 Ga0501233_002582 3300049668 Bacteria 3201
671 Ga0501235_004623 3300049669 Bacteria 2976
672 Ga0501243_006991 3300049675 Bacteria 1719
673 Ga0501257_007181 3300049686 Bacteria 2486
674 Ga0501225_0000940 3300049705 Bacteria 9087
675 Ga0501229_001976 3300049706 Bacteria 2413
676 Ga0501229_005777 3300049706 Bacteria 1524
677 Ga0501234_002275 3300049707 Bacteria 3031
678 Ga0501079_0286828 3300049741 Bacteria 1287
679 Ga0501283_001997 3300049779 Bacteria 2641
680 Ga0501283_002891 3300049779 Bacteria 2252
681 Ga0501035_0008777 3300049822 Bacteria 9410
682 Ga0501044_0000430 3300049823 Bacteria 51693
683 Ga0501045_0044473 3300049824 Bacteria 3235
684 Ga0501045_0090560 3300049824 Bacteria 2260
685 Ga0501204_004521 3300049850 Bacteria 1501
686 Ga0501226_000756 3300049853 Bacteria 4365
687 nmdc:mga03683_17100_c1 3300050489 Bacteria 2739
688 nmdc:mga0yw44_80741_c1 3300050492 Bacteria 2038
689 nmdc:mga0k408_1976_c1 3300050493 Bacteria 10993
690 nmdc:mga05p37_116125_c1 3300050507 Bacteria 3289
691 nmdc:mga05p37_117500_c1 3300050507 Bacteria 3268
692 nmdc:mga05p37_135924_c1 3300050507 Bacteria 3015
693 nmdc:mga05p37_139733_c1 3300050507 Bacteria 2968
694 nmdc:mga05p37_210318_c1 3300050507 Bacteria 2352
695 nmdc:mga05p37_215664_c1 3300050507 Bacteria 2318
696 nmdc:mga05p37_220815_c1 3300050507 Bacteria 2287
697 nmdc:mga05p37_282476_c1 3300050507 Bacteria 1979
698 nmdc:mga05p37_3031_c1 3300050507 Bacteria 19512
699 nmdc:mga05p37_40613_c1 3300050507 Bacteria 5713
700 nmdc:mga05p37_40739_c2 3300050507 Unclassified 3619
701 nmdc:mga05p37_81409_c1 3300050507 Bacteria 3988
702 nmdc:mga09592_153791_c1 3300050508 Bacteria 1985
703 nmdc:mga09592_205071_c1 3300050508 Bacteria 1708
704 nmdc:mga09592_42652_c1 3300050508 Bacteria 3816
705 nmdc:mga09592_58937_c1 3300050508 Bacteria 3246
706 nmdc:mga0qj67_104439_c1 3300050509 Bacteria 2286
707 nmdc:mga0qj67_14701_c1 3300050509 Bacteria 5918
708 nmdc:mga0qj67_35060_c1 3300050509 Bacteria 3922
709 nmdc:mga0qj67_7100_c1 3300050509 Bacteria 8263
710 nmdc:mga06r32_18255_c1 3300050510 Bacteria 6419
711 nmdc:mga06r32_222893_c1 3300050510 Bacteria 1874
712 nmdc:mga06r32_38641_c1 3300050510 Bacteria 4111
713 nmdc:mga06r32_51027_c2 3300050510 Bacteria 3484
714 nmdc:mga06r32_74590_c1 3300050510 Bacteria 3289
715 nmdc:mga06r32_9748_c1 3300050510 Bacteria 8674
716 nmdc:mga08y16_141102_c1 3300050511 Bacteria 2505
717 nmdc:mga08y16_158978_c1 3300050511 Bacteria 2348
718 nmdc:mga08y16_304108_c1 3300050511 Bacteria 1643
719 nmdc:mga08y16_3897_c1 3300050511 Bacteria 15538
720 nmdc:mga08y16_65708_c1 3300050511 Bacteria 3786
721 nmdc:mga0n895_165483_c1 3300050512 Bacteria 2243
722 nmdc:mga0rr50_12455_c1 3300050513 Bacteria 5500
723 nmdc:mga0rr50_38935_c1 3300050513 Bacteria 3445
724 nmdc:mga0rr50_697_c1 3300050513 Bacteria 18007
725 nmdc:mga08x19_13_c1 3300050514 Bacteria 366166
726 nmdc:mga08x19_14576_c1 3300050514 Bacteria 4769
727 nmdc:mga08x19_14823_c1 3300050514 Bacteria 2830
728 nmdc:mga08x19_7_c1 3300050514 Bacteria 437351
729 nmdc:mga0a205_132770_c1 3300050515 Bacteria 2390
730 nmdc:mga0a205_146005_c1 3300050515 Bacteria 2265
731 nmdc:mga0a205_20308_c1 3300050515 Bacteria 6265
732 nmdc:mga0a205_315218_c1 3300050515 Bacteria 1436
733 nmdc:mga0a205_47408_c1 3300050515 Bacteria 4146
734 nmdc:mga0a205_51041_c2 3300050515 Bacteria 2443
735 nmdc:mga0a205_51429_c1 3300050515 Bacteria 3977
736 nmdc:mga0a205_59000_c1 3300050515 Bacteria 3707
737 Ga0500554_025611 3300053102 Bacteria 1685
738 Ga0500628_000346 3300053129 Bacteria 8819
739 Ga0501082_0059825 3300060353 Bacteria 3283

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049741 Ga0501079_0286828 Ga0501079_0286828_141_1274 371
2 3300044693 Ga0466961_0027151 Ga0466961_0027151_48_1208 380
3 3300021388 Ga0213875_10010731 Ga0213875_100107313 382
4 3300037853 Ga0436364_1339265 Ga0436364_1339265_5892_7274 382
5 3300048915 Ga0496112_0381775 Ga0496112_0381775_20_1282 383
6 3300005617 Ga0068859_100029764 Ga0068859_1000297643 386
7 3300006931 Ga0097620_100029764 Ga0097620_1000297643 386
8 3300022730 Ga0224570_100607 Ga0224570_1006072 393
9 3300024225 Ga0224572_1002888 Ga0224572_10028882 393
10 3300026067 Ga0207678_10092136 Ga0207678_100921362 393
11 3300028017 Ga0265356_1001451 Ga0265356_10014511 393
12 3300006852 Ga0075433_10055537 Ga0075433_100555372 395
13 3300035695 Ga0373927_0001502 Ga0373927_0001502_14595_15911 395
14 3300050507 nmdc:mga05p37_117500_c1 nmdc:mga05p37_117500_c1_449_1846 395
15 3300005406 Ga0070703_10021176 Ga0070703_100211762 396
16 3300005547 Ga0070693_100013626 Ga0070693_1000136262 396
17 3300005615 Ga0070702_100017626 Ga0070702_1000176262 396
18 3300009093 Ga0105240_10178981 Ga0105240_101789812 396
19 3300010375 Ga0105239_10199354 Ga0105239_101993542 396
20 3300014968 Ga0157379_10131855 Ga0157379_101318552 396
21 3300025885 Ga0207653_10005723 Ga0207653_100057232 396
22 3300025914 Ga0207671_10002504 Ga0207671_1000250414 396
23 3300049589 Ga0501073_0056674 Ga0501073_0056674_831_2147 396
24 3300049779 Ga0501283_002891 Ga0501283_002891_661_1959 396
25 3300045049 Ga0466959_0059697 Ga0466959_0059697_43_1290 397
26 3300005331 Ga0070670_100013610 Ga0070670_1000136101 398
27 3300005564 Ga0070664_100144177 Ga0070664_1001441772 398
28 3300006358 Ga0068871_100192142 Ga0068871_1001921422 398
29 3300025945 Ga0207679_10194129 Ga0207679_101941292 398
30 3300060353 Ga0501082_0059825 Ga0501082_0059825_747_2066 400
31 3300005327 Ga0070658_10001325 Ga0070658_1000132515 401
32 3300025909 Ga0207705_10020405 Ga0207705_100204053 401
33 3300009147 Ga0114129_10209077 Ga0114129_102090772 402
34 3300035398 Ga0316574_0022811 Ga0316574_0022811_995_2329 402
35 3300045976 Ga0466967_0049638 Ga0466967_0049638_125_1468 402
36 3300050507 nmdc:mga05p37_220815_c1 nmdc:mga05p37_220815_c1_1027_2274 402
37 3300009094 Ga0111539_10072169 Ga0111539_100721692 403
38 3300009147 Ga0114129_10614550 Ga0114129_106145501 403
39 3300050511 nmdc:mga08y16_141102_c1 nmdc:mga08y16_141102_c1_452_1750 403
40 3300005329 Ga0070683_100103421 Ga0070683_1001034212 404
41 3300025913 Ga0207695_10237259 Ga0207695_102372591 404
42 3300005467 Ga0070706_100100835 Ga0070706_1001008352 405
43 3300005468 Ga0070707_100159966 Ga0070707_1001599662 405
44 3300005518 Ga0070699_100231806 Ga0070699_1002318061 405
45 3300006881 Ga0068865_100068133 Ga0068865_1000681332 405
46 3300025910 Ga0207684_10128153 Ga0207684_101281532 405
47 3300025922 Ga0207646_10112880 Ga0207646_101128802 405
48 3300006844 Ga0075428_100013356 Ga0075428_1000133564 406
49 3300009147 Ga0114129_10390341 Ga0114129_103903412 406
50 3300044694 Ga0466963_0056409 Ga0466963_0056409_816_2159 406
51 3300050507 nmdc:mga05p37_116125_c1 nmdc:mga05p37_116125_c1_1521_2810 406
52 3300005356 Ga0070674_100017320 Ga0070674_1000173202 407
53 3300005536 Ga0070697_100268444 Ga0070697_1002684441 407
54 3300009176 Ga0105242_10051803 Ga0105242_100518032 407
55 3300025937 Ga0207669_10010393 Ga0207669_100103932 407
56 3300031727 Ga0316576_10014082 Ga0316576_100140822 407
57 3300036712 Ga0316584_0039502 Ga0316584_0039502_168_1517 407
58 3300039450 Ga0436363_0991061 Ga0436363_0991061_4350_5792 407
59 3300049649 Ga0501198_005752 Ga0501198_005752_279_1583 407
60 3300006847 Ga0075431_100003521 Ga0075431_1000035216 409
61 3300044712 Ga0453684_0010740 Ga0453684_0010740_1977_3359 409
62 3300046472 Ga0495580_0042715 Ga0495580_0042715_20_1414 409
63 3300006847 Ga0075431_100202087 Ga0075431_1002020872 410
64 3300006880 Ga0075429_100011715 Ga0075429_1000117154 410
65 3300009093 Ga0105240_10036231 Ga0105240_100362315 410
66 3300009147 Ga0114129_10116295 Ga0114129_101162952 410
67 3300025914 Ga0207671_10024229 Ga0207671_100242293 410
68 3300025928 Ga0207700_10181193 Ga0207700_101811932 410
69 3300031824 Ga0307413_10062488 Ga0307413_100624884 410
70 3300031852 Ga0307410_10000762 Ga0307410_100007624 410
71 3300031903 Ga0307407_10107650 Ga0307407_101076501 410
72 3300031995 Ga0307409_100006099 Ga0307409_1000060995 410
73 3300032002 Ga0307416_100067954 Ga0307416_1000679541 410
74 3300032005 Ga0307411_10003967 Ga0307411_100039674 410
75 3300050507 nmdc:mga05p37_81409_c1 nmdc:mga05p37_81409_c1_1158_2468 410
76 3300050508 nmdc:mga09592_42652_c1 nmdc:mga09592_42652_c1_528_1838 410
77 3300050510 nmdc:mga06r32_222893_c1 nmdc:mga06r32_222893_c1_264_1574 410
78 3300006846 Ga0075430_100043930 Ga0075430_1000439302 411
79 3300050510 nmdc:mga06r32_51027_c2 nmdc:mga06r32_51027_c2_411_1766 411
80 3300050510 nmdc:mga06r32_9748_c1 nmdc:mga06r32_9748_c1_845_2182 411
81 3300005842 Ga0068858_100062291 Ga0068858_1000622914 412
82 3300009094 Ga0111539_10045812 Ga0111539_100458122 412
83 3300014969 Ga0157376_10102763 Ga0157376_101027633 412
84 3300044712 Ga0453684_0022578 Ga0453684_0022578_3981_5432 412
85 3300005329 Ga0070683_100014240 Ga0070683_1000142404 413
86 3300005344 Ga0070661_100005989 Ga0070661_1000059892 413
87 3300005345 Ga0070692_10012394 Ga0070692_100123942 413
88 3300005353 Ga0070669_100003088 Ga0070669_1000030886 413
89 3300005366 Ga0070659_100049173 Ga0070659_1000491732 413
90 3300005435 Ga0070714_100002411 Ga0070714_1000024119 413
91 3300005441 Ga0070700_100055814 Ga0070700_1000558142 413
92 3300005535 Ga0070684_100116615 Ga0070684_1001166152 413
93 3300005539 Ga0068853_100006085 Ga0068853_1000060856 413
94 3300005564 Ga0070664_100050391 Ga0070664_1000503912 413
95 3300005577 Ga0068857_100019588 Ga0068857_1000195882 413
96 3300005719 Ga0068861_100001695 Ga0068861_1000016952 413
97 3300005842 Ga0068858_100100933 Ga0068858_1001009332 413
98 3300005843 Ga0068860_100059954 Ga0068860_1000599542 413
99 3300009093 Ga0105240_10083110 Ga0105240_100831103 413
100 3300009098 Ga0105245_10059275 Ga0105245_100592752 413
101 3300009553 Ga0105249_10014919 Ga0105249_100149194 413
102 3300010375 Ga0105239_10148508 Ga0105239_101485082 413
103 3300014968 Ga0157379_10042065 Ga0157379_100420653 413
104 3300025901 Ga0207688_10037931 Ga0207688_100379312 413
105 3300025907 Ga0207645_10001781 Ga0207645_100017811 413
106 3300025919 Ga0207657_10027742 Ga0207657_100277425 413
107 3300025920 Ga0207649_10072843 Ga0207649_100728432 413
108 3300025923 Ga0207681_10029013 Ga0207681_100290132 413
109 3300025923 Ga0207681_10047651 Ga0207681_100476511 413
110 3300025929 Ga0207664_10002367 Ga0207664_100023678 413
111 3300025942 Ga0207689_10013421 Ga0207689_100134215 413
112 3300025945 Ga0207679_10025447 Ga0207679_100254472 413
113 3300025949 Ga0207667_10040300 Ga0207667_100403002 413
114 3300026023 Ga0207677_10054384 Ga0207677_100543842 413
115 3300026041 Ga0207639_10062495 Ga0207639_100624952 413
116 3300026067 Ga0207678_10070087 Ga0207678_100700872 413
117 3300026089 Ga0207648_10012629 Ga0207648_100126295 413
118 3300026116 Ga0207674_10006330 Ga0207674_100063302 413
119 3300035114 Ga0373939_0027816 Ga0373939_0027816_227_1585 413
120 3300035115 Ga0373941_0016135 Ga0373941_0016135_475_1818 413
121 3300045051 Ga0451576_0060963 Ga0451576_0060963_2528_3913 413
122 3300031548 Ga0307408_100008937 Ga0307408_1000089372 414
123 3300031901 Ga0307406_10003162 Ga0307406_100031625 414
124 3300037418 Ga0395900_0001406 Ga0395900_0001406_169_1506 414
125 3300037466 Ga0395898_0027895 Ga0395898_0027895_3219_4556 414
126 3300005518 Ga0070699_100000021 Ga0070699_10000002159 415
127 3300025906 Ga0207699_10022728 Ga0207699_100227282 415
128 3300005331 Ga0070670_100002232 Ga0070670_1000022327 416
129 3300005335 Ga0070666_10040261 Ga0070666_100402611 416
130 3300005355 Ga0070671_100017291 Ga0070671_1000172913 416
131 3300005364 Ga0070673_100015463 Ga0070673_1000154632 416
132 3300005406 Ga0070703_10000258 Ga0070703_1000025817 416
133 3300005445 Ga0070708_100017065 Ga0070708_1000170652 416
134 3300005467 Ga0070706_100000266 Ga0070706_10000026613 416
135 3300005536 Ga0070697_100000694 Ga0070697_10000069413 416
136 3300005539 Ga0068853_100000011 Ga0068853_100000011190 416
137 3300005547 Ga0070693_100032742 Ga0070693_1000327422 416
138 3300006237 Ga0097621_100017758 Ga0097621_1000177583 416
139 3300006846 Ga0075430_100128861 Ga0075430_1001288612 416
140 3300013296 Ga0157374_10001619 Ga0157374_1000161915 416
141 3300013306 Ga0163162_10020999 Ga0163162_100209992 416
142 3300013308 Ga0157375_10065650 Ga0157375_100656502 416
143 3300025885 Ga0207653_10000334 Ga0207653_100003344 416
144 3300025910 Ga0207684_10002321 Ga0207684_100023219 416
145 3300025931 Ga0207644_10048849 Ga0207644_100488491 416
146 3300026041 Ga0207639_10000019 Ga0207639_1000001912 416
147 3300042876 Ga0451577_0000005 Ga0451577_0000005_449934_451241 416
148 3300046461 Ga0495641_0005278 Ga0495641_0005278_7075_8427 416
149 3300046517 Ga0495630_0148017 Ga0495630_0148017_218_1582 416
150 3300046526 Ga0495666_0065026 Ga0495666_0065026_60_1412 416
151 3300046535 Ga0495586_0040548 Ga0495586_0040548_946_2298 416
152 3300046642 Ga0495634_0024532 Ga0495634_0024532_150_1514 416
153 3300046683 Ga0495658_0001171 Ga0495658_0001171_11818_13170 416
154 3300047321 Ga0495676_0074834 Ga0495676_0074834_124_1476 416
155 3300048089 Ga0495614_0056773 Ga0495614_0056773_247_1599 416
156 3300049706 Ga0501229_005777 Ga0501229_005777_79_1401 416
157 3300050507 nmdc:mga05p37_215664_c1 nmdc:mga05p37_215664_c1_926_2254 416
158 3300005288 Ga0065714_10002198 Ga0065714_1000219849 417
159 3300005290 Ga0065712_10000119 Ga0065712_1000011946 417
160 3300013308 Ga0157375_10052445 Ga0157375_100524453 417
161 iso_pu_bacteria 2786546940 2788434003 417
162 3300005441 Ga0070700_100000099 Ga0070700_10000009929 418
163 3300005471 Ga0070698_100173391 Ga0070698_1001733912 418
164 3300005615 Ga0070702_100061313 Ga0070702_1000613132 418
165 3300005617 Ga0068859_100270501 Ga0068859_1002705012 418
166 3300005618 Ga0068864_100244746 Ga0068864_1002447462 418
167 3300006358 Ga0068871_100124043 Ga0068871_1001240432 418
168 3300006931 Ga0097620_100270484 Ga0097620_1002704842 418
169 3300009011 Ga0105251_10089602 Ga0105251_100896021 418
170 3300009094 Ga0111539_10196841 Ga0111539_101968412 418
171 3300009174 Ga0105241_10175575 Ga0105241_101755752 418
172 3300009177 Ga0105248_10022916 Ga0105248_100229164 418
173 3300025918 Ga0207662_10165823 Ga0207662_101658231 418
174 3300026095 Ga0207676_10138172 Ga0207676_101381722 418
175 3300031238 Ga0265332_10030549 Ga0265332_100305492 418
176 3300031251 Ga0265327_10022303 Ga0265327_100223032 418
177 3300031548 Ga0307408_100003574 Ga0307408_1000035744 418
178 3300031731 Ga0307405_10031153 Ga0307405_100311532 418
179 3300031824 Ga0307413_10009277 Ga0307413_100092772 418
180 3300031852 Ga0307410_10002630 Ga0307410_100026304 418
181 3300031852 Ga0307410_10172888 Ga0307410_101728882 418
182 3300031901 Ga0307406_10007552 Ga0307406_100075522 418
183 3300031911 Ga0307412_10003206 Ga0307412_100032063 418
184 3300031995 Ga0307409_100051939 Ga0307409_1000519392 418
185 3300032002 Ga0307416_100003301 Ga0307416_1000033014 418
186 3300032004 Ga0307414_10001981 Ga0307414_100019814 418
187 3300032126 Ga0307415_100006040 Ga0307415_1000060402 418
188 3300035119 Ga0373956_0048735 Ga0373956_0048735_254_1624 418
189 3300042876 Ga0451577_0004971 Ga0451577_0004971_10192_11511 418
190 3300044712 Ga0453684_0001014 Ga0453684_0001014_57402_58721 418
191 3300049652 Ga0501202_004237 Ga0501202_004237_398_1696 418
192 3300049654 Ga0501207_002489 Ga0501207_002489_150_1448 418
193 3300049660 Ga0501216_002400 Ga0501216_002400_1124_2422 418
194 3300049661 Ga0501217_000124 Ga0501217_000124_6130_7428 418
195 3300049663 Ga0501223_003737 Ga0501223_003737_635_1933 418
196 3300049664 Ga0501224_002117 Ga0501224_002117_1013_2311 418
197 3300049665 Ga0501227_002821 Ga0501227_002821_45_1343 418
198 3300049668 Ga0501233_002582 Ga0501233_002582_188_1486 418
199 3300049705 Ga0501225_0000940 Ga0501225_0000940_1422_2720 418
200 3300049706 Ga0501229_001976 Ga0501229_001976_589_1887 418
201 3300049707 Ga0501234_002275 Ga0501234_002275_1451_2749 418
202 3300049853 Ga0501226_000756 Ga0501226_000756_591_1889 418
203 3300005328 Ga0070676_10032770 Ga0070676_100327704 419
204 3300005331 Ga0070670_100007508 Ga0070670_1000075083 419
205 3300005335 Ga0070666_10011613 Ga0070666_100116135 419
206 3300005347 Ga0070668_100121682 Ga0070668_1001216822 419
207 3300005353 Ga0070669_100017526 Ga0070669_1000175261 419
208 3300005354 Ga0070675_100001987 Ga0070675_1000019878 419
209 3300005356 Ga0070674_100013539 Ga0070674_1000135393 419
210 3300005365 Ga0070688_100007920 Ga0070688_1000079204 419
211 3300005458 Ga0070681_10018466 Ga0070681_100184662 419
212 3300005458 Ga0070681_10271704 Ga0070681_102717042 419
213 3300005459 Ga0068867_100003151 Ga0068867_1000031514 419
214 3300005543 Ga0070672_100001164 Ga0070672_1000011647 419
215 3300005545 Ga0070695_100096163 Ga0070695_1000961632 419
216 3300005546 Ga0070696_100084178 Ga0070696_1000841782 419
217 3300005548 Ga0070665_100049517 Ga0070665_1000495172 419
218 3300005618 Ga0068864_100021543 Ga0068864_1000215432 419
219 3300006847 Ga0075431_100098481 Ga0075431_1000984812 419
220 3300006852 Ga0075433_10090815 Ga0075433_100908152 419
221 3300006871 Ga0075434_100130516 Ga0075434_1001305162 419
222 3300006871 Ga0075434_100221205 Ga0075434_1002212052 419
223 3300006881 Ga0068865_100034608 Ga0068865_1000346084 419
224 3300009545 Ga0105237_10077187 Ga0105237_100771873 419
225 3300013297 Ga0157378_10134123 Ga0157378_101341232 419
226 3300013306 Ga0163162_10013334 Ga0163162_100133343 419
227 3300013308 Ga0157375_10008016 Ga0157375_100080163 419
228 3300014325 Ga0163163_10123771 Ga0163163_101237712 419
229 3300025315 Ga0207697_10000190 Ga0207697_1000019019 419
230 3300025901 Ga0207688_10041810 Ga0207688_100418103 419
231 3300025903 Ga0207680_10062908 Ga0207680_100629082 419
232 3300025907 Ga0207645_10024826 Ga0207645_100248263 419
233 3300025912 Ga0207707_10034305 Ga0207707_100343053 419
234 3300025945 Ga0207679_10058237 Ga0207679_100582372 419
235 3300025960 Ga0207651_10213341 Ga0207651_102133411 419
236 3300025972 Ga0207668_10128492 Ga0207668_101284922 419
237 3300025986 Ga0207658_10018382 Ga0207658_100183822 419
238 3300026089 Ga0207648_10024695 Ga0207648_100246953 419
239 3300026095 Ga0207676_10031044 Ga0207676_100310442 419
240 3300026121 Ga0207683_10008228 Ga0207683_100082282 419
241 3300037466 Ga0395898_0134230 Ga0395898_0134230_522_1823 419
242 3300042157 Ga0439458_0008559 Ga0439458_0008559_537_1838 419
243 3300047320 Ga0495672_0000500 Ga0495672_0000500_5566_6879 419
244 3300048915 Ga0496112_0293806 Ga0496112_0293806_36_1337 419
245 3300050510 nmdc:mga06r32_74590_c1 nmdc:mga06r32_74590_c1_1662_2960 419
246 3300050515 nmdc:mga0a205_315218_c1 nmdc:mga0a205_315218_c1_63_1364 419
247 3300050515 nmdc:mga0a205_59000_c1 nmdc:mga0a205_59000_c1_1093_2391 419
248 3300003203 JGI25406J46586_10000597 JGI25406J46586_100005979 420
249 3300005290 Ga0065712_10022415 Ga0065712_100224152 420
250 3300005293 Ga0065715_10002646 Ga0065715_100026462 420
251 3300005364 Ga0070673_100025636 Ga0070673_1000256362 420
252 3300005467 Ga0070706_100000015 Ga0070706_100000015147 420
253 3300005545 Ga0070695_100038698 Ga0070695_1000386982 420
254 3300005615 Ga0070702_100121564 Ga0070702_1001215642 420
255 3300005617 Ga0068859_100043506 Ga0068859_1000435063 420
256 3300005617 Ga0068859_100267687 Ga0068859_1002676872 420
257 3300005718 Ga0068866_10108567 Ga0068866_101085672 420
258 3300005719 Ga0068861_100021342 Ga0068861_1000213423 420
259 3300005840 Ga0068870_10009123 Ga0068870_100091232 420
260 3300005842 Ga0068858_100059034 Ga0068858_1000590342 420
261 3300005842 Ga0068858_100092522 Ga0068858_1000925222 420
262 3300005843 Ga0068860_100005979 Ga0068860_1000059794 420
263 3300005844 Ga0068862_100123294 Ga0068862_1001232942 420
264 3300005985 Ga0081539_10001369 Ga0081539_100013695 420
265 3300006358 Ga0068871_100003645 Ga0068871_1000036453 420
266 3300006852 Ga0075433_10036926 Ga0075433_100369262 420
267 3300006931 Ga0097620_100043504 Ga0097620_1000435043 420
268 3300006931 Ga0097620_100267708 Ga0097620_1002677082 420
269 3300009551 Ga0105238_10001447 Ga0105238_1000144715 420
270 3300009553 Ga0105249_10004552 Ga0105249_100045522 420
271 3300010375 Ga0105239_10271134 Ga0105239_102711342 420
272 3300013100 Ga0157373_10044151 Ga0157373_100441512 420
273 3300013306 Ga0163162_10047730 Ga0163162_100477303 420
274 3300013308 Ga0157375_10040454 Ga0157375_100404543 420
275 3300013308 Ga0157375_10109318 Ga0157375_101093182 420
276 3300014325 Ga0163163_10281418 Ga0163163_102814182 420
277 3300014968 Ga0157379_10145582 Ga0157379_101455822 420
278 3300025904 Ga0207647_10000808 Ga0207647_100008084 420
279 3300025908 Ga0207643_10005175 Ga0207643_100051753 420
280 3300025908 Ga0207643_10009782 Ga0207643_100097823 420
281 3300025910 Ga0207684_10000083 Ga0207684_1000008316 420
282 3300025923 Ga0207681_10074069 Ga0207681_100740692 420
283 3300025924 Ga0207694_10004881 Ga0207694_100048817 420
284 3300025942 Ga0207689_10052950 Ga0207689_100529502 420
285 3300025981 Ga0207640_10230789 Ga0207640_102307891 420
286 3300026116 Ga0207674_10287799 Ga0207674_102877992 420
287 3300031911 Ga0307412_10050550 Ga0307412_100505502 420
288 3300035091 Ga0373951_0012962 Ga0373951_0012962_576_1862 420
289 3300042876 Ga0451577_0088818 Ga0451577_0088818_868_2178 420
290 3300048915 Ga0496112_0063908 Ga0496112_0063908_1187_2488 420
291 3300049574 Ga0501038_0002371 Ga0501038_0002371_568_1872 420
292 3300005290 Ga0065712_10007765 Ga0065712_100077653 421
293 3300005337 Ga0070682_100038766 Ga0070682_1000387662 421
294 3300005445 Ga0070708_100000091 Ga0070708_10000009114 421
295 3300005548 Ga0070665_100036053 Ga0070665_1000360535 421
296 3300009101 Ga0105247_10001245 Ga0105247_100012453 421
297 3300009177 Ga0105248_10006052 Ga0105248_100060522 421
298 3300009545 Ga0105237_10153476 Ga0105237_101534762 421
299 3300013104 Ga0157370_10027101 Ga0157370_100271013 421
300 3300013105 Ga0157369_10003038 Ga0157369_1000303810 421
301 3300021361 Ga0213872_10001600 Ga0213872_100016006 421
302 3300025900 Ga0207710_10002083 Ga0207710_100020833 421
303 3300025908 Ga0207643_10110189 Ga0207643_101101891 421
304 3300025941 Ga0207711_10006273 Ga0207711_100062732 421
305 3300028379 Ga0268266_10025358 Ga0268266_100253585 421
306 3300031241 Ga0265325_10000457 Ga0265325_1000045727 421
307 3300031548 Ga0307408_100162349 Ga0307408_1001623491 421
308 3300032004 Ga0307414_10236942 Ga0307414_102369422 421
309 3300035695 Ga0373927_0130569 Ga0373927_0130569_187_1599 421
310 3300035725 Ga0373947_0014764 Ga0373947_0014764_1018_2430 421
311 3300039447 Ga0436361_0881637 Ga0436361_0881637_9399_10802 421
312 3300044656 Ga0466969_0022523 Ga0466969_0022523_1306_2676 421
313 3300046472 Ga0495580_0023592 Ga0495580_0023592_1405_2817 421
314 3300046473 Ga0495582_0030464 Ga0495582_0030464_76_1488 421
315 3300046499 Ga0495594_0099485 Ga0495594_0099485_178_1590 421
316 3300046517 Ga0495630_0052697 Ga0495630_0052697_404_1816 421
317 3300046531 Ga0495665_0026803 Ga0495665_0026803_1431_2843 421
318 3300047315 Ga0495581_0012547 Ga0495581_0012547_1088_2500 421
319 3300048915 Ga0496112_0245131 Ga0496112_0245131_362_1666 421
320 3300049521 Ga0501298_010840 Ga0501298_010840_107_1444 421
321 3300049661 Ga0501217_012307 Ga0501217_012307_428_1765 421
322 3300049665 Ga0501227_019704 Ga0501227_019704_135_1472 421
323 3300049675 Ga0501243_006991 Ga0501243_006991_244_1581 421
324 3300049686 Ga0501257_007181 Ga0501257_007181_410_1747 421
325 3300049779 Ga0501283_001997 Ga0501283_001997_1154_2458 421
326 3300049850 Ga0501204_004521 Ga0501204_004521_125_1462 421
327 3300050513 nmdc:mga0rr50_12455_c1 nmdc:mga0rr50_12455_c1_1646_2977 421
328 3300005471 Ga0070698_100016011 Ga0070698_1000160113 422
329 3300005518 Ga0070699_100135596 Ga0070699_1001355962 422
330 3300005536 Ga0070697_100104179 Ga0070697_1001041792 422
331 3300005985 Ga0081539_10000898 Ga0081539_1000089819 422
332 3300006846 Ga0075430_100011532 Ga0075430_1000115324 422
333 3300006846 Ga0075430_100015750 Ga0075430_1000157504 422
334 3300006846 Ga0075430_100019708 Ga0075430_1000197084 422
335 3300006847 Ga0075431_100019334 Ga0075431_1000193343 422
336 3300006847 Ga0075431_100053313 Ga0075431_1000533132 422
337 3300031249 Ga0265339_10005958 Ga0265339_100059587 422
338 3300042876 Ga0451577_0020861 Ga0451577_0020861_2829_4112 422
339 3300046525 Ga0495663_0000834 Ga0495663_0000834_6780_8237 422
340 3300046537 Ga0495598_0000152 Ga0495598_0000152_1441_2898 422
341 3300046539 Ga0495621_0000280 Ga0495621_0000280_9097_10554 422
342 3300050509 nmdc:mga0qj67_104439_c1 nmdc:mga0qj67_104439_c1_458_1870 422
343 3300050509 nmdc:mga0qj67_14701_c1 nmdc:mga0qj67_14701_c1_3944_5311 422
344 3300050509 nmdc:mga0qj67_35060_c1 nmdc:mga0qj67_35060_c1_1201_2568 422
345 3300005466 Ga0070685_10008928 Ga0070685_100089284 423
346 3300006871 Ga0075434_100087780 Ga0075434_1000877802 423
347 3300009147 Ga0114129_10114211 Ga0114129_101142112 423
348 3300013100 Ga0157373_10080386 Ga0157373_100803862 423
349 3300014326 Ga0157380_10000250 Ga0157380_100002509 423
350 3300021384 Ga0213876_10000295 Ga0213876_1000029512 423
351 3300025911 Ga0207654_10082444 Ga0207654_100824442 423
352 3300031995 Ga0307409_100030746 Ga0307409_1000307462 423
353 3300035695 Ga0373927_0007658 Ga0373927_0007658_4337_5668 423
354 3300039437 Ga0436365_1601972 Ga0436365_1601972_15176_16615 423
355 3300050507 nmdc:mga05p37_135924_c1 nmdc:mga05p37_135924_c1_1345_2784 423
356 3300050508 nmdc:mga09592_205071_c1 nmdc:mga09592_205071_c1_120_1559 423
357 3300050515 nmdc:mga0a205_146005_c1 nmdc:mga0a205_146005_c1_911_2230 423
358 3300005546 Ga0070696_100002421 Ga0070696_1000024214 424
359 3300009093 Ga0105240_10017556 Ga0105240_100175562 424
360 3300025913 Ga0207695_10013523 Ga0207695_100135235 424
361 3300031251 Ga0265327_10076793 Ga0265327_100767932 424
362 3300031344 Ga0265316_10001737 Ga0265316_100017371 424
363 3300031344 Ga0265316_10067967 Ga0265316_100679672 424
364 3300031595 Ga0265313_10018326 Ga0265313_100183265 424
365 3300049568 Ga0501031_0000122 Ga0501031_0000122_22944_24284 424
366 3300049569 Ga0501032_0027405 Ga0501032_0027405_1917_3257 424
367 3300049570 Ga0501033_0022595 Ga0501033_0022595_1415_2755 424
368 3300049574 Ga0501038_0120263 Ga0501038_0120263_629_1960 424
369 3300049575 Ga0501039_0058291 Ga0501039_0058291_1230_2570 424
370 3300049580 Ga0501046_0219975 Ga0501046_0219975_16_1356 424
371 3300049822 Ga0501035_0008777 Ga0501035_0008777_7250_8590 424
372 3300049823 Ga0501044_0000430 Ga0501044_0000430_23363_24703 424
373 3300049824 Ga0501045_0090560 Ga0501045_0090560_261_1592 424
374 3300050511 nmdc:mga08y16_158978_c1 nmdc:mga08y16_158978_c1_556_2016 424
375 3300005327 Ga0070658_10082619 Ga0070658_100826191 425
376 3300005536 Ga0070697_100113280 Ga0070697_1001132802 425
377 3300005548 Ga0070665_100037131 Ga0070665_1000371314 425
378 3300005719 Ga0068861_100004364 Ga0068861_1000043643 425
379 3300005719 Ga0068861_100009333 Ga0068861_1000093332 425
380 3300005841 Ga0068863_100134993 Ga0068863_1001349932 425
381 3300005844 Ga0068862_100024013 Ga0068862_1000240133 425
382 3300006846 Ga0075430_100093201 Ga0075430_1000932013 425
383 3300009174 Ga0105241_10037066 Ga0105241_100370662 425
384 3300009177 Ga0105248_10016065 Ga0105248_100160653 425
385 3300013306 Ga0163162_10066928 Ga0163162_100669283 425
386 3300025909 Ga0207705_10196097 Ga0207705_101960971 425
387 3300025918 Ga0207662_10000992 Ga0207662_100009923 425
388 3300025941 Ga0207711_10054349 Ga0207711_100543492 425
389 3300025961 Ga0207712_10000737 Ga0207712_1000073715 425
390 3300026118 Ga0207675_100024358 Ga0207675_1000243582 425
391 3300026118 Ga0207675_100084477 Ga0207675_1000844772 425
392 3300028379 Ga0268266_10026792 Ga0268266_100267922 425
393 3300050510 nmdc:mga06r32_38641_c1 nmdc:mga06r32_38641_c1_2613_3953 425
394 3300005338 Ga0068868_100127419 Ga0068868_1001274192 426
395 3300005367 Ga0070667_100200823 Ga0070667_1002008232 426
396 3300005438 Ga0070701_10000533 Ga0070701_100005332 426
397 3300005459 Ga0068867_100006105 Ga0068867_1000061052 426
398 3300005518 Ga0070699_100099321 Ga0070699_1000993212 426
399 3300005546 Ga0070696_100085918 Ga0070696_1000859182 426
400 3300005548 Ga0070665_100074853 Ga0070665_1000748532 426
401 3300005564 Ga0070664_100231305 Ga0070664_1002313052 426
402 3300005844 Ga0068862_100059699 Ga0068862_1000596993 426
403 3300006038 Ga0075365_10016339 Ga0075365_100163393 426
404 3300006178 Ga0075367_10011831 Ga0075367_100118313 426
405 3300006195 Ga0075366_10000251 Ga0075366_1000025118 426
406 3300006880 Ga0075429_100194729 Ga0075429_1001947292 426
407 3300006881 Ga0068865_100050625 Ga0068865_1000506252 426
408 3300007076 Ga0075435_100052016 Ga0075435_1000520163 426
409 3300009094 Ga0111539_10000333 Ga0111539_1000033324 426
410 3300009177 Ga0105248_10056492 Ga0105248_100564923 426
411 3300009553 Ga0105249_10001505 Ga0105249_100015059 426
412 3300014745 Ga0157377_10065686 Ga0157377_100656862 426
413 3300025940 Ga0207691_10065326 Ga0207691_100653262 426
414 3300025961 Ga0207712_10001491 Ga0207712_100014917 426
415 3300025961 Ga0207712_10139610 Ga0207712_101396102 426
416 3300026023 Ga0207677_10043608 Ga0207677_100436082 426
417 3300026089 Ga0207648_10000296 Ga0207648_1000029626 426
418 3300027907 Ga0207428_10000665 Ga0207428_1000066510 426
419 3300028379 Ga0268266_10133048 Ga0268266_101330481 426
420 3300049669 Ga0501235_004623 Ga0501235_004623_1536_2909 426
421 3300050489 nmdc:mga03683_17100_c1 nmdc:mga03683_17100_c1_152_1489 426
422 3300050492 nmdc:mga0yw44_80741_c1 nmdc:mga0yw44_80741_c1_474_1811 426
423 3300050493 nmdc:mga0k408_1976_c1 nmdc:mga0k408_1976_c1_4558_5895 426
424 3300050513 nmdc:mga0rr50_38935_c1 nmdc:mga0rr50_38935_c1_1284_2621 426
425 3300013104 Ga0157370_10129570 Ga0157370_101295702 427
426 3300025942 Ga0207689_10092824 Ga0207689_100928243 427
427 3300025945 Ga0207679_10022647 Ga0207679_100226471 427
428 3300031995 Ga0307409_100020708 Ga0307409_1000207082 427
429 3300005340 Ga0070689_100011882 Ga0070689_1000118823 428
430 3300025936 Ga0207670_10006870 Ga0207670_100068703 428
431 3300050507 nmdc:mga05p37_3031_c1 nmdc:mga05p37_3031_c1_9936_11516 428
432 3300053129 Ga0500628_000346 Ga0500628_000346_1385_2782 428
433 3300005471 Ga0070698_100013222 Ga0070698_1000132225 429
434 3300005985 Ga0081539_10007977 Ga0081539_100079778 429
435 3300006852 Ga0075433_10146047 Ga0075433_101460472 429
436 3300009147 Ga0114129_10495538 Ga0114129_104955381 429
437 3300025910 Ga0207684_10036389 Ga0207684_100363893 429
438 3300031241 Ga0265325_10011149 Ga0265325_100111492 429
439 3300031731 Ga0307405_10034757 Ga0307405_100347571 429
440 3300031852 Ga0307410_10061201 Ga0307410_100612012 429
441 3300031901 Ga0307406_10092021 Ga0307406_100920212 429
442 3300031901 Ga0307406_10121851 Ga0307406_101218512 429
443 3300031995 Ga0307409_100101220 Ga0307409_1001012202 429
444 3300032005 Ga0307411_10095498 Ga0307411_100954982 429
445 3300050515 nmdc:mga0a205_47408_c1 nmdc:mga0a205_47408_c1_1780_3195 429
446 3300009147 Ga0114129_10062700 Ga0114129_100627002 430
447 3300037312 Ga0395899_0085733 Ga0395899_0085733_82_1455 430
448 3300050507 nmdc:mga05p37_40739_c2 nmdc:mga05p37_40739_c2_375_1769 430
449 3300005439 Ga0070711_100000024 Ga0070711_10000002435 431
450 3300006846 Ga0075430_100006705 Ga0075430_1000067054 431
451 3300007076 Ga0075435_100099353 Ga0075435_1000993532 431
452 3300009147 Ga0114129_10046930 Ga0114129_100469306 431
453 3300025916 Ga0207663_10000012 Ga0207663_1000001269 431
454 3300050507 nmdc:mga05p37_40613_c1 nmdc:mga05p37_40613_c1_672_2024 431
455 3300005327 Ga0070658_10099506 Ga0070658_100995061 432
456 3300005336 Ga0070680_100059074 Ga0070680_1000590742 432
457 3300005339 Ga0070660_100081044 Ga0070660_1000810442 432
458 3300005340 Ga0070689_100011051 Ga0070689_1000110515 432
459 3300005343 Ga0070687_100022676 Ga0070687_1000226762 432
460 3300005354 Ga0070675_100020546 Ga0070675_1000205462 432
461 3300005438 Ga0070701_10072572 Ga0070701_100725721 432
462 3300005457 Ga0070662_100042818 Ga0070662_1000428182 432
463 3300005457 Ga0070662_100058417 Ga0070662_1000584172 432
464 3300005458 Ga0070681_10000650 Ga0070681_100006504 432
465 3300005458 Ga0070681_10075881 Ga0070681_100758812 432
466 3300005471 Ga0070698_100226695 Ga0070698_1002266952 432
467 3300005530 Ga0070679_100021013 Ga0070679_1000210132 432
468 3300005535 Ga0070684_100008305 Ga0070684_1000083052 432
469 3300005543 Ga0070672_100012675 Ga0070672_1000126753 432
470 3300005577 Ga0068857_100007858 Ga0068857_1000078585 432
471 3300005616 Ga0068852_100137429 Ga0068852_1001374292 432
472 3300005844 Ga0068862_100017780 Ga0068862_1000177803 432
473 3300005983 Ga0081540_1034260 Ga0081540_10342602 432
474 3300006175 Ga0070712_100071862 Ga0070712_1000718622 432
475 3300006846 Ga0075430_100013476 Ga0075430_1000134762 432
476 3300006847 Ga0075431_100056685 Ga0075431_1000566852 432
477 3300006871 Ga0075434_100007923 Ga0075434_1000079234 432
478 3300006880 Ga0075429_100045841 Ga0075429_1000458412 432
479 3300006880 Ga0075429_100053028 Ga0075429_1000530282 432
480 3300009147 Ga0114129_10009296 Ga0114129_100092969 432
481 3300009177 Ga0105248_10126036 Ga0105248_101260361 432
482 3300013102 Ga0157371_10015567 Ga0157371_100155673 432
483 3300013105 Ga0157369_10077923 Ga0157369_100779232 432
484 3300013296 Ga0157374_10100933 Ga0157374_101009332 432
485 3300013307 Ga0157372_10115014 Ga0157372_101150142 432
486 3300013308 Ga0157375_10023014 Ga0157375_100230143 432
487 3300025315 Ga0207697_10002830 Ga0207697_100028302 432
488 3300025912 Ga0207707_10018498 Ga0207707_100184985 432
489 3300025912 Ga0207707_10081821 Ga0207707_100818212 432
490 3300025915 Ga0207693_10042582 Ga0207693_100425823 432
491 3300025917 Ga0207660_10111099 Ga0207660_101110991 432
492 3300025919 Ga0207657_10024758 Ga0207657_100247583 432
493 3300025920 Ga0207649_10035092 Ga0207649_100350922 432
494 3300025931 Ga0207644_10053911 Ga0207644_100539112 432
495 3300025933 Ga0207706_10007513 Ga0207706_100075132 432
496 3300025933 Ga0207706_10048274 Ga0207706_100482742 432
497 3300025940 Ga0207691_10049983 Ga0207691_100499832 432
498 3300025940 Ga0207691_10060961 Ga0207691_100609612 432
499 3300025944 Ga0207661_10051129 Ga0207661_100511292 432
500 3300025945 Ga0207679_10009018 Ga0207679_100090183 432
501 3300026041 Ga0207639_10028051 Ga0207639_100280512 432
502 3300026116 Ga0207674_10010797 Ga0207674_100107975 432
503 3300027907 Ga0207428_10077553 Ga0207428_100775532 432
504 3300028381 Ga0268264_10070920 Ga0268264_100709202 432
505 3300046684 Ga0495669_0033350 Ga0495669_0033350_350_1750 432
506 3300050507 nmdc:mga05p37_139733_c1 nmdc:mga05p37_139733_c1_1074_2441 432
507 3300050508 nmdc:mga09592_153791_c1 nmdc:mga09592_153791_c1_450_1847 432
508 3300050508 nmdc:mga09592_58937_c1 nmdc:mga09592_58937_c1_750_2117 432
509 3300050509 nmdc:mga0qj67_7100_c1 nmdc:mga0qj67_7100_c1_678_2045 432
510 3300050510 nmdc:mga06r32_18255_c1 nmdc:mga06r32_18255_c1_1696_3093 432
511 3300050511 nmdc:mga08y16_304108_c1 nmdc:mga08y16_304108_c1_51_1448 432
512 3300050511 nmdc:mga08y16_65708_c1 nmdc:mga08y16_65708_c1_1258_2643 432
513 3300050515 nmdc:mga0a205_132770_c1 nmdc:mga0a205_132770_c1_473_1840 432
514 3300050515 nmdc:mga0a205_20308_c1 nmdc:mga0a205_20308_c1_3776_5182 432
515 3300005353 Ga0070669_100002722 Ga0070669_1000027227 433
516 3300005577 Ga0068857_100052018 Ga0068857_1000520182 433
517 3300005719 Ga0068861_100006547 Ga0068861_1000065472 433
518 3300005844 Ga0068862_100000865 Ga0068862_1000008659 433
519 3300009553 Ga0105249_10000407 Ga0105249_1000040714 433
520 3300013306 Ga0163162_10049121 Ga0163162_100491212 433
521 3300014326 Ga0157380_10090955 Ga0157380_100909552 433
522 3300025923 Ga0207681_10024632 Ga0207681_100246323 433
523 3300025938 Ga0207704_10124958 Ga0207704_101249582 433
524 3300025940 Ga0207691_10158067 Ga0207691_101580672 433
525 3300025961 Ga0207712_10000878 Ga0207712_100008784 433
526 3300026075 Ga0207708_10026489 Ga0207708_100264892 433
527 3300026116 Ga0207674_10034076 Ga0207674_100340764 433
528 3300026118 Ga0207675_100003058 Ga0207675_1000030582 433
529 3300028380 Ga0268265_10001765 Ga0268265_100017655 433
530 3300032002 Ga0307416_100099182 Ga0307416_1000991822 433
531 3300032002 Ga0307416_100100048 Ga0307416_1001000482 433
532 3300005343 Ga0070687_100033052 Ga0070687_1000330521 434
533 3300005467 Ga0070706_100001562 Ga0070706_1000015623 434
534 3300025910 Ga0207684_10057563 Ga0207684_100575632 434
535 3300025918 Ga0207662_10075226 Ga0207662_100752262 434
536 3300005563 Ga0068855_100302784 Ga0068855_1003027842 435
537 3300025949 Ga0207667_10255884 Ga0207667_102558842 435
538 3300005331 Ga0070670_100151984 Ga0070670_1001519842 436
539 3300005337 Ga0070682_100148475 Ga0070682_1001484751 436
540 3300005339 Ga0070660_100038191 Ga0070660_1000381912 436
541 3300005353 Ga0070669_100000581 Ga0070669_1000005816 436
542 3300005577 Ga0068857_100023990 Ga0068857_1000239902 436
543 3300005577 Ga0068857_100071833 Ga0068857_1000718332 436
544 3300005578 Ga0068854_100033576 Ga0068854_1000335762 436
545 3300009147 Ga0114129_10459301 Ga0114129_104593011 436
546 3300009174 Ga0105241_10060016 Ga0105241_100600162 436
547 3300013100 Ga0157373_10038367 Ga0157373_100383672 436
548 3300025923 Ga0207681_10004151 Ga0207681_100041513 436
549 3300025925 Ga0207650_10099355 Ga0207650_100993551 436
550 3300037471 Ga0395905_0008205 Ga0395905_0008205_7403_8755 436
551 3300050515 nmdc:mga0a205_51429_c1 nmdc:mga0a205_51429_c1_1420_2886 436
552 3300005289 Ga0065704_10001544 Ga0065704_100015443 437
553 3300005295 Ga0065707_10003824 Ga0065707_100038242 437
554 3300005434 Ga0070709_10000023 Ga0070709_1000002352 437
555 3300005618 Ga0068864_100089887 Ga0068864_1000898872 437
556 3300006871 Ga0075434_100103085 Ga0075434_1001030852 437
557 3300006914 Ga0075436_100022879 Ga0075436_1000228792 437
558 3300006914 Ga0075436_100068084 Ga0075436_1000680841 437
559 3300009094 Ga0111539_10012815 Ga0111539_100128154 437
560 3300009176 Ga0105242_10141489 Ga0105242_101414892 437
561 3300011119 Ga0105246_10021264 Ga0105246_100212643 437
562 3300014325 Ga0163163_10091911 Ga0163163_100919112 437
563 3300025906 Ga0207699_10000008 Ga0207699_10000008245 437
564 3300025935 Ga0207709_10003673 Ga0207709_100036733 437
565 3300026095 Ga0207676_10050181 Ga0207676_100501813 437
566 3300027907 Ga0207428_10003354 Ga0207428_100033546 437
567 3300044673 Ga0453683_0012241 Ga0453683_0012241_105_1502 437
568 3300049577 Ga0501041_0032028 Ga0501041_0032028_97_1539 437
569 3300049580 Ga0501046_0061178 Ga0501046_0061178_307_1749 437
570 3300049591 Ga0501075_0051560 Ga0501075_0051560_1564_3006 437
571 3300049592 Ga0501076_0051770 Ga0501076_0051770_1447_2889 437
572 3300049593 Ga0501077_0053904 Ga0501077_0053904_731_2173 437
573 3300049824 Ga0501045_0044473 Ga0501045_0044473_480_1922 437
574 3300050511 nmdc:mga08y16_3897_c1 nmdc:mga08y16_3897_c1_4973_6379 437
575 3300050512 nmdc:mga0n895_165483_c1 nmdc:mga0n895_165483_c1_750_2177 437
576 3300050514 nmdc:mga08x19_14576_c1 nmdc:mga08x19_14576_c1_1660_3069 437
577 3300050514 nmdc:mga08x19_14823_c1 nmdc:mga08x19_14823_c1_594_2021 437
578 3300050515 nmdc:mga0a205_51041_c2 nmdc:mga0a205_51041_c2_299_1705 437
579 3300003203 JGI25406J46586_10004308 JGI25406J46586_100043084 438
580 3300005337 Ga0070682_100000145 Ga0070682_10000014543 438
581 3300005471 Ga0070698_100004135 Ga0070698_1000041358 438
582 3300005985 Ga0081539_10000073 Ga0081539_1000007399 438
583 3300005985 Ga0081539_10054186 Ga0081539_100541862 438
584 3300006163 Ga0070715_10000002 Ga0070715_1000000250 438
585 3300006914 Ga0075436_100007044 Ga0075436_1000070443 438
586 3300006914 Ga0075436_100063125 Ga0075436_1000631252 438
587 3300007076 Ga0075435_100072136 Ga0075435_1000721362 438
588 3300009147 Ga0114129_10035088 Ga0114129_100350884 438
589 3300009147 Ga0114129_10046934 Ga0114129_100469344 438
590 3300009147 Ga0114129_10069480 Ga0114129_100694802 438
591 3300009148 Ga0105243_10000349 Ga0105243_100003494 438
592 3300009176 Ga0105242_10001577 Ga0105242_1000157710 438
593 3300013297 Ga0157378_10000094 Ga0157378_1000009450 438
594 3300013308 Ga0157375_10000943 Ga0157375_100009438 438
595 3300014325 Ga0163163_10076031 Ga0163163_100760312 438
596 3300025905 Ga0207685_10000030 Ga0207685_1000003049 438
597 3300025934 Ga0207686_10002076 Ga0207686_100020764 438
598 3300025935 Ga0207709_10000896 Ga0207709_1000089611 438
599 3300039437 Ga0436365_1783306 Ga0436365_1783306_375_1781 438
600 3300046522 Ga0495643_0000069 Ga0495643_0000069_73138_74550 438
601 3300050507 nmdc:mga05p37_210318_c1 nmdc:mga05p37_210318_c1_122_1540 438
602 3300050507 nmdc:mga05p37_282476_c1 nmdc:mga05p37_282476_c1_555_1967 438
603 3300050514 nmdc:mga08x19_7_c1 nmdc:mga08x19_7_c1_129771_131198 438
604 3300005289 Ga0065704_10108457 Ga0065704_101084572 439
605 3300005293 Ga0065715_10095431 Ga0065715_100954312 439
606 3300005295 Ga0065707_10011320 Ga0065707_100113202 439
607 3300005330 Ga0070690_100004860 Ga0070690_1000048604 439
608 3300005334 Ga0068869_100081597 Ga0068869_1000815972 439
609 3300005336 Ga0070680_100002058 Ga0070680_1000020587 439
610 3300005343 Ga0070687_100006970 Ga0070687_1000069702 439
611 3300005353 Ga0070669_100008824 Ga0070669_1000088244 439
612 3300005355 Ga0070671_100024213 Ga0070671_1000242132 439
613 3300005438 Ga0070701_10083807 Ga0070701_100838071 439
614 3300005441 Ga0070700_100013610 Ga0070700_1000136102 439
615 3300005444 Ga0070694_100040127 Ga0070694_1000401272 439
616 3300005445 Ga0070708_100014111 Ga0070708_1000141111 439
617 3300005445 Ga0070708_100014189 Ga0070708_1000141893 439
618 3300005457 Ga0070662_100000088 Ga0070662_10000008822 439
619 3300005457 Ga0070662_100047570 Ga0070662_1000475702 439
620 3300005458 Ga0070681_10000048 Ga0070681_1000004825 439
621 3300005467 Ga0070706_100037799 Ga0070706_1000377993 439
622 3300005468 Ga0070707_100158595 Ga0070707_1001585952 439
623 3300005471 Ga0070698_100027818 Ga0070698_1000278185 439
624 3300005518 Ga0070699_100050066 Ga0070699_1000500662 439
625 3300005530 Ga0070679_100000079 Ga0070679_1000000795 439
626 3300005536 Ga0070697_100000366 Ga0070697_10000036622 439
627 3300005536 Ga0070697_100008900 Ga0070697_1000089005 439
628 3300005536 Ga0070697_100032897 Ga0070697_1000328971 439
629 3300005536 Ga0070697_100086956 Ga0070697_1000869562 439
630 3300005536 Ga0070697_100146986 Ga0070697_1001469862 439
631 3300005544 Ga0070686_100007820 Ga0070686_1000078202 439
632 3300005547 Ga0070693_100032371 Ga0070693_1000323712 439
633 3300005549 Ga0070704_100026646 Ga0070704_1000266461 439
634 3300005577 Ga0068857_100059506 Ga0068857_1000595062 439
635 3300005578 Ga0068854_100096313 Ga0068854_1000963131 439
636 3300005614 Ga0068856_100006040 Ga0068856_1000060406 439
637 3300005617 Ga0068859_100167063 Ga0068859_1001670632 439
638 3300005719 Ga0068861_100014416 Ga0068861_1000144162 439
639 3300005843 Ga0068860_100025860 Ga0068860_1000258602 439
640 3300005844 Ga0068862_100013332 Ga0068862_1000133322 439
641 3300005844 Ga0068862_100048770 Ga0068862_1000487702 439
642 3300006173 Ga0070716_100000010 Ga0070716_10000001098 439
643 3300006358 Ga0068871_100144608 Ga0068871_1001446081 439
644 3300006852 Ga0075433_10011742 Ga0075433_100117424 439
645 3300006881 Ga0068865_100025715 Ga0068865_1000257152 439
646 3300006914 Ga0075436_100000006 Ga0075436_100000006211 439
647 3300006931 Ga0097620_100167063 Ga0097620_1001670632 439
648 3300007076 Ga0075435_100002065 Ga0075435_1000020657 439
649 3300009094 Ga0111539_10005719 Ga0111539_100057192 439
650 3300009147 Ga0114129_10102962 Ga0114129_101029623 439
651 3300009147 Ga0114129_10107181 Ga0114129_101071811 439
652 3300009553 Ga0105249_10043675 Ga0105249_100436751 439
653 3300009553 Ga0105249_10099497 Ga0105249_100994972 439
654 3300010375 Ga0105239_10013822 Ga0105239_100138222 439
655 3300011119 Ga0105246_10087284 Ga0105246_100872842 439
656 3300013297 Ga0157378_10008075 Ga0157378_100080752 439
657 3300013306 Ga0163162_10252759 Ga0163162_102527592 439
658 3300013307 Ga0157372_10027079 Ga0157372_100270793 439
659 3300013308 Ga0157375_10053440 Ga0157375_100534402 439
660 3300014325 Ga0163163_10000696 Ga0163163_1000069610 439
661 3300014325 Ga0163163_10168698 Ga0163163_101686983 439
662 3300014326 Ga0157380_10006205 Ga0157380_100062054 439
663 3300014968 Ga0157379_10019834 Ga0157379_100198343 439
664 3300025910 Ga0207684_10016018 Ga0207684_100160183 439
665 3300025912 Ga0207707_10000015 Ga0207707_1000001548 439
666 3300025917 Ga0207660_10068881 Ga0207660_100688812 439
667 3300025918 Ga0207662_10001313 Ga0207662_100013133 439
668 3300025921 Ga0207652_10002603 Ga0207652_100026034 439
669 3300025922 Ga0207646_10133037 Ga0207646_101330372 439
670 3300025923 Ga0207681_10025857 Ga0207681_100258573 439
671 3300025931 Ga0207644_10016062 Ga0207644_100160623 439
672 3300025933 Ga0207706_10000527 Ga0207706_1000052715 439
673 3300025933 Ga0207706_10216389 Ga0207706_102163891 439
674 3300025935 Ga0207709_10180753 Ga0207709_101807531 439
675 3300025939 Ga0207665_10000010 Ga0207665_1000001095 439
676 3300025942 Ga0207689_10010447 Ga0207689_100104472 439
677 3300025942 Ga0207689_10010745 Ga0207689_100107455 439
678 3300025961 Ga0207712_10017399 Ga0207712_100173991 439
679 3300026075 Ga0207708_10024183 Ga0207708_100241832 439
680 3300026078 Ga0207702_10043753 Ga0207702_100437531 439
681 3300026089 Ga0207648_10173314 Ga0207648_101733141 439
682 3300026116 Ga0207674_10065914 Ga0207674_100659142 439
683 3300026116 Ga0207674_10098551 Ga0207674_100985512 439
684 3300026118 Ga0207675_100001216 Ga0207675_10000121613 439
685 3300027907 Ga0207428_10045502 Ga0207428_100455021 439
686 3300028380 Ga0268265_10089173 Ga0268265_100891732 439
687 3300028381 Ga0268264_10053326 Ga0268264_100533262 439
688 3300028381 Ga0268264_10070007 Ga0268264_100700073 439
689 3300031548 Ga0307408_100204466 Ga0307408_1002044661 439
690 3300036401 Ga0373937_0050393 Ga0373937_0050393_450_1847 439
691 3300048905 Ga0496102_0070132 Ga0496102_0070132_1023_2420 439
692 3300048916 Ga0496113_0194176 Ga0496113_0194176_163_1560 439
693 3300050513 nmdc:mga0rr50_697_c1 nmdc:mga0rr50_697_c1_9666_11096 439
694 3300050514 nmdc:mga08x19_13_c1 nmdc:mga08x19_13_c1_268440_269870 439
695 3300005434 Ga0070709_10014270 Ga0070709_100142702 440
696 3300005435 Ga0070714_100027183 Ga0070714_1000271832 440
697 3300005435 Ga0070714_100083861 Ga0070714_1000838612 440
698 3300005436 Ga0070713_100002665 Ga0070713_10000266511 440
699 3300005458 Ga0070681_10003381 Ga0070681_100033815 440
700 3300005530 Ga0070679_100015360 Ga0070679_1000153602 440
701 3300005547 Ga0070693_100004171 Ga0070693_1000041712 440
702 3300006028 Ga0070717_10004414 Ga0070717_100044142 440
703 3300006844 Ga0075428_100011220 Ga0075428_1000112204 440
704 3300025915 Ga0207693_10040532 Ga0207693_100405322 440
705 3300025928 Ga0207700_10001659 Ga0207700_100016597 440
706 3300025929 Ga0207664_10196822 Ga0207664_101968221 440
707 3300035083 Ga0373926_0001478 Ga0373926_0001478_3311_4687 440
708 3300035089 Ga0373944_0012820 Ga0373944_0012820_307_1683 440
709 3300035116 Ga0373945_0019222 Ga0373945_0019222_149_1525 440
710 3300035170 Ga0373943_0002406 Ga0373943_0002406_202_1578 440
711 3300035171 Ga0373946_0009803 Ga0373946_0009803_869_2245 440
712 3300035692 Ga0373935_0020467 Ga0373935_0020467_1900_3276 440
713 3300035695 Ga0373927_0009011 Ga0373927_0009011_3173_4549 440
714 3300035725 Ga0373947_0013582 Ga0373947_0013582_644_2020 440
715 3300037068 Ga0373925_0013499 Ga0373925_0013499_2646_4022 440
716 3300046459 Ga0495629_0015341 Ga0495629_0015341_951_2336 440
717 3300046472 Ga0495580_0025509 Ga0495580_0025509_1062_2438 440
718 3300046475 Ga0495639_0000589 Ga0495639_0000589_772_2148 440
719 3300046517 Ga0495630_0001355 Ga0495630_0001355_4305_5681 440
720 3300046531 Ga0495665_0002050 Ga0495665_0002050_8764_10140 440
721 3300046674 Ga0495588_0002108 Ga0495588_0002108_5959_7335 440
722 3300046683 Ga0495658_0001117 Ga0495658_0001117_7758_9134 440
723 3300046689 Ga0495613_0010333 Ga0495613_0010333_3844_5220 440
724 3300047315 Ga0495581_0000780 Ga0495581_0000780_9144_10520 440
725 3300047673 Ga0495593_0000587 Ga0495593_0000587_8538_9914 440
726 3300048089 Ga0495614_0000014 Ga0495614_0000014_34369_35745 440
727 3300009551 Ga0105238_10000193 Ga0105238_1000019315 441
728 3300025924 Ga0207694_10000150 Ga0207694_1000015015 441
729 3300037471 Ga0395905_0060560 Ga0395905_0060560_1715_3151 441
730 3300037471 Ga0395905_0223554 Ga0395905_0223554_289_1728 441
731 3300044693 Ga0466961_0008116 Ga0466961_0008116_5206_6624 441
732 3300000549 LJQas_1000004 LJQas_100000417 442
733 3300009093 Ga0105240_10000186 Ga0105240_1000018612 442
734 3300021384 Ga0213876_10000031 Ga0213876_10000031119 442
735 3300025913 Ga0207695_10000281 Ga0207695_1000028176 442
736 3300025918 Ga0207662_10005114 Ga0207662_100051142 442
737 3300031456 Ga0307513_10004115 Ga0307513_100041157 442
738 3300038443 Ga0395901_0022256 Ga0395901_0022256_2611_3990 442
739 3300039437 Ga0436365_0882969 Ga0436365_0882969_159092_160510 442
740 3300053102 Ga0500554_025611 Ga0500554_025611_122_1519 442

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13347

MFS_2

MFS/sugar transport protein

35

280

0.83

PF07690

MFS_1

Major Facilitator Superfamily

14

341

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8293 2 413
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8231 2 413
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8005 2 413
6kkk-assembly3.cif.gz_C crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) 0.7948 2 412
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.7862 2 413
ID Description Score Start End Superfamily
af_D3ZPP5_275_405_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9188 231 350 1.20.1250.20
af_F1R4M7_275_416_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9036 226 350 1.20.1250.20
af_E7EYD2_580_800_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8945 226 419 1.20.1250.20
af_Q7KWK4_204_629_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8935 2 411 1.20.1250.20
af_Q6YK44_74_579_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8881 11 414 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Y2DTF3-F1-model_v4 MFS transporter 0.9911 1 395 GO:0016020
GO:0022857
AF-A0A3M1SK15-F1-model_v4 MFS transporter 0.9821 1 304 GO:0016020
GO:0022857
AF-A0A7Y2DTF3-F1-model_v4 MFS transporter 0.9812 1 395 GO:0016020
GO:0022857
AF-A0A2V7VBQ4-F1-model_v4 MFS transporter 0.9809 213 416 GO:0016020
AF-A0A350YX58-F1-model_v4 MFS transporter 0.9803 229 416 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
85.48 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map