F478556
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 325 | 739 | 450 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_3031_c1|nmdc:mga05p37_3031_c1_9936_11516 |
| Length | 515 |
| Sequence | MEKPRLSFWQIWNMSFGFLGIQFGWGLQLANMSAIYTYLGADPDRIPILWLAGPMTGLIVQPIIGSMSDRTWNRLGRRRPYFLVGAILSSIALFFMPDSTALWIAASLLWILDASINVSMEPFRAFVADKLNVEQRTVGFVMQSFFIGIGATLANGLPYLFRQLGVTGRTASGIPLTVQYSFKIGAAAFLLCVLWTVLTSKEYPPENLEEFRRKQAETRGTGGIVGKLINVVREMPQTMKQLAVVQVFTWLGLFCMWMFFGLMTSRHVFGARDPSSARFAEGGEWGGICFAVYSIVCLIVALAFNPMSNTMLCLVTVAIYSVIESFTVFVIHSPWSLTRFVGMAMASCVLVLLVRWMSKAASRKTFHASSLVCGGIGLLSTYLIHDQYVLLLTMVGVGIAWASILSMPYAILSGALPAARMGVYMGIFNFFIVIPEIVASLTFQPLVRYVFNNNPLYVVMLGGASLLVAAALVARVRDVADRITPEVVLAADEHEPFVVPESVQPVPSTGLVDES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 131 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 192 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 243 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 290 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 291 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 292 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 293 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 294 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 295 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 300 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 301 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 303 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 310 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 324 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.08 |
| Nodule | 0 |
| Rhizoplane | 0.81 |
| Rhizosphere | 96.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000004 | 3300000549 | Bacteria | 34891 |
| 2 | JGI25406J46586_10000597 | 3300003203 | Bacteria | 17002 |
| 3 | JGI25406J46586_10004308 | 3300003203 | Bacteria | 6642 |
| 4 | Ga0065714_10002198 | 3300005288 | Bacteria | 90565 |
| 5 | Ga0065704_10001544 | 3300005289 | Bacteria | 8135 |
| 6 | Ga0065704_10108457 | 3300005289 | Bacteria | 2028 |
| 7 | Ga0065712_10000119 | 3300005290 | Bacteria | 137052 |
| 8 | Ga0065712_10007765 | 3300005290 | Bacteria | 4418 |
| 9 | Ga0065712_10022415 | 3300005290 | Bacteria | 1688 |
| 10 | Ga0065715_10002646 | 3300005293 | Bacteria | 4585 |
| 11 | Ga0065715_10095431 | 3300005293 | Bacteria | 4082 |
| 12 | Ga0065707_10003824 | 3300005295 | Bacteria | 3523 |
| 13 | Ga0065707_10011320 | 3300005295 | Bacteria | 3457 |
| 14 | Ga0070658_10001325 | 3300005327 | Bacteria | 21112 |
| 15 | Ga0070658_10082619 | 3300005327 | Bacteria | 2640 |
| 16 | Ga0070658_10099506 | 3300005327 | Bacteria | 2403 |
| 17 | Ga0070676_10032770 | 3300005328 | Bacteria | 2979 |
| 18 | Ga0070683_100014240 | 3300005329 | Bacteria | 6951 |
| 19 | Ga0070683_100103421 | 3300005329 | Bacteria | 2684 |
| 20 | Ga0070690_100004860 | 3300005330 | Bacteria | 7506 |
| 21 | Ga0070670_100002232 | 3300005331 | Bacteria | 15924 |
| 22 | Ga0070670_100007508 | 3300005331 | Bacteria | 9256 |
| 23 | Ga0070670_100013610 | 3300005331 | Bacteria | 6971 |
| 24 | Ga0070670_100151984 | 3300005331 | Bacteria | 2004 |
| 25 | Ga0068869_100081597 | 3300005334 | Bacteria | 2415 |
| 26 | Ga0070666_10011613 | 3300005335 | Bacteria | 5533 |
| 27 | Ga0070666_10040261 | 3300005335 | Bacteria | 3119 |
| 28 | Ga0070680_100002058 | 3300005336 | Bacteria | 14834 |
| 29 | Ga0070680_100059074 | 3300005336 | Bacteria | 3137 |
| 30 | Ga0070682_100000145 | 3300005337 | Bacteria | 56593 |
| 31 | Ga0070682_100038766 | 3300005337 | Bacteria | 2924 |
| 32 | Ga0070682_100148475 | 3300005337 | Unclassified | 1606 |
| 33 | Ga0068868_100127419 | 3300005338 | Bacteria | 2081 |
| 34 | Ga0070660_100038191 | 3300005339 | Bacteria | 3644 |
| 35 | Ga0070660_100081044 | 3300005339 | Bacteria | 2548 |
| 36 | Ga0070689_100011051 | 3300005340 | Bacteria | 6454 |
| 37 | Ga0070689_100011882 | 3300005340 | Bacteria | 6250 |
| 38 | Ga0070687_100006970 | 3300005343 | Bacteria | 4675 |
| 39 | Ga0070687_100022676 | 3300005343 | Bacteria | 2972 |
| 40 | Ga0070687_100033052 | 3300005343 | Bacteria | 2550 |
| 41 | Ga0070661_100005989 | 3300005344 | Bacteria | 8369 |
| 42 | Ga0070692_10012394 | 3300005345 | Bacteria | 3945 |
| 43 | Ga0070668_100121682 | 3300005347 | Bacteria | 2087 |
| 44 | Ga0070669_100000581 | 3300005353 | Bacteria | 27178 |
| 45 | Ga0070669_100002722 | 3300005353 | Bacteria | 12752 |
| 46 | Ga0070669_100003088 | 3300005353 | Bacteria | 11988 |
| 47 | Ga0070669_100008824 | 3300005353 | Bacteria | 7194 |
| 48 | Ga0070669_100017526 | 3300005353 | Bacteria | 5108 |
| 49 | Ga0070675_100001987 | 3300005354 | Bacteria | 15166 |
| 50 | Ga0070675_100020546 | 3300005354 | Bacteria | 5269 |
| 51 | Ga0070671_100017291 | 3300005355 | Bacteria | 5839 |
| 52 | Ga0070671_100024213 | 3300005355 | Bacteria | 4969 |
| 53 | Ga0070674_100013539 | 3300005356 | Bacteria | 5046 |
| 54 | Ga0070674_100017320 | 3300005356 | Bacteria | 4529 |
| 55 | Ga0070673_100015463 | 3300005364 | Bacteria | 5361 |
| 56 | Ga0070673_100025636 | 3300005364 | Bacteria | 4343 |
| 57 | Ga0070688_100007920 | 3300005365 | Bacteria | 5745 |
| 58 | Ga0070659_100049173 | 3300005366 | Bacteria | 3315 |
| 59 | Ga0070667_100200823 | 3300005367 | Bacteria | 1769 |
| 60 | Ga0070703_10000258 | 3300005406 | Bacteria | 25659 |
| 61 | Ga0070703_10021176 | 3300005406 | Bacteria | 1898 |
| 62 | Ga0070709_10000023 | 3300005434 | Bacteria | 132636 |
| 63 | Ga0070709_10014270 | 3300005434 | Bacteria | 4492 |
| 64 | Ga0070714_100002411 | 3300005435 | Bacteria | 13776 |
| 65 | Ga0070714_100027183 | 3300005435 | Bacteria | 4735 |
| 66 | Ga0070714_100083861 | 3300005435 | Bacteria | 2780 |
| 67 | Ga0070713_100002665 | 3300005436 | Bacteria | 11632 |
| 68 | Ga0070701_10000533 | 3300005438 | Bacteria | 13103 |
| 69 | Ga0070701_10072572 | 3300005438 | Bacteria | 1844 |
| 70 | Ga0070701_10083807 | 3300005438 | Bacteria | 1732 |
| 71 | Ga0070711_100000024 | 3300005439 | Bacteria | 117125 |
| 72 | Ga0070700_100000099 | 3300005441 | Bacteria | 56217 |
| 73 | Ga0070700_100013610 | 3300005441 | Bacteria | 4573 |
| 74 | Ga0070700_100055814 | 3300005441 | Bacteria | 2473 |
| 75 | Ga0070694_100040127 | 3300005444 | Unclassified | 3120 |
| 76 | Ga0070708_100000091 | 3300005445 | Bacteria | 59200 |
| 77 | Ga0070708_100014111 | 3300005445 | Bacteria | 6568 |
| 78 | Ga0070708_100014189 | 3300005445 | Bacteria | 6547 |
| 79 | Ga0070708_100017065 | 3300005445 | Bacteria | 6045 |
| 80 | Ga0070662_100000088 | 3300005457 | Bacteria | 50362 |
| 81 | Ga0070662_100042818 | 3300005457 | Bacteria | 3236 |
| 82 | Ga0070662_100047570 | 3300005457 | Unclassified | 3086 |
| 83 | Ga0070662_100058417 | 3300005457 | Bacteria | 2807 |
| 84 | Ga0070681_10000048 | 3300005458 | Bacteria | 82548 |
| 85 | Ga0070681_10000650 | 3300005458 | Bacteria | 28674 |
| 86 | Ga0070681_10003381 | 3300005458 | Bacteria | 14926 |
| 87 | Ga0070681_10018466 | 3300005458 | Bacteria | 6970 |
| 88 | Ga0070681_10075881 | 3300005458 | Unclassified | 3321 |
| 89 | Ga0070681_10271704 | 3300005458 | Bacteria | 1607 |
| 90 | Ga0068867_100003151 | 3300005459 | Bacteria | 11630 |
| 91 | Ga0068867_100006105 | 3300005459 | Bacteria | 8529 |
| 92 | Ga0070685_10008928 | 3300005466 | Bacteria | 5171 |
| 93 | Ga0070706_100000015 | 3300005467 | Bacteria | 188425 |
| 94 | Ga0070706_100000266 | 3300005467 | Bacteria | 63768 |
| 95 | Ga0070706_100001562 | 3300005467 | Bacteria | 23916 |
| 96 | Ga0070706_100037799 | 3300005467 | Bacteria | 4457 |
| 97 | Ga0070706_100100835 | 3300005467 | Bacteria | 2683 |
| 98 | Ga0070707_100158595 | 3300005468 | Bacteria | 2204 |
| 99 | Ga0070707_100159966 | 3300005468 | Bacteria | 2194 |
| 100 | Ga0070698_100004135 | 3300005471 | Bacteria | 15960 |
| 101 | Ga0070698_100013222 | 3300005471 | Bacteria | 8734 |
| 102 | Ga0070698_100016011 | 3300005471 | Bacteria | 7920 |
| 103 | Ga0070698_100027818 | 3300005471 | Bacteria | 5875 |
| 104 | Ga0070698_100173391 | 3300005471 | Bacteria | 2097 |
| 105 | Ga0070698_100226695 | 3300005471 | Bacteria | 1802 |
| 106 | Ga0070699_100000021 | 3300005518 | Bacteria | 164544 |
| 107 | Ga0070699_100050066 | 3300005518 | Bacteria | 3616 |
| 108 | Ga0070699_100099321 | 3300005518 | Bacteria | 2551 |
| 109 | Ga0070699_100135596 | 3300005518 | Bacteria | 2171 |
| 110 | Ga0070699_100231806 | 3300005518 | Bacteria | 1647 |
| 111 | Ga0070679_100000079 | 3300005530 | Bacteria | 72586 |
| 112 | Ga0070679_100015360 | 3300005530 | Bacteria | 7357 |
| 113 | Ga0070679_100021013 | 3300005530 | Bacteria | 6370 |
| 114 | Ga0070684_100008305 | 3300005535 | Bacteria | 8111 |
| 115 | Ga0070684_100116615 | 3300005535 | Bacteria | 2399 |
| 116 | Ga0070697_100000366 | 3300005536 | Bacteria | 35335 |
| 117 | Ga0070697_100000694 | 3300005536 | Bacteria | 25190 |
| 118 | Ga0070697_100008900 | 3300005536 | Bacteria | 7841 |
| 119 | Ga0070697_100032897 | 3300005536 | Bacteria | 4175 |
| 120 | Ga0070697_100086956 | 3300005536 | Bacteria | 2580 |
| 121 | Ga0070697_100104179 | 3300005536 | Bacteria | 2359 |
| 122 | Ga0070697_100113280 | 3300005536 | Bacteria | 2263 |
| 123 | Ga0070697_100146986 | 3300005536 | Unclassified | 1985 |
| 124 | Ga0070697_100268444 | 3300005536 | Bacteria | 1462 |
| 125 | Ga0068853_100000011 | 3300005539 | Bacteria | 246709 |
| 126 | Ga0068853_100006085 | 3300005539 | Bacteria | 9553 |
| 127 | Ga0070672_100001164 | 3300005543 | Bacteria | 16038 |
| 128 | Ga0070672_100012675 | 3300005543 | Bacteria | 5932 |
| 129 | Ga0070686_100007820 | 3300005544 | Bacteria | 5975 |
| 130 | Ga0070695_100038698 | 3300005545 | Bacteria | 3012 |
| 131 | Ga0070695_100096163 | 3300005545 | Bacteria | 1986 |
| 132 | Ga0070696_100002421 | 3300005546 | Bacteria | 12364 |
| 133 | Ga0070696_100084178 | 3300005546 | Bacteria | 2256 |
| 134 | Ga0070696_100085918 | 3300005546 | Bacteria | 2233 |
| 135 | Ga0070693_100004171 | 3300005547 | Bacteria | 6819 |
| 136 | Ga0070693_100013626 | 3300005547 | Bacteria | 4146 |
| 137 | Ga0070693_100032371 | 3300005547 | Bacteria | 2875 |
| 138 | Ga0070693_100032742 | 3300005547 | Bacteria | 2862 |
| 139 | Ga0070665_100036053 | 3300005548 | Bacteria | 4976 |
| 140 | Ga0070665_100037131 | 3300005548 | Bacteria | 4900 |
| 141 | Ga0070665_100049517 | 3300005548 | Bacteria | 4215 |
| 142 | Ga0070665_100074853 | 3300005548 | Bacteria | 3392 |
| 143 | Ga0070704_100026646 | 3300005549 | Bacteria | 3824 |
| 144 | Ga0068855_100302784 | 3300005563 | Bacteria | 1770 |
| 145 | Ga0070664_100050391 | 3300005564 | Bacteria | 3523 |
| 146 | Ga0070664_100144177 | 3300005564 | Bacteria | 2099 |
| 147 | Ga0070664_100231305 | 3300005564 | Bacteria | 1657 |
| 148 | Ga0068857_100007858 | 3300005577 | Bacteria | 9199 |
| 149 | Ga0068857_100019588 | 3300005577 | Bacteria | 5943 |
| 150 | Ga0068857_100023990 | 3300005577 | Bacteria | 5369 |
| 151 | Ga0068857_100052018 | 3300005577 | Bacteria | 3634 |
| 152 | Ga0068857_100059506 | 3300005577 | Bacteria | 3393 |
| 153 | Ga0068857_100071833 | 3300005577 | Bacteria | 3084 |
| 154 | Ga0068854_100033576 | 3300005578 | Unclassified | 3578 |
| 155 | Ga0068854_100096313 | 3300005578 | Bacteria | 2211 |
| 156 | Ga0068856_100006040 | 3300005614 | Bacteria | 11906 |
| 157 | Ga0070702_100017626 | 3300005615 | Bacteria | 3688 |
| 158 | Ga0070702_100061313 | 3300005615 | Bacteria | 2190 |
| 159 | Ga0070702_100121564 | 3300005615 | Bacteria | 1636 |
| 160 | Ga0068852_100137429 | 3300005616 | Unclassified | 2258 |
| 161 | Ga0068859_100029764 | 3300005617 | Bacteria | 5479 |
| 162 | Ga0068859_100043506 | 3300005617 | Bacteria | 4513 |
| 163 | Ga0068859_100167063 | 3300005617 | Unclassified | 2280 |
| 164 | Ga0068859_100267687 | 3300005617 | Bacteria | 1801 |
| 165 | Ga0068859_100270501 | 3300005617 | Bacteria | 1791 |
| 166 | Ga0068864_100021543 | 3300005618 | Bacteria | 5399 |
| 167 | Ga0068864_100089887 | 3300005618 | Bacteria | 2706 |
| 168 | Ga0068864_100244746 | 3300005618 | Bacteria | 1663 |
| 169 | Ga0068866_10108567 | 3300005718 | Bacteria | 1544 |
| 170 | Ga0068861_100001695 | 3300005719 | Bacteria | 14147 |
| 171 | Ga0068861_100004364 | 3300005719 | Bacteria | 9487 |
| 172 | Ga0068861_100006547 | 3300005719 | Bacteria | 7948 |
| 173 | Ga0068861_100009333 | 3300005719 | Bacteria | 6771 |
| 174 | Ga0068861_100014416 | 3300005719 | Bacteria | 5549 |
| 175 | Ga0068861_100021342 | 3300005719 | Bacteria | 4654 |
| 176 | Ga0068870_10009123 | 3300005840 | Bacteria | 4494 |
| 177 | Ga0068863_100134993 | 3300005841 | Unclassified | 2357 |
| 178 | Ga0068858_100059034 | 3300005842 | Bacteria | 3545 |
| 179 | Ga0068858_100062291 | 3300005842 | Bacteria | 3449 |
| 180 | Ga0068858_100092522 | 3300005842 | Bacteria | 2815 |
| 181 | Ga0068858_100100933 | 3300005842 | Bacteria | 2691 |
| 182 | Ga0068860_100005979 | 3300005843 | Bacteria | 12248 |
| 183 | Ga0068860_100025860 | 3300005843 | Bacteria | 5662 |
| 184 | Ga0068860_100059954 | 3300005843 | Bacteria | 3617 |
| 185 | Ga0068862_100000865 | 3300005844 | Bacteria | 29644 |
| 186 | Ga0068862_100013332 | 3300005844 | Bacteria | 6800 |
| 187 | Ga0068862_100017780 | 3300005844 | Bacteria | 5918 |
| 188 | Ga0068862_100024013 | 3300005844 | Bacteria | 5110 |
| 189 | Ga0068862_100048770 | 3300005844 | Unclassified | 3615 |
| 190 | Ga0068862_100059699 | 3300005844 | Bacteria | 3275 |
| 191 | Ga0068862_100123294 | 3300005844 | Bacteria | 2286 |
| 192 | Ga0081540_1034260 | 3300005983 | Bacteria | 2742 |
| 193 | Ga0081539_10000073 | 3300005985 | Bacteria | 231470 |
| 194 | Ga0081539_10000898 | 3300005985 | Bacteria | 56680 |
| 195 | Ga0081539_10001369 | 3300005985 | Bacteria | 42259 |
| 196 | Ga0081539_10007977 | 3300005985 | Bacteria | 9414 |
| 197 | Ga0081539_10054186 | 3300005985 | Bacteria | 2241 |
| 198 | Ga0070717_10004414 | 3300006028 | Bacteria | 10153 |
| 199 | Ga0075365_10016339 | 3300006038 | Bacteria | 4512 |
| 200 | Ga0070715_10000002 | 3300006163 | Bacteria | 389554 |
| 201 | Ga0070716_100000010 | 3300006173 | Bacteria | 157261 |
| 202 | Ga0070712_100071862 | 3300006175 | Bacteria | 2477 |
| 203 | Ga0075367_10011831 | 3300006178 | Bacteria | 4634 |
| 204 | Ga0075366_10000251 | 3300006195 | Bacteria | 23598 |
| 205 | Ga0097621_100017758 | 3300006237 | Bacteria | 5413 |
| 206 | Ga0068871_100003645 | 3300006358 | Bacteria | 10581 |
| 207 | Ga0068871_100124043 | 3300006358 | Bacteria | 2184 |
| 208 | Ga0068871_100144608 | 3300006358 | Bacteria | 2023 |
| 209 | Ga0068871_100192142 | 3300006358 | Bacteria | 1759 |
| 210 | Ga0075428_100011220 | 3300006844 | Bacteria | 9971 |
| 211 | Ga0075428_100013356 | 3300006844 | Bacteria | 9133 |
| 212 | Ga0075430_100006705 | 3300006846 | Bacteria | 9712 |
| 213 | Ga0075430_100011532 | 3300006846 | Bacteria | 7512 |
| 214 | Ga0075430_100013476 | 3300006846 | Bacteria | 6969 |
| 215 | Ga0075430_100015750 | 3300006846 | Bacteria | 6439 |
| 216 | Ga0075430_100019708 | 3300006846 | Bacteria | 5738 |
| 217 | Ga0075430_100043930 | 3300006846 | Bacteria | 3779 |
| 218 | Ga0075430_100093201 | 3300006846 | Bacteria | 2518 |
| 219 | Ga0075430_100128861 | 3300006846 | Bacteria | 2109 |
| 220 | Ga0075431_100003521 | 3300006847 | Bacteria | 15169 |
| 221 | Ga0075431_100019334 | 3300006847 | Bacteria | 6943 |
| 222 | Ga0075431_100053313 | 3300006847 | Bacteria | 4170 |
| 223 | Ga0075431_100056685 | 3300006847 | Bacteria | 4041 |
| 224 | Ga0075431_100098481 | 3300006847 | Bacteria | 3019 |
| 225 | Ga0075431_100202087 | 3300006847 | Bacteria | 2033 |
| 226 | Ga0075433_10011742 | 3300006852 | Bacteria | 7053 |
| 227 | Ga0075433_10036926 | 3300006852 | Bacteria | 4211 |
| 228 | Ga0075433_10055537 | 3300006852 | Bacteria | 3457 |
| 229 | Ga0075433_10090815 | 3300006852 | Bacteria | 2700 |
| 230 | Ga0075433_10146047 | 3300006852 | Bacteria | 2102 |
| 231 | Ga0075434_100007923 | 3300006871 | Bacteria | 9845 |
| 232 | Ga0075434_100087780 | 3300006871 | Bacteria | 3111 |
| 233 | Ga0075434_100103085 | 3300006871 | Bacteria | 2861 |
| 234 | Ga0075434_100130516 | 3300006871 | Bacteria | 2531 |
| 235 | Ga0075434_100221205 | 3300006871 | Bacteria | 1913 |
| 236 | Ga0075429_100011715 | 3300006880 | Bacteria | 7606 |
| 237 | Ga0075429_100045841 | 3300006880 | Bacteria | 3804 |
| 238 | Ga0075429_100053028 | 3300006880 | Bacteria | 3529 |
| 239 | Ga0075429_100194729 | 3300006880 | Bacteria | 1775 |
| 240 | Ga0068865_100025715 | 3300006881 | Bacteria | 3876 |
| 241 | Ga0068865_100034608 | 3300006881 | Bacteria | 3391 |
| 242 | Ga0068865_100050625 | 3300006881 | Bacteria | 2870 |
| 243 | Ga0068865_100068133 | 3300006881 | Bacteria | 2515 |
| 244 | Ga0075436_100000006 | 3300006914 | Bacteria | 306066 |
| 245 | Ga0075436_100007044 | 3300006914 | Bacteria | 7697 |
| 246 | Ga0075436_100022879 | 3300006914 | Bacteria | 4293 |
| 247 | Ga0075436_100063125 | 3300006914 | Bacteria | 2560 |
| 248 | Ga0075436_100068084 | 3300006914 | Bacteria | 2460 |
| 249 | Ga0097620_100029764 | 3300006931 | Bacteria | 5479 |
| 250 | Ga0097620_100043504 | 3300006931 | Bacteria | 4513 |
| 251 | Ga0097620_100167063 | 3300006931 | Unclassified | 2280 |
| 252 | Ga0097620_100267708 | 3300006931 | Bacteria | 1801 |
| 253 | Ga0097620_100270484 | 3300006931 | Bacteria | 1791 |
| 254 | Ga0075435_100002065 | 3300007076 | Bacteria | 13165 |
| 255 | Ga0075435_100052016 | 3300007076 | Bacteria | 3300 |
| 256 | Ga0075435_100072136 | 3300007076 | Bacteria | 2821 |
| 257 | Ga0075435_100099353 | 3300007076 | Bacteria | 2410 |
| 258 | Ga0105251_10089602 | 3300009011 | Bacteria | 1414 |
| 259 | Ga0105240_10000186 | 3300009093 | Bacteria | 126271 |
| 260 | Ga0105240_10017556 | 3300009093 | Bacteria | 9640 |
| 261 | Ga0105240_10036231 | 3300009093 | Bacteria | 6348 |
| 262 | Ga0105240_10083110 | 3300009093 | Bacteria | 3930 |
| 263 | Ga0105240_10178981 | 3300009093 | Bacteria | 2504 |
| 264 | Ga0111539_10000333 | 3300009094 | Bacteria | 57916 |
| 265 | Ga0111539_10005719 | 3300009094 | Bacteria | 16078 |
| 266 | Ga0111539_10012815 | 3300009094 | Bacteria | 10494 |
| 267 | Ga0111539_10045812 | 3300009094 | Bacteria | 5234 |
| 268 | Ga0111539_10072169 | 3300009094 | Bacteria | 4072 |
| 269 | Ga0111539_10196841 | 3300009094 | Bacteria | 2350 |
| 270 | Ga0105245_10059275 | 3300009098 | Bacteria | 3447 |
| 271 | Ga0105247_10001245 | 3300009101 | Bacteria | 18879 |
| 272 | Ga0114129_10009296 | 3300009147 | Bacteria | 14018 |
| 273 | Ga0114129_10035088 | 3300009147 | Bacteria | 7086 |
| 274 | Ga0114129_10046930 | 3300009147 | Bacteria | 6070 |
| 275 | Ga0114129_10046934 | 3300009147 | Bacteria | 6070 |
| 276 | Ga0114129_10062700 | 3300009147 | Bacteria | 5193 |
| 277 | Ga0114129_10069480 | 3300009147 | Bacteria | 4910 |
| 278 | Ga0114129_10102962 | 3300009147 | Bacteria | 3948 |
| 279 | Ga0114129_10107181 | 3300009147 | Bacteria | 3859 |
| 280 | Ga0114129_10114211 | 3300009147 | Bacteria | 3723 |
| 281 | Ga0114129_10116295 | 3300009147 | Bacteria | 3685 |
| 282 | Ga0114129_10209077 | 3300009147 | Bacteria | 2639 |
| 283 | Ga0114129_10390341 | 3300009147 | Bacteria | 1836 |
| 284 | Ga0114129_10459301 | 3300009147 | Bacteria | 1669 |
| 285 | Ga0114129_10495538 | 3300009147 | Bacteria | 1596 |
| 286 | Ga0114129_10614550 | 3300009147 | Bacteria | 1407 |
| 287 | Ga0105243_10000349 | 3300009148 | Bacteria | 49476 |
| 288 | Ga0105241_10037066 | 3300009174 | Unclassified | 3672 |
| 289 | Ga0105241_10060016 | 3300009174 | Bacteria | 2925 |
| 290 | Ga0105241_10175575 | 3300009174 | Bacteria | 1773 |
| 291 | Ga0105242_10001577 | 3300009176 | Bacteria | 17916 |
| 292 | Ga0105242_10051803 | 3300009176 | Bacteria | 3347 |
| 293 | Ga0105242_10141489 | 3300009176 | Bacteria | 2088 |
| 294 | Ga0105248_10006052 | 3300009177 | Bacteria | 13277 |
| 295 | Ga0105248_10016065 | 3300009177 | Bacteria | 8240 |
| 296 | Ga0105248_10022916 | 3300009177 | Bacteria | 6934 |
| 297 | Ga0105248_10056492 | 3300009177 | Bacteria | 4404 |
| 298 | Ga0105248_10126036 | 3300009177 | Bacteria | 2889 |
| 299 | Ga0105237_10077187 | 3300009545 | Bacteria | 3321 |
| 300 | Ga0105237_10153476 | 3300009545 | Bacteria | 2299 |
| 301 | Ga0105238_10000193 | 3300009551 | Bacteria | 67265 |
| 302 | Ga0105238_10001447 | 3300009551 | Bacteria | 23857 |
| 303 | Ga0105249_10000407 | 3300009553 | Bacteria | 41419 |
| 304 | Ga0105249_10001505 | 3300009553 | Bacteria | 20441 |
| 305 | Ga0105249_10004552 | 3300009553 | Bacteria | 11978 |
| 306 | Ga0105249_10014919 | 3300009553 | Bacteria | 6874 |
| 307 | Ga0105249_10043675 | 3300009553 | Bacteria | 4076 |
| 308 | Ga0105249_10099497 | 3300009553 | Bacteria | 2733 |
| 309 | Ga0105239_10013822 | 3300010375 | Bacteria | 8958 |
| 310 | Ga0105239_10148508 | 3300010375 | Bacteria | 2615 |
| 311 | Ga0105239_10199354 | 3300010375 | Bacteria | 2242 |
| 312 | Ga0105239_10271134 | 3300010375 | Bacteria | 1909 |
| 313 | Ga0105246_10021264 | 3300011119 | Bacteria | 4173 |
| 314 | Ga0105246_10087284 | 3300011119 | Bacteria | 2239 |
| 315 | Ga0157373_10038367 | 3300013100 | Unclassified | 3434 |
| 316 | Ga0157373_10044151 | 3300013100 | Bacteria | 3182 |
| 317 | Ga0157373_10080386 | 3300013100 | Bacteria | 2298 |
| 318 | Ga0157371_10015567 | 3300013102 | Bacteria | 5702 |
| 319 | Ga0157370_10027101 | 3300013104 | Bacteria | 5651 |
| 320 | Ga0157370_10129570 | 3300013104 | Bacteria | 2354 |
| 321 | Ga0157369_10003038 | 3300013105 | Bacteria | 20027 |
| 322 | Ga0157369_10077923 | 3300013105 | Bacteria | 3551 |
| 323 | Ga0157374_10001619 | 3300013296 | Bacteria | 18883 |
| 324 | Ga0157374_10100933 | 3300013296 | Bacteria | 2767 |
| 325 | Ga0157378_10000094 | 3300013297 | Bacteria | 84481 |
| 326 | Ga0157378_10008075 | 3300013297 | Bacteria | 9185 |
| 327 | Ga0157378_10134123 | 3300013297 | Bacteria | 2295 |
| 328 | Ga0163162_10013334 | 3300013306 | Bacteria | 8029 |
| 329 | Ga0163162_10020999 | 3300013306 | Bacteria | 6424 |
| 330 | Ga0163162_10047730 | 3300013306 | Bacteria | 4290 |
| 331 | Ga0163162_10049121 | 3300013306 | Bacteria | 4228 |
| 332 | Ga0163162_10066928 | 3300013306 | Unclassified | 3642 |
| 333 | Ga0163162_10252759 | 3300013306 | Bacteria | 1894 |
| 334 | Ga0157372_10027079 | 3300013307 | Bacteria | 6240 |
| 335 | Ga0157372_10115014 | 3300013307 | Unclassified | 3084 |
| 336 | Ga0157375_10000943 | 3300013308 | Bacteria | 25210 |
| 337 | Ga0157375_10008016 | 3300013308 | Bacteria | 9248 |
| 338 | Ga0157375_10023014 | 3300013308 | Bacteria | 5743 |
| 339 | Ga0157375_10040454 | 3300013308 | Bacteria | 4493 |
| 340 | Ga0157375_10052445 | 3300013308 | Bacteria | 4010 |
| 341 | Ga0157375_10053440 | 3300013308 | Unclassified | 3974 |
| 342 | Ga0157375_10065650 | 3300013308 | Bacteria | 3618 |
| 343 | Ga0157375_10109318 | 3300013308 | Bacteria | 2861 |
| 344 | Ga0163163_10000696 | 3300014325 | Bacteria | 28562 |
| 345 | Ga0163163_10076031 | 3300014325 | Bacteria | 3352 |
| 346 | Ga0163163_10091911 | 3300014325 | Bacteria | 3049 |
| 347 | Ga0163163_10123771 | 3300014325 | Bacteria | 2622 |
| 348 | Ga0163163_10168698 | 3300014325 | Bacteria | 2235 |
| 349 | Ga0163163_10281418 | 3300014325 | Bacteria | 1715 |
| 350 | Ga0157380_10000250 | 3300014326 | Bacteria | 32403 |
| 351 | Ga0157380_10006205 | 3300014326 | Bacteria | 8390 |
| 352 | Ga0157380_10090955 | 3300014326 | Bacteria | 2518 |
| 353 | Ga0157377_10065686 | 3300014745 | Bacteria | 2085 |
| 354 | Ga0157379_10019834 | 3300014968 | Bacteria | 5940 |
| 355 | Ga0157379_10042065 | 3300014968 | Bacteria | 4078 |
| 356 | Ga0157379_10131855 | 3300014968 | Bacteria | 2250 |
| 357 | Ga0157379_10145582 | 3300014968 | Bacteria | 2137 |
| 358 | Ga0157376_10102763 | 3300014969 | Bacteria | 2501 |
| 359 | Ga0213872_10001600 | 3300021361 | Bacteria | 14378 |
| 360 | Ga0213876_10000031 | 3300021384 | Bacteria | 213087 |
| 361 | Ga0213876_10000295 | 3300021384 | Bacteria | 45211 |
| 362 | Ga0213875_10010731 | 3300021388 | Bacteria | 4582 |
| 363 | Ga0224570_100607 | 3300022730 | Bacteria | 2854 |
| 364 | Ga0224572_1002888 | 3300024225 | Bacteria | 2835 |
| 365 | Ga0207697_10000190 | 3300025315 | Bacteria | 32223 |
| 366 | Ga0207697_10002830 | 3300025315 | Bacteria | 8827 |
| 367 | Ga0207653_10000334 | 3300025885 | Bacteria | 24824 |
| 368 | Ga0207653_10005723 | 3300025885 | Bacteria | 3876 |
| 369 | Ga0207710_10002083 | 3300025900 | Bacteria | 9475 |
| 370 | Ga0207688_10037931 | 3300025901 | Bacteria | 2674 |
| 371 | Ga0207688_10041810 | 3300025901 | Bacteria | 2550 |
| 372 | Ga0207680_10062908 | 3300025903 | Bacteria | 2269 |
| 373 | Ga0207647_10000808 | 3300025904 | Bacteria | 24255 |
| 374 | Ga0207685_10000030 | 3300025905 | Bacteria | 89606 |
| 375 | Ga0207699_10000008 | 3300025906 | Bacteria | 358402 |
| 376 | Ga0207699_10022728 | 3300025906 | Bacteria | 3403 |
| 377 | Ga0207645_10001781 | 3300025907 | Bacteria | 17423 |
| 378 | Ga0207645_10024826 | 3300025907 | Bacteria | 3883 |
| 379 | Ga0207643_10005175 | 3300025908 | Bacteria | 6974 |
| 380 | Ga0207643_10009782 | 3300025908 | Bacteria | 5148 |
| 381 | Ga0207643_10110189 | 3300025908 | Bacteria | 1622 |
| 382 | Ga0207705_10020405 | 3300025909 | Bacteria | 4737 |
| 383 | Ga0207705_10196097 | 3300025909 | Bacteria | 1529 |
| 384 | Ga0207684_10000083 | 3300025910 | Bacteria | 176092 |
| 385 | Ga0207684_10002321 | 3300025910 | Bacteria | 19314 |
| 386 | Ga0207684_10016018 | 3300025910 | Bacteria | 6438 |
| 387 | Ga0207684_10036389 | 3300025910 | Bacteria | 4178 |
| 388 | Ga0207684_10057563 | 3300025910 | Bacteria | 3298 |
| 389 | Ga0207684_10128153 | 3300025910 | Bacteria | 2178 |
| 390 | Ga0207654_10082444 | 3300025911 | Bacteria | 1939 |
| 391 | Ga0207707_10000015 | 3300025912 | Bacteria | 259670 |
| 392 | Ga0207707_10018498 | 3300025912 | Bacteria | 6073 |
| 393 | Ga0207707_10034305 | 3300025912 | Bacteria | 4439 |
| 394 | Ga0207707_10081821 | 3300025912 | Bacteria | 2819 |
| 395 | Ga0207695_10000281 | 3300025913 | Bacteria | 126279 |
| 396 | Ga0207695_10013523 | 3300025913 | Bacteria | 9727 |
| 397 | Ga0207695_10237259 | 3300025913 | Bacteria | 1726 |
| 398 | Ga0207671_10002504 | 3300025914 | Bacteria | 19603 |
| 399 | Ga0207671_10024229 | 3300025914 | Bacteria | 4567 |
| 400 | Ga0207693_10040532 | 3300025915 | Bacteria | 3668 |
| 401 | Ga0207693_10042582 | 3300025915 | Bacteria | 3574 |
| 402 | Ga0207663_10000012 | 3300025916 | Bacteria | 167739 |
| 403 | Ga0207660_10068881 | 3300025917 | Bacteria | 2568 |
| 404 | Ga0207660_10111099 | 3300025917 | Bacteria | 2063 |
| 405 | Ga0207662_10000992 | 3300025918 | Bacteria | 13239 |
| 406 | Ga0207662_10001313 | 3300025918 | Bacteria | 11980 |
| 407 | Ga0207662_10005114 | 3300025918 | Bacteria | 6959 |
| 408 | Ga0207662_10075226 | 3300025918 | Bacteria | 2051 |
| 409 | Ga0207662_10165823 | 3300025918 | Bacteria | 1414 |
| 410 | Ga0207657_10024758 | 3300025919 | Bacteria | 5549 |
| 411 | Ga0207657_10027742 | 3300025919 | Bacteria | 5180 |
| 412 | Ga0207649_10035092 | 3300025920 | Bacteria | 3011 |
| 413 | Ga0207649_10072843 | 3300025920 | Bacteria | 2199 |
| 414 | Ga0207652_10002603 | 3300025921 | Bacteria | 15145 |
| 415 | Ga0207646_10112880 | 3300025922 | Bacteria | 2439 |
| 416 | Ga0207646_10133037 | 3300025922 | Bacteria | 2239 |
| 417 | Ga0207681_10004151 | 3300025923 | Bacteria | 8976 |
| 418 | Ga0207681_10024632 | 3300025923 | Bacteria | 3863 |
| 419 | Ga0207681_10025857 | 3300025923 | Bacteria | 3781 |
| 420 | Ga0207681_10029013 | 3300025923 | Bacteria | 3588 |
| 421 | Ga0207681_10047651 | 3300025923 | Bacteria | 2889 |
| 422 | Ga0207681_10074069 | 3300025923 | Bacteria | 2384 |
| 423 | Ga0207694_10000150 | 3300025924 | Bacteria | 71968 |
| 424 | Ga0207694_10004881 | 3300025924 | Bacteria | 10416 |
| 425 | Ga0207650_10099355 | 3300025925 | Bacteria | 2237 |
| 426 | Ga0207700_10001659 | 3300025928 | Bacteria | 12652 |
| 427 | Ga0207700_10181193 | 3300025928 | Bacteria | 1764 |
| 428 | Ga0207664_10002367 | 3300025929 | Bacteria | 12455 |
| 429 | Ga0207664_10196822 | 3300025929 | Bacteria | 1738 |
| 430 | Ga0207644_10016062 | 3300025931 | Bacteria | 5034 |
| 431 | Ga0207644_10048849 | 3300025931 | Bacteria | 3027 |
| 432 | Ga0207644_10053911 | 3300025931 | Bacteria | 2895 |
| 433 | Ga0207706_10000527 | 3300025933 | Bacteria | 40589 |
| 434 | Ga0207706_10007513 | 3300025933 | Bacteria | 10084 |
| 435 | Ga0207706_10048274 | 3300025933 | Bacteria | 3765 |
| 436 | Ga0207706_10216389 | 3300025933 | Unclassified | 1678 |
| 437 | Ga0207686_10002076 | 3300025934 | Bacteria | 11039 |
| 438 | Ga0207709_10000896 | 3300025935 | Bacteria | 22507 |
| 439 | Ga0207709_10003673 | 3300025935 | Bacteria | 9035 |
| 440 | Ga0207709_10180753 | 3300025935 | Bacteria | 1489 |
| 441 | Ga0207670_10006870 | 3300025936 | Bacteria | 6332 |
| 442 | Ga0207669_10010393 | 3300025937 | Bacteria | 4479 |
| 443 | Ga0207704_10124958 | 3300025938 | Bacteria | 1769 |
| 444 | Ga0207665_10000010 | 3300025939 | Bacteria | 157219 |
| 445 | Ga0207691_10049983 | 3300025940 | Bacteria | 3829 |
| 446 | Ga0207691_10060961 | 3300025940 | Bacteria | 3427 |
| 447 | Ga0207691_10065326 | 3300025940 | Bacteria | 3294 |
| 448 | Ga0207691_10158067 | 3300025940 | Bacteria | 1990 |
| 449 | Ga0207711_10006273 | 3300025941 | Bacteria | 10030 |
| 450 | Ga0207711_10054349 | 3300025941 | Bacteria | 3436 |
| 451 | Ga0207689_10010447 | 3300025942 | Bacteria | 7993 |
| 452 | Ga0207689_10010745 | 3300025942 | Bacteria | 7879 |
| 453 | Ga0207689_10013421 | 3300025942 | Bacteria | 6994 |
| 454 | Ga0207689_10052950 | 3300025942 | Bacteria | 3343 |
| 455 | Ga0207689_10092824 | 3300025942 | Bacteria | 2480 |
| 456 | Ga0207661_10051129 | 3300025944 | Bacteria | 3296 |
| 457 | Ga0207679_10009018 | 3300025945 | Bacteria | 6374 |
| 458 | Ga0207679_10022647 | 3300025945 | Bacteria | 4281 |
| 459 | Ga0207679_10025447 | 3300025945 | Bacteria | 4070 |
| 460 | Ga0207679_10058237 | 3300025945 | Bacteria | 2861 |
| 461 | Ga0207679_10194129 | 3300025945 | Bacteria | 1691 |
| 462 | Ga0207667_10040300 | 3300025949 | Bacteria | 4974 |
| 463 | Ga0207667_10255884 | 3300025949 | Bacteria | 1791 |
| 464 | Ga0207651_10213341 | 3300025960 | Bacteria | 1555 |
| 465 | Ga0207712_10000737 | 3300025961 | Bacteria | 24808 |
| 466 | Ga0207712_10000878 | 3300025961 | Bacteria | 21874 |
| 467 | Ga0207712_10001491 | 3300025961 | Bacteria | 15886 |
| 468 | Ga0207712_10017399 | 3300025961 | Bacteria | 4667 |
| 469 | Ga0207712_10139610 | 3300025961 | Bacteria | 1858 |
| 470 | Ga0207668_10128492 | 3300025972 | Bacteria | 1931 |
| 471 | Ga0207640_10230789 | 3300025981 | Bacteria | 1424 |
| 472 | Ga0207658_10018382 | 3300025986 | Bacteria | 4827 |
| 473 | Ga0207677_10043608 | 3300026023 | Bacteria | 2983 |
| 474 | Ga0207677_10054384 | 3300026023 | Bacteria | 2731 |
| 475 | Ga0207639_10000019 | 3300026041 | Bacteria | 246728 |
| 476 | Ga0207639_10028051 | 3300026041 | Unclassified | 4106 |
| 477 | Ga0207639_10062495 | 3300026041 | Bacteria | 2880 |
| 478 | Ga0207678_10070087 | 3300026067 | Bacteria | 3006 |
| 479 | Ga0207678_10092136 | 3300026067 | Bacteria | 2590 |
| 480 | Ga0207708_10024183 | 3300026075 | Unclassified | 4593 |
| 481 | Ga0207708_10026489 | 3300026075 | Bacteria | 4389 |
| 482 | Ga0207702_10043753 | 3300026078 | Bacteria | 3761 |
| 483 | Ga0207648_10000296 | 3300026089 | Bacteria | 54157 |
| 484 | Ga0207648_10012629 | 3300026089 | Bacteria | 7900 |
| 485 | Ga0207648_10024695 | 3300026089 | Bacteria | 5361 |
| 486 | Ga0207648_10173314 | 3300026089 | Unclassified | 1907 |
| 487 | Ga0207676_10031044 | 3300026095 | Bacteria | 4015 |
| 488 | Ga0207676_10050181 | 3300026095 | Bacteria | 3251 |
| 489 | Ga0207676_10138172 | 3300026095 | Bacteria | 2082 |
| 490 | Ga0207674_10006330 | 3300026116 | Bacteria | 13942 |
| 491 | Ga0207674_10010797 | 3300026116 | Bacteria | 10297 |
| 492 | Ga0207674_10034076 | 3300026116 | Bacteria | 5325 |
| 493 | Ga0207674_10065914 | 3300026116 | Bacteria | 3649 |
| 494 | Ga0207674_10098551 | 3300026116 | Bacteria | 2906 |
| 495 | Ga0207674_10287799 | 3300026116 | Bacteria | 1592 |
| 496 | Ga0207675_100001216 | 3300026118 | Bacteria | 25684 |
| 497 | Ga0207675_100003058 | 3300026118 | Bacteria | 16405 |
| 498 | Ga0207675_100024358 | 3300026118 | Bacteria | 5628 |
| 499 | Ga0207675_100084477 | 3300026118 | Bacteria | 2979 |
| 500 | Ga0207683_10008228 | 3300026121 | Bacteria | 8922 |
| 501 | Ga0207428_10000665 | 3300027907 | Bacteria | 40252 |
| 502 | Ga0207428_10003354 | 3300027907 | Bacteria | 15564 |
| 503 | Ga0207428_10045502 | 3300027907 | Bacteria | 3534 |
| 504 | Ga0207428_10077553 | 3300027907 | Bacteria | 2601 |
| 505 | Ga0265356_1001451 | 3300028017 | Bacteria | 3506 |
| 506 | Ga0268266_10025358 | 3300028379 | Bacteria | 5043 |
| 507 | Ga0268266_10026792 | 3300028379 | Bacteria | 4905 |
| 508 | Ga0268266_10133048 | 3300028379 | Bacteria | 2226 |
| 509 | Ga0268265_10001765 | 3300028380 | Bacteria | 17368 |
| 510 | Ga0268265_10089173 | 3300028380 | Bacteria | 2459 |
| 511 | Ga0268264_10053326 | 3300028381 | Unclassified | 3373 |
| 512 | Ga0268264_10070007 | 3300028381 | Bacteria | 2969 |
| 513 | Ga0268264_10070920 | 3300028381 | Bacteria | 2950 |
| 514 | Ga0265332_10030549 | 3300031238 | Bacteria | 2353 |
| 515 | Ga0265325_10000457 | 3300031241 | Bacteria | 29473 |
| 516 | Ga0265325_10011149 | 3300031241 | Bacteria | 5174 |
| 517 | Ga0265339_10005958 | 3300031249 | Bacteria | 8060 |
| 518 | Ga0265327_10022303 | 3300031251 | Bacteria | 3791 |
| 519 | Ga0265327_10076793 | 3300031251 | Bacteria | 1659 |
| 520 | Ga0265316_10001737 | 3300031344 | Bacteria | 23108 |
| 521 | Ga0265316_10067967 | 3300031344 | Bacteria | 2755 |
| 522 | Ga0307513_10004115 | 3300031456 | Bacteria | 19495 |
| 523 | Ga0307408_100003574 | 3300031548 | Bacteria | 10593 |
| 524 | Ga0307408_100008937 | 3300031548 | Bacteria | 6618 |
| 525 | Ga0307408_100162349 | 3300031548 | Bacteria | 1776 |
| 526 | Ga0307408_100204466 | 3300031548 | Bacteria | 1601 |
| 527 | Ga0265313_10018326 | 3300031595 | Bacteria | 3935 |
| 528 | Ga0316576_10014082 | 3300031727 | Bacteria | 5334 |
| 529 | Ga0307405_10031153 | 3300031731 | Bacteria | 3136 |
| 530 | Ga0307405_10034757 | 3300031731 | Bacteria | 3003 |
| 531 | Ga0307413_10009277 | 3300031824 | Bacteria | 4701 |
| 532 | Ga0307413_10062488 | 3300031824 | Bacteria | 2304 |
| 533 | Ga0307410_10000762 | 3300031852 | Bacteria | 13535 |
| 534 | Ga0307410_10002630 | 3300031852 | Bacteria | 8746 |
| 535 | Ga0307410_10061201 | 3300031852 | Bacteria | 2576 |
| 536 | Ga0307410_10172888 | 3300031852 | Bacteria | 1629 |
| 537 | Ga0307406_10003162 | 3300031901 | Bacteria | 8958 |
| 538 | Ga0307406_10007552 | 3300031901 | Bacteria | 6034 |
| 539 | Ga0307406_10092021 | 3300031901 | Bacteria | 2044 |
| 540 | Ga0307406_10121851 | 3300031901 | Bacteria | 1815 |
| 541 | Ga0307407_10107650 | 3300031903 | Bacteria | 1744 |
| 542 | Ga0307412_10003206 | 3300031911 | Bacteria | 9090 |
| 543 | Ga0307412_10050550 | 3300031911 | Bacteria | 2744 |
| 544 | Ga0307409_100006099 | 3300031995 | Bacteria | 7044 |
| 545 | Ga0307409_100020708 | 3300031995 | Bacteria | 4490 |
| 546 | Ga0307409_100030746 | 3300031995 | Bacteria | 3864 |
| 547 | Ga0307409_100051939 | 3300031995 | Bacteria | 3140 |
| 548 | Ga0307409_100101220 | 3300031995 | Bacteria | 2390 |
| 549 | Ga0307416_100003301 | 3300032002 | Bacteria | 9438 |
| 550 | Ga0307416_100067954 | 3300032002 | Bacteria | 2942 |
| 551 | Ga0307416_100099182 | 3300032002 | Bacteria | 2529 |
| 552 | Ga0307416_100100048 | 3300032002 | Bacteria | 2520 |
| 553 | Ga0307414_10001981 | 3300032004 | Bacteria | 10622 |
| 554 | Ga0307414_10236942 | 3300032004 | Bacteria | 1508 |
| 555 | Ga0307411_10003967 | 3300032005 | Bacteria | 6991 |
| 556 | Ga0307411_10095498 | 3300032005 | Bacteria | 2087 |
| 557 | Ga0307415_100006040 | 3300032126 | Bacteria | 6489 |
| 558 | Ga0373926_0001478 | 3300035083 | Bacteria | 7174 |
| 559 | Ga0373944_0012820 | 3300035089 | Bacteria | 2316 |
| 560 | Ga0373951_0012962 | 3300035091 | Bacteria | 1874 |
| 561 | Ga0373939_0027816 | 3300035114 | Bacteria | 1605 |
| 562 | Ga0373941_0016135 | 3300035115 | Bacteria | 2025 |
| 563 | Ga0373945_0019222 | 3300035116 | Bacteria | 2331 |
| 564 | Ga0373956_0048735 | 3300035119 | Bacteria | 1898 |
| 565 | Ga0373943_0002406 | 3300035170 | Bacteria | 8483 |
| 566 | Ga0373946_0009803 | 3300035171 | Bacteria | 3537 |
| 567 | Ga0316574_0022811 | 3300035398 | Bacteria | 3732 |
| 568 | Ga0373935_0020467 | 3300035692 | Bacteria | 4044 |
| 569 | Ga0373927_0001502 | 3300035695 | Bacteria | 17563 |
| 570 | Ga0373927_0007658 | 3300035695 | Bacteria | 7307 |
| 571 | Ga0373927_0009011 | 3300035695 | Bacteria | 6700 |
| 572 | Ga0373927_0130569 | 3300035695 | Bacteria | 1641 |
| 573 | Ga0373947_0013582 | 3300035725 | Bacteria | 4665 |
| 574 | Ga0373947_0014764 | 3300035725 | Bacteria | 4481 |
| 575 | Ga0373937_0050393 | 3300036401 | Bacteria | 3814 |
| 576 | Ga0316584_0039502 | 3300036712 | Bacteria | 3513 |
| 577 | Ga0373925_0013499 | 3300037068 | Bacteria | 5913 |
| 578 | Ga0395899_0085733 | 3300037312 | Bacteria | 2289 |
| 579 | Ga0395900_0001406 | 3300037418 | Bacteria | 28805 |
| 580 | Ga0395898_0027895 | 3300037466 | Bacteria | 5662 |
| 581 | Ga0395898_0134230 | 3300037466 | Bacteria | 2370 |
| 582 | Ga0395905_0008205 | 3300037471 | Bacteria | 10315 |
| 583 | Ga0395905_0060560 | 3300037471 | Bacteria | 3540 |
| 584 | Ga0395905_0223554 | 3300037471 | Bacteria | 1762 |
| 585 | Ga0436364_1339265 | 3300037853 | Bacteria | 10176 |
| 586 | Ga0395901_0022256 | 3300038443 | Bacteria | 6494 |
| 587 | Ga0436365_0882969 | 3300039437 | Bacteria | 184313 |
| 588 | Ga0436365_1601972 | 3300039437 | Bacteria | 65837 |
| 589 | Ga0436365_1783306 | 3300039437 | Bacteria | 2057 |
| 590 | Ga0436361_0881637 | 3300039447 | Bacteria | 23287 |
| 591 | Ga0436363_0991061 | 3300039450 | Bacteria | 8326 |
| 592 | Ga0439458_0008559 | 3300042157 | Bacteria | 2280 |
| 593 | Ga0451577_0000005 | 3300042876 | Bacteria | 712599 |
| 594 | Ga0451577_0004971 | 3300042876 | Bacteria | 13796 |
| 595 | Ga0451577_0020861 | 3300042876 | Bacteria | 6005 |
| 596 | Ga0451577_0088818 | 3300042876 | Bacteria | 2758 |
| 597 | Ga0466969_0022523 | 3300044656 | Bacteria | 3252 |
| 598 | Ga0453683_0012241 | 3300044673 | Bacteria | 5629 |
| 599 | Ga0466961_0008116 | 3300044693 | Bacteria | 6684 |
| 600 | Ga0466961_0027151 | 3300044693 | Bacteria | 3681 |
| 601 | Ga0466963_0056409 | 3300044694 | Bacteria | 2614 |
| 602 | Ga0453684_0001014 | 3300044712 | Bacteria | 90517 |
| 603 | Ga0453684_0010740 | 3300044712 | Bacteria | 15557 |
| 604 | Ga0453684_0022578 | 3300044712 | Bacteria | 9324 |
| 605 | Ga0466959_0059697 | 3300045049 | Bacteria | 2777 |
| 606 | Ga0451576_0060963 | 3300045051 | Bacteria | 3935 |
| 607 | Ga0466967_0049638 | 3300045976 | Bacteria | 3670 |
| 608 | Ga0495629_0015341 | 3300046459 | Bacteria | 5502 |
| 609 | Ga0495641_0005278 | 3300046461 | Bacteria | 8783 |
| 610 | Ga0495580_0023592 | 3300046472 | Bacteria | 4515 |
| 611 | Ga0495580_0025509 | 3300046472 | Bacteria | 4320 |
| 612 | Ga0495580_0042715 | 3300046472 | Bacteria | 3228 |
| 613 | Ga0495582_0030464 | 3300046473 | Bacteria | 2962 |
| 614 | Ga0495639_0000589 | 3300046475 | Bacteria | 16934 |
| 615 | Ga0495594_0099485 | 3300046499 | Bacteria | 1635 |
| 616 | Ga0495630_0001355 | 3300046517 | Bacteria | 16842 |
| 617 | Ga0495630_0052697 | 3300046517 | Bacteria | 3046 |
| 618 | Ga0495630_0148017 | 3300046517 | Bacteria | 1786 |
| 619 | Ga0495643_0000069 | 3300046522 | Bacteria | 172047 |
| 620 | Ga0495663_0000834 | 3300046525 | Bacteria | 10567 |
| 621 | Ga0495666_0065026 | 3300046526 | Bacteria | 1740 |
| 622 | Ga0495665_0002050 | 3300046531 | Bacteria | 10911 |
| 623 | Ga0495665_0026803 | 3300046531 | Bacteria | 3095 |
| 624 | Ga0495586_0040548 | 3300046535 | Bacteria | 2506 |
| 625 | Ga0495598_0000152 | 3300046537 | Bacteria | 11830 |
| 626 | Ga0495621_0000280 | 3300046539 | Bacteria | 12303 |
| 627 | Ga0495634_0024532 | 3300046642 | Bacteria | 4230 |
| 628 | Ga0495588_0002108 | 3300046674 | Bacteria | 8537 |
| 629 | Ga0495658_0001117 | 3300046683 | Bacteria | 14199 |
| 630 | Ga0495658_0001171 | 3300046683 | Bacteria | 13838 |
| 631 | Ga0495669_0033350 | 3300046684 | Bacteria | 2266 |
| 632 | Ga0495613_0010333 | 3300046689 | Bacteria | 6933 |
| 633 | Ga0495581_0000780 | 3300047315 | Bacteria | 16930 |
| 634 | Ga0495581_0012547 | 3300047315 | Bacteria | 4909 |
| 635 | Ga0495672_0000500 | 3300047320 | Bacteria | 45343 |
| 636 | Ga0495676_0074834 | 3300047321 | Bacteria | 2592 |
| 637 | Ga0495593_0000587 | 3300047673 | Bacteria | 20755 |
| 638 | Ga0495614_0000014 | 3300048089 | Bacteria | 56596 |
| 639 | Ga0495614_0056773 | 3300048089 | Bacteria | 1681 |
| 640 | Ga0496102_0070132 | 3300048905 | Bacteria | 3218 |
| 641 | Ga0496112_0063908 | 3300048915 | Bacteria | 3631 |
| 642 | Ga0496112_0245131 | 3300048915 | Bacteria | 1744 |
| 643 | Ga0496112_0293806 | 3300048915 | Bacteria | 1571 |
| 644 | Ga0496112_0381775 | 3300048915 | Bacteria | 1350 |
| 645 | Ga0496113_0194176 | 3300048916 | Bacteria | 1612 |
| 646 | Ga0501298_010840 | 3300049521 | Bacteria | 1574 |
| 647 | Ga0501031_0000122 | 3300049568 | Bacteria | 42868 |
| 648 | Ga0501032_0027405 | 3300049569 | Bacteria | 3915 |
| 649 | Ga0501033_0022595 | 3300049570 | Bacteria | 4745 |
| 650 | Ga0501038_0002371 | 3300049574 | Bacteria | 17541 |
| 651 | Ga0501038_0120263 | 3300049574 | Bacteria | 2167 |
| 652 | Ga0501039_0058291 | 3300049575 | Bacteria | 2991 |
| 653 | Ga0501041_0032028 | 3300049577 | Bacteria | 3178 |
| 654 | Ga0501046_0061178 | 3300049580 | Bacteria | 2945 |
| 655 | Ga0501046_0219975 | 3300049580 | Bacteria | 1406 |
| 656 | Ga0501073_0056674 | 3300049589 | Bacteria | 2741 |
| 657 | Ga0501075_0051560 | 3300049591 | Bacteria | 3094 |
| 658 | Ga0501076_0051770 | 3300049592 | Bacteria | 3251 |
| 659 | Ga0501077_0053904 | 3300049593 | Bacteria | 2554 |
| 660 | Ga0501198_005752 | 3300049649 | Bacteria | 1752 |
| 661 | Ga0501202_004237 | 3300049652 | Bacteria | 2506 |
| 662 | Ga0501207_002489 | 3300049654 | Bacteria | 2385 |
| 663 | Ga0501216_002400 | 3300049660 | Bacteria | 2656 |
| 664 | Ga0501217_000124 | 3300049661 | Bacteria | 10177 |
| 665 | Ga0501217_012307 | 3300049661 | Bacteria | 1904 |
| 666 | Ga0501223_003737 | 3300049663 | Bacteria | 3290 |
| 667 | Ga0501224_002117 | 3300049664 | Bacteria | 2691 |
| 668 | Ga0501227_002821 | 3300049665 | Bacteria | 3813 |
| 669 | Ga0501227_019704 | 3300049665 | Bacteria | 1540 |
| 670 | Ga0501233_002582 | 3300049668 | Bacteria | 3201 |
| 671 | Ga0501235_004623 | 3300049669 | Bacteria | 2976 |
| 672 | Ga0501243_006991 | 3300049675 | Bacteria | 1719 |
| 673 | Ga0501257_007181 | 3300049686 | Bacteria | 2486 |
| 674 | Ga0501225_0000940 | 3300049705 | Bacteria | 9087 |
| 675 | Ga0501229_001976 | 3300049706 | Bacteria | 2413 |
| 676 | Ga0501229_005777 | 3300049706 | Bacteria | 1524 |
| 677 | Ga0501234_002275 | 3300049707 | Bacteria | 3031 |
| 678 | Ga0501079_0286828 | 3300049741 | Bacteria | 1287 |
| 679 | Ga0501283_001997 | 3300049779 | Bacteria | 2641 |
| 680 | Ga0501283_002891 | 3300049779 | Bacteria | 2252 |
| 681 | Ga0501035_0008777 | 3300049822 | Bacteria | 9410 |
| 682 | Ga0501044_0000430 | 3300049823 | Bacteria | 51693 |
| 683 | Ga0501045_0044473 | 3300049824 | Bacteria | 3235 |
| 684 | Ga0501045_0090560 | 3300049824 | Bacteria | 2260 |
| 685 | Ga0501204_004521 | 3300049850 | Bacteria | 1501 |
| 686 | Ga0501226_000756 | 3300049853 | Bacteria | 4365 |
| 687 | nmdc:mga03683_17100_c1 | 3300050489 | Bacteria | 2739 |
| 688 | nmdc:mga0yw44_80741_c1 | 3300050492 | Bacteria | 2038 |
| 689 | nmdc:mga0k408_1976_c1 | 3300050493 | Bacteria | 10993 |
| 690 | nmdc:mga05p37_116125_c1 | 3300050507 | Bacteria | 3289 |
| 691 | nmdc:mga05p37_117500_c1 | 3300050507 | Bacteria | 3268 |
| 692 | nmdc:mga05p37_135924_c1 | 3300050507 | Bacteria | 3015 |
| 693 | nmdc:mga05p37_139733_c1 | 3300050507 | Bacteria | 2968 |
| 694 | nmdc:mga05p37_210318_c1 | 3300050507 | Bacteria | 2352 |
| 695 | nmdc:mga05p37_215664_c1 | 3300050507 | Bacteria | 2318 |
| 696 | nmdc:mga05p37_220815_c1 | 3300050507 | Bacteria | 2287 |
| 697 | nmdc:mga05p37_282476_c1 | 3300050507 | Bacteria | 1979 |
| 698 | nmdc:mga05p37_3031_c1 | 3300050507 | Bacteria | 19512 |
| 699 | nmdc:mga05p37_40613_c1 | 3300050507 | Bacteria | 5713 |
| 700 | nmdc:mga05p37_40739_c2 | 3300050507 | Unclassified | 3619 |
| 701 | nmdc:mga05p37_81409_c1 | 3300050507 | Bacteria | 3988 |
| 702 | nmdc:mga09592_153791_c1 | 3300050508 | Bacteria | 1985 |
| 703 | nmdc:mga09592_205071_c1 | 3300050508 | Bacteria | 1708 |
| 704 | nmdc:mga09592_42652_c1 | 3300050508 | Bacteria | 3816 |
| 705 | nmdc:mga09592_58937_c1 | 3300050508 | Bacteria | 3246 |
| 706 | nmdc:mga0qj67_104439_c1 | 3300050509 | Bacteria | 2286 |
| 707 | nmdc:mga0qj67_14701_c1 | 3300050509 | Bacteria | 5918 |
| 708 | nmdc:mga0qj67_35060_c1 | 3300050509 | Bacteria | 3922 |
| 709 | nmdc:mga0qj67_7100_c1 | 3300050509 | Bacteria | 8263 |
| 710 | nmdc:mga06r32_18255_c1 | 3300050510 | Bacteria | 6419 |
| 711 | nmdc:mga06r32_222893_c1 | 3300050510 | Bacteria | 1874 |
| 712 | nmdc:mga06r32_38641_c1 | 3300050510 | Bacteria | 4111 |
| 713 | nmdc:mga06r32_51027_c2 | 3300050510 | Bacteria | 3484 |
| 714 | nmdc:mga06r32_74590_c1 | 3300050510 | Bacteria | 3289 |
| 715 | nmdc:mga06r32_9748_c1 | 3300050510 | Bacteria | 8674 |
| 716 | nmdc:mga08y16_141102_c1 | 3300050511 | Bacteria | 2505 |
| 717 | nmdc:mga08y16_158978_c1 | 3300050511 | Bacteria | 2348 |
| 718 | nmdc:mga08y16_304108_c1 | 3300050511 | Bacteria | 1643 |
| 719 | nmdc:mga08y16_3897_c1 | 3300050511 | Bacteria | 15538 |
| 720 | nmdc:mga08y16_65708_c1 | 3300050511 | Bacteria | 3786 |
| 721 | nmdc:mga0n895_165483_c1 | 3300050512 | Bacteria | 2243 |
| 722 | nmdc:mga0rr50_12455_c1 | 3300050513 | Bacteria | 5500 |
| 723 | nmdc:mga0rr50_38935_c1 | 3300050513 | Bacteria | 3445 |
| 724 | nmdc:mga0rr50_697_c1 | 3300050513 | Bacteria | 18007 |
| 725 | nmdc:mga08x19_13_c1 | 3300050514 | Bacteria | 366166 |
| 726 | nmdc:mga08x19_14576_c1 | 3300050514 | Bacteria | 4769 |
| 727 | nmdc:mga08x19_14823_c1 | 3300050514 | Bacteria | 2830 |
| 728 | nmdc:mga08x19_7_c1 | 3300050514 | Bacteria | 437351 |
| 729 | nmdc:mga0a205_132770_c1 | 3300050515 | Bacteria | 2390 |
| 730 | nmdc:mga0a205_146005_c1 | 3300050515 | Bacteria | 2265 |
| 731 | nmdc:mga0a205_20308_c1 | 3300050515 | Bacteria | 6265 |
| 732 | nmdc:mga0a205_315218_c1 | 3300050515 | Bacteria | 1436 |
| 733 | nmdc:mga0a205_47408_c1 | 3300050515 | Bacteria | 4146 |
| 734 | nmdc:mga0a205_51041_c2 | 3300050515 | Bacteria | 2443 |
| 735 | nmdc:mga0a205_51429_c1 | 3300050515 | Bacteria | 3977 |
| 736 | nmdc:mga0a205_59000_c1 | 3300050515 | Bacteria | 3707 |
| 737 | Ga0500554_025611 | 3300053102 | Bacteria | 1685 |
| 738 | Ga0500628_000346 | 3300053129 | Bacteria | 8819 |
| 739 | Ga0501082_0059825 | 3300060353 | Bacteria | 3283 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049741 | Ga0501079_0286828 | Ga0501079_0286828_141_1274 | 371 |
| 2 | 3300044693 | Ga0466961_0027151 | Ga0466961_0027151_48_1208 | 380 |
| 3 | 3300021388 | Ga0213875_10010731 | Ga0213875_100107313 | 382 |
| 4 | 3300037853 | Ga0436364_1339265 | Ga0436364_1339265_5892_7274 | 382 |
| 5 | 3300048915 | Ga0496112_0381775 | Ga0496112_0381775_20_1282 | 383 |
| 6 | 3300005617 | Ga0068859_100029764 | Ga0068859_1000297643 | 386 |
| 7 | 3300006931 | Ga0097620_100029764 | Ga0097620_1000297643 | 386 |
| 8 | 3300022730 | Ga0224570_100607 | Ga0224570_1006072 | 393 |
| 9 | 3300024225 | Ga0224572_1002888 | Ga0224572_10028882 | 393 |
| 10 | 3300026067 | Ga0207678_10092136 | Ga0207678_100921362 | 393 |
| 11 | 3300028017 | Ga0265356_1001451 | Ga0265356_10014511 | 393 |
| 12 | 3300006852 | Ga0075433_10055537 | Ga0075433_100555372 | 395 |
| 13 | 3300035695 | Ga0373927_0001502 | Ga0373927_0001502_14595_15911 | 395 |
| 14 | 3300050507 | nmdc:mga05p37_117500_c1 | nmdc:mga05p37_117500_c1_449_1846 | 395 |
| 15 | 3300005406 | Ga0070703_10021176 | Ga0070703_100211762 | 396 |
| 16 | 3300005547 | Ga0070693_100013626 | Ga0070693_1000136262 | 396 |
| 17 | 3300005615 | Ga0070702_100017626 | Ga0070702_1000176262 | 396 |
| 18 | 3300009093 | Ga0105240_10178981 | Ga0105240_101789812 | 396 |
| 19 | 3300010375 | Ga0105239_10199354 | Ga0105239_101993542 | 396 |
| 20 | 3300014968 | Ga0157379_10131855 | Ga0157379_101318552 | 396 |
| 21 | 3300025885 | Ga0207653_10005723 | Ga0207653_100057232 | 396 |
| 22 | 3300025914 | Ga0207671_10002504 | Ga0207671_1000250414 | 396 |
| 23 | 3300049589 | Ga0501073_0056674 | Ga0501073_0056674_831_2147 | 396 |
| 24 | 3300049779 | Ga0501283_002891 | Ga0501283_002891_661_1959 | 396 |
| 25 | 3300045049 | Ga0466959_0059697 | Ga0466959_0059697_43_1290 | 397 |
| 26 | 3300005331 | Ga0070670_100013610 | Ga0070670_1000136101 | 398 |
| 27 | 3300005564 | Ga0070664_100144177 | Ga0070664_1001441772 | 398 |
| 28 | 3300006358 | Ga0068871_100192142 | Ga0068871_1001921422 | 398 |
| 29 | 3300025945 | Ga0207679_10194129 | Ga0207679_101941292 | 398 |
| 30 | 3300060353 | Ga0501082_0059825 | Ga0501082_0059825_747_2066 | 400 |
| 31 | 3300005327 | Ga0070658_10001325 | Ga0070658_1000132515 | 401 |
| 32 | 3300025909 | Ga0207705_10020405 | Ga0207705_100204053 | 401 |
| 33 | 3300009147 | Ga0114129_10209077 | Ga0114129_102090772 | 402 |
| 34 | 3300035398 | Ga0316574_0022811 | Ga0316574_0022811_995_2329 | 402 |
| 35 | 3300045976 | Ga0466967_0049638 | Ga0466967_0049638_125_1468 | 402 |
| 36 | 3300050507 | nmdc:mga05p37_220815_c1 | nmdc:mga05p37_220815_c1_1027_2274 | 402 |
| 37 | 3300009094 | Ga0111539_10072169 | Ga0111539_100721692 | 403 |
| 38 | 3300009147 | Ga0114129_10614550 | Ga0114129_106145501 | 403 |
| 39 | 3300050511 | nmdc:mga08y16_141102_c1 | nmdc:mga08y16_141102_c1_452_1750 | 403 |
| 40 | 3300005329 | Ga0070683_100103421 | Ga0070683_1001034212 | 404 |
| 41 | 3300025913 | Ga0207695_10237259 | Ga0207695_102372591 | 404 |
| 42 | 3300005467 | Ga0070706_100100835 | Ga0070706_1001008352 | 405 |
| 43 | 3300005468 | Ga0070707_100159966 | Ga0070707_1001599662 | 405 |
| 44 | 3300005518 | Ga0070699_100231806 | Ga0070699_1002318061 | 405 |
| 45 | 3300006881 | Ga0068865_100068133 | Ga0068865_1000681332 | 405 |
| 46 | 3300025910 | Ga0207684_10128153 | Ga0207684_101281532 | 405 |
| 47 | 3300025922 | Ga0207646_10112880 | Ga0207646_101128802 | 405 |
| 48 | 3300006844 | Ga0075428_100013356 | Ga0075428_1000133564 | 406 |
| 49 | 3300009147 | Ga0114129_10390341 | Ga0114129_103903412 | 406 |
| 50 | 3300044694 | Ga0466963_0056409 | Ga0466963_0056409_816_2159 | 406 |
| 51 | 3300050507 | nmdc:mga05p37_116125_c1 | nmdc:mga05p37_116125_c1_1521_2810 | 406 |
| 52 | 3300005356 | Ga0070674_100017320 | Ga0070674_1000173202 | 407 |
| 53 | 3300005536 | Ga0070697_100268444 | Ga0070697_1002684441 | 407 |
| 54 | 3300009176 | Ga0105242_10051803 | Ga0105242_100518032 | 407 |
| 55 | 3300025937 | Ga0207669_10010393 | Ga0207669_100103932 | 407 |
| 56 | 3300031727 | Ga0316576_10014082 | Ga0316576_100140822 | 407 |
| 57 | 3300036712 | Ga0316584_0039502 | Ga0316584_0039502_168_1517 | 407 |
| 58 | 3300039450 | Ga0436363_0991061 | Ga0436363_0991061_4350_5792 | 407 |
| 59 | 3300049649 | Ga0501198_005752 | Ga0501198_005752_279_1583 | 407 |
| 60 | 3300006847 | Ga0075431_100003521 | Ga0075431_1000035216 | 409 |
| 61 | 3300044712 | Ga0453684_0010740 | Ga0453684_0010740_1977_3359 | 409 |
| 62 | 3300046472 | Ga0495580_0042715 | Ga0495580_0042715_20_1414 | 409 |
| 63 | 3300006847 | Ga0075431_100202087 | Ga0075431_1002020872 | 410 |
| 64 | 3300006880 | Ga0075429_100011715 | Ga0075429_1000117154 | 410 |
| 65 | 3300009093 | Ga0105240_10036231 | Ga0105240_100362315 | 410 |
| 66 | 3300009147 | Ga0114129_10116295 | Ga0114129_101162952 | 410 |
| 67 | 3300025914 | Ga0207671_10024229 | Ga0207671_100242293 | 410 |
| 68 | 3300025928 | Ga0207700_10181193 | Ga0207700_101811932 | 410 |
| 69 | 3300031824 | Ga0307413_10062488 | Ga0307413_100624884 | 410 |
| 70 | 3300031852 | Ga0307410_10000762 | Ga0307410_100007624 | 410 |
| 71 | 3300031903 | Ga0307407_10107650 | Ga0307407_101076501 | 410 |
| 72 | 3300031995 | Ga0307409_100006099 | Ga0307409_1000060995 | 410 |
| 73 | 3300032002 | Ga0307416_100067954 | Ga0307416_1000679541 | 410 |
| 74 | 3300032005 | Ga0307411_10003967 | Ga0307411_100039674 | 410 |
| 75 | 3300050507 | nmdc:mga05p37_81409_c1 | nmdc:mga05p37_81409_c1_1158_2468 | 410 |
| 76 | 3300050508 | nmdc:mga09592_42652_c1 | nmdc:mga09592_42652_c1_528_1838 | 410 |
| 77 | 3300050510 | nmdc:mga06r32_222893_c1 | nmdc:mga06r32_222893_c1_264_1574 | 410 |
| 78 | 3300006846 | Ga0075430_100043930 | Ga0075430_1000439302 | 411 |
| 79 | 3300050510 | nmdc:mga06r32_51027_c2 | nmdc:mga06r32_51027_c2_411_1766 | 411 |
| 80 | 3300050510 | nmdc:mga06r32_9748_c1 | nmdc:mga06r32_9748_c1_845_2182 | 411 |
| 81 | 3300005842 | Ga0068858_100062291 | Ga0068858_1000622914 | 412 |
| 82 | 3300009094 | Ga0111539_10045812 | Ga0111539_100458122 | 412 |
| 83 | 3300014969 | Ga0157376_10102763 | Ga0157376_101027633 | 412 |
| 84 | 3300044712 | Ga0453684_0022578 | Ga0453684_0022578_3981_5432 | 412 |
| 85 | 3300005329 | Ga0070683_100014240 | Ga0070683_1000142404 | 413 |
| 86 | 3300005344 | Ga0070661_100005989 | Ga0070661_1000059892 | 413 |
| 87 | 3300005345 | Ga0070692_10012394 | Ga0070692_100123942 | 413 |
| 88 | 3300005353 | Ga0070669_100003088 | Ga0070669_1000030886 | 413 |
| 89 | 3300005366 | Ga0070659_100049173 | Ga0070659_1000491732 | 413 |
| 90 | 3300005435 | Ga0070714_100002411 | Ga0070714_1000024119 | 413 |
| 91 | 3300005441 | Ga0070700_100055814 | Ga0070700_1000558142 | 413 |
| 92 | 3300005535 | Ga0070684_100116615 | Ga0070684_1001166152 | 413 |
| 93 | 3300005539 | Ga0068853_100006085 | Ga0068853_1000060856 | 413 |
| 94 | 3300005564 | Ga0070664_100050391 | Ga0070664_1000503912 | 413 |
| 95 | 3300005577 | Ga0068857_100019588 | Ga0068857_1000195882 | 413 |
| 96 | 3300005719 | Ga0068861_100001695 | Ga0068861_1000016952 | 413 |
| 97 | 3300005842 | Ga0068858_100100933 | Ga0068858_1001009332 | 413 |
| 98 | 3300005843 | Ga0068860_100059954 | Ga0068860_1000599542 | 413 |
| 99 | 3300009093 | Ga0105240_10083110 | Ga0105240_100831103 | 413 |
| 100 | 3300009098 | Ga0105245_10059275 | Ga0105245_100592752 | 413 |
| 101 | 3300009553 | Ga0105249_10014919 | Ga0105249_100149194 | 413 |
| 102 | 3300010375 | Ga0105239_10148508 | Ga0105239_101485082 | 413 |
| 103 | 3300014968 | Ga0157379_10042065 | Ga0157379_100420653 | 413 |
| 104 | 3300025901 | Ga0207688_10037931 | Ga0207688_100379312 | 413 |
| 105 | 3300025907 | Ga0207645_10001781 | Ga0207645_100017811 | 413 |
| 106 | 3300025919 | Ga0207657_10027742 | Ga0207657_100277425 | 413 |
| 107 | 3300025920 | Ga0207649_10072843 | Ga0207649_100728432 | 413 |
| 108 | 3300025923 | Ga0207681_10029013 | Ga0207681_100290132 | 413 |
| 109 | 3300025923 | Ga0207681_10047651 | Ga0207681_100476511 | 413 |
| 110 | 3300025929 | Ga0207664_10002367 | Ga0207664_100023678 | 413 |
| 111 | 3300025942 | Ga0207689_10013421 | Ga0207689_100134215 | 413 |
| 112 | 3300025945 | Ga0207679_10025447 | Ga0207679_100254472 | 413 |
| 113 | 3300025949 | Ga0207667_10040300 | Ga0207667_100403002 | 413 |
| 114 | 3300026023 | Ga0207677_10054384 | Ga0207677_100543842 | 413 |
| 115 | 3300026041 | Ga0207639_10062495 | Ga0207639_100624952 | 413 |
| 116 | 3300026067 | Ga0207678_10070087 | Ga0207678_100700872 | 413 |
| 117 | 3300026089 | Ga0207648_10012629 | Ga0207648_100126295 | 413 |
| 118 | 3300026116 | Ga0207674_10006330 | Ga0207674_100063302 | 413 |
| 119 | 3300035114 | Ga0373939_0027816 | Ga0373939_0027816_227_1585 | 413 |
| 120 | 3300035115 | Ga0373941_0016135 | Ga0373941_0016135_475_1818 | 413 |
| 121 | 3300045051 | Ga0451576_0060963 | Ga0451576_0060963_2528_3913 | 413 |
| 122 | 3300031548 | Ga0307408_100008937 | Ga0307408_1000089372 | 414 |
| 123 | 3300031901 | Ga0307406_10003162 | Ga0307406_100031625 | 414 |
| 124 | 3300037418 | Ga0395900_0001406 | Ga0395900_0001406_169_1506 | 414 |
| 125 | 3300037466 | Ga0395898_0027895 | Ga0395898_0027895_3219_4556 | 414 |
| 126 | 3300005518 | Ga0070699_100000021 | Ga0070699_10000002159 | 415 |
| 127 | 3300025906 | Ga0207699_10022728 | Ga0207699_100227282 | 415 |
| 128 | 3300005331 | Ga0070670_100002232 | Ga0070670_1000022327 | 416 |
| 129 | 3300005335 | Ga0070666_10040261 | Ga0070666_100402611 | 416 |
| 130 | 3300005355 | Ga0070671_100017291 | Ga0070671_1000172913 | 416 |
| 131 | 3300005364 | Ga0070673_100015463 | Ga0070673_1000154632 | 416 |
| 132 | 3300005406 | Ga0070703_10000258 | Ga0070703_1000025817 | 416 |
| 133 | 3300005445 | Ga0070708_100017065 | Ga0070708_1000170652 | 416 |
| 134 | 3300005467 | Ga0070706_100000266 | Ga0070706_10000026613 | 416 |
| 135 | 3300005536 | Ga0070697_100000694 | Ga0070697_10000069413 | 416 |
| 136 | 3300005539 | Ga0068853_100000011 | Ga0068853_100000011190 | 416 |
| 137 | 3300005547 | Ga0070693_100032742 | Ga0070693_1000327422 | 416 |
| 138 | 3300006237 | Ga0097621_100017758 | Ga0097621_1000177583 | 416 |
| 139 | 3300006846 | Ga0075430_100128861 | Ga0075430_1001288612 | 416 |
| 140 | 3300013296 | Ga0157374_10001619 | Ga0157374_1000161915 | 416 |
| 141 | 3300013306 | Ga0163162_10020999 | Ga0163162_100209992 | 416 |
| 142 | 3300013308 | Ga0157375_10065650 | Ga0157375_100656502 | 416 |
| 143 | 3300025885 | Ga0207653_10000334 | Ga0207653_100003344 | 416 |
| 144 | 3300025910 | Ga0207684_10002321 | Ga0207684_100023219 | 416 |
| 145 | 3300025931 | Ga0207644_10048849 | Ga0207644_100488491 | 416 |
| 146 | 3300026041 | Ga0207639_10000019 | Ga0207639_1000001912 | 416 |
| 147 | 3300042876 | Ga0451577_0000005 | Ga0451577_0000005_449934_451241 | 416 |
| 148 | 3300046461 | Ga0495641_0005278 | Ga0495641_0005278_7075_8427 | 416 |
| 149 | 3300046517 | Ga0495630_0148017 | Ga0495630_0148017_218_1582 | 416 |
| 150 | 3300046526 | Ga0495666_0065026 | Ga0495666_0065026_60_1412 | 416 |
| 151 | 3300046535 | Ga0495586_0040548 | Ga0495586_0040548_946_2298 | 416 |
| 152 | 3300046642 | Ga0495634_0024532 | Ga0495634_0024532_150_1514 | 416 |
| 153 | 3300046683 | Ga0495658_0001171 | Ga0495658_0001171_11818_13170 | 416 |
| 154 | 3300047321 | Ga0495676_0074834 | Ga0495676_0074834_124_1476 | 416 |
| 155 | 3300048089 | Ga0495614_0056773 | Ga0495614_0056773_247_1599 | 416 |
| 156 | 3300049706 | Ga0501229_005777 | Ga0501229_005777_79_1401 | 416 |
| 157 | 3300050507 | nmdc:mga05p37_215664_c1 | nmdc:mga05p37_215664_c1_926_2254 | 416 |
| 158 | 3300005288 | Ga0065714_10002198 | Ga0065714_1000219849 | 417 |
| 159 | 3300005290 | Ga0065712_10000119 | Ga0065712_1000011946 | 417 |
| 160 | 3300013308 | Ga0157375_10052445 | Ga0157375_100524453 | 417 |
| 161 | iso_pu_bacteria | 2786546940 | 2788434003 | 417 |
| 162 | 3300005441 | Ga0070700_100000099 | Ga0070700_10000009929 | 418 |
| 163 | 3300005471 | Ga0070698_100173391 | Ga0070698_1001733912 | 418 |
| 164 | 3300005615 | Ga0070702_100061313 | Ga0070702_1000613132 | 418 |
| 165 | 3300005617 | Ga0068859_100270501 | Ga0068859_1002705012 | 418 |
| 166 | 3300005618 | Ga0068864_100244746 | Ga0068864_1002447462 | 418 |
| 167 | 3300006358 | Ga0068871_100124043 | Ga0068871_1001240432 | 418 |
| 168 | 3300006931 | Ga0097620_100270484 | Ga0097620_1002704842 | 418 |
| 169 | 3300009011 | Ga0105251_10089602 | Ga0105251_100896021 | 418 |
| 170 | 3300009094 | Ga0111539_10196841 | Ga0111539_101968412 | 418 |
| 171 | 3300009174 | Ga0105241_10175575 | Ga0105241_101755752 | 418 |
| 172 | 3300009177 | Ga0105248_10022916 | Ga0105248_100229164 | 418 |
| 173 | 3300025918 | Ga0207662_10165823 | Ga0207662_101658231 | 418 |
| 174 | 3300026095 | Ga0207676_10138172 | Ga0207676_101381722 | 418 |
| 175 | 3300031238 | Ga0265332_10030549 | Ga0265332_100305492 | 418 |
| 176 | 3300031251 | Ga0265327_10022303 | Ga0265327_100223032 | 418 |
| 177 | 3300031548 | Ga0307408_100003574 | Ga0307408_1000035744 | 418 |
| 178 | 3300031731 | Ga0307405_10031153 | Ga0307405_100311532 | 418 |
| 179 | 3300031824 | Ga0307413_10009277 | Ga0307413_100092772 | 418 |
| 180 | 3300031852 | Ga0307410_10002630 | Ga0307410_100026304 | 418 |
| 181 | 3300031852 | Ga0307410_10172888 | Ga0307410_101728882 | 418 |
| 182 | 3300031901 | Ga0307406_10007552 | Ga0307406_100075522 | 418 |
| 183 | 3300031911 | Ga0307412_10003206 | Ga0307412_100032063 | 418 |
| 184 | 3300031995 | Ga0307409_100051939 | Ga0307409_1000519392 | 418 |
| 185 | 3300032002 | Ga0307416_100003301 | Ga0307416_1000033014 | 418 |
| 186 | 3300032004 | Ga0307414_10001981 | Ga0307414_100019814 | 418 |
| 187 | 3300032126 | Ga0307415_100006040 | Ga0307415_1000060402 | 418 |
| 188 | 3300035119 | Ga0373956_0048735 | Ga0373956_0048735_254_1624 | 418 |
| 189 | 3300042876 | Ga0451577_0004971 | Ga0451577_0004971_10192_11511 | 418 |
| 190 | 3300044712 | Ga0453684_0001014 | Ga0453684_0001014_57402_58721 | 418 |
| 191 | 3300049652 | Ga0501202_004237 | Ga0501202_004237_398_1696 | 418 |
| 192 | 3300049654 | Ga0501207_002489 | Ga0501207_002489_150_1448 | 418 |
| 193 | 3300049660 | Ga0501216_002400 | Ga0501216_002400_1124_2422 | 418 |
| 194 | 3300049661 | Ga0501217_000124 | Ga0501217_000124_6130_7428 | 418 |
| 195 | 3300049663 | Ga0501223_003737 | Ga0501223_003737_635_1933 | 418 |
| 196 | 3300049664 | Ga0501224_002117 | Ga0501224_002117_1013_2311 | 418 |
| 197 | 3300049665 | Ga0501227_002821 | Ga0501227_002821_45_1343 | 418 |
| 198 | 3300049668 | Ga0501233_002582 | Ga0501233_002582_188_1486 | 418 |
| 199 | 3300049705 | Ga0501225_0000940 | Ga0501225_0000940_1422_2720 | 418 |
| 200 | 3300049706 | Ga0501229_001976 | Ga0501229_001976_589_1887 | 418 |
| 201 | 3300049707 | Ga0501234_002275 | Ga0501234_002275_1451_2749 | 418 |
| 202 | 3300049853 | Ga0501226_000756 | Ga0501226_000756_591_1889 | 418 |
| 203 | 3300005328 | Ga0070676_10032770 | Ga0070676_100327704 | 419 |
| 204 | 3300005331 | Ga0070670_100007508 | Ga0070670_1000075083 | 419 |
| 205 | 3300005335 | Ga0070666_10011613 | Ga0070666_100116135 | 419 |
| 206 | 3300005347 | Ga0070668_100121682 | Ga0070668_1001216822 | 419 |
| 207 | 3300005353 | Ga0070669_100017526 | Ga0070669_1000175261 | 419 |
| 208 | 3300005354 | Ga0070675_100001987 | Ga0070675_1000019878 | 419 |
| 209 | 3300005356 | Ga0070674_100013539 | Ga0070674_1000135393 | 419 |
| 210 | 3300005365 | Ga0070688_100007920 | Ga0070688_1000079204 | 419 |
| 211 | 3300005458 | Ga0070681_10018466 | Ga0070681_100184662 | 419 |
| 212 | 3300005458 | Ga0070681_10271704 | Ga0070681_102717042 | 419 |
| 213 | 3300005459 | Ga0068867_100003151 | Ga0068867_1000031514 | 419 |
| 214 | 3300005543 | Ga0070672_100001164 | Ga0070672_1000011647 | 419 |
| 215 | 3300005545 | Ga0070695_100096163 | Ga0070695_1000961632 | 419 |
| 216 | 3300005546 | Ga0070696_100084178 | Ga0070696_1000841782 | 419 |
| 217 | 3300005548 | Ga0070665_100049517 | Ga0070665_1000495172 | 419 |
| 218 | 3300005618 | Ga0068864_100021543 | Ga0068864_1000215432 | 419 |
| 219 | 3300006847 | Ga0075431_100098481 | Ga0075431_1000984812 | 419 |
| 220 | 3300006852 | Ga0075433_10090815 | Ga0075433_100908152 | 419 |
| 221 | 3300006871 | Ga0075434_100130516 | Ga0075434_1001305162 | 419 |
| 222 | 3300006871 | Ga0075434_100221205 | Ga0075434_1002212052 | 419 |
| 223 | 3300006881 | Ga0068865_100034608 | Ga0068865_1000346084 | 419 |
| 224 | 3300009545 | Ga0105237_10077187 | Ga0105237_100771873 | 419 |
| 225 | 3300013297 | Ga0157378_10134123 | Ga0157378_101341232 | 419 |
| 226 | 3300013306 | Ga0163162_10013334 | Ga0163162_100133343 | 419 |
| 227 | 3300013308 | Ga0157375_10008016 | Ga0157375_100080163 | 419 |
| 228 | 3300014325 | Ga0163163_10123771 | Ga0163163_101237712 | 419 |
| 229 | 3300025315 | Ga0207697_10000190 | Ga0207697_1000019019 | 419 |
| 230 | 3300025901 | Ga0207688_10041810 | Ga0207688_100418103 | 419 |
| 231 | 3300025903 | Ga0207680_10062908 | Ga0207680_100629082 | 419 |
| 232 | 3300025907 | Ga0207645_10024826 | Ga0207645_100248263 | 419 |
| 233 | 3300025912 | Ga0207707_10034305 | Ga0207707_100343053 | 419 |
| 234 | 3300025945 | Ga0207679_10058237 | Ga0207679_100582372 | 419 |
| 235 | 3300025960 | Ga0207651_10213341 | Ga0207651_102133411 | 419 |
| 236 | 3300025972 | Ga0207668_10128492 | Ga0207668_101284922 | 419 |
| 237 | 3300025986 | Ga0207658_10018382 | Ga0207658_100183822 | 419 |
| 238 | 3300026089 | Ga0207648_10024695 | Ga0207648_100246953 | 419 |
| 239 | 3300026095 | Ga0207676_10031044 | Ga0207676_100310442 | 419 |
| 240 | 3300026121 | Ga0207683_10008228 | Ga0207683_100082282 | 419 |
| 241 | 3300037466 | Ga0395898_0134230 | Ga0395898_0134230_522_1823 | 419 |
| 242 | 3300042157 | Ga0439458_0008559 | Ga0439458_0008559_537_1838 | 419 |
| 243 | 3300047320 | Ga0495672_0000500 | Ga0495672_0000500_5566_6879 | 419 |
| 244 | 3300048915 | Ga0496112_0293806 | Ga0496112_0293806_36_1337 | 419 |
| 245 | 3300050510 | nmdc:mga06r32_74590_c1 | nmdc:mga06r32_74590_c1_1662_2960 | 419 |
| 246 | 3300050515 | nmdc:mga0a205_315218_c1 | nmdc:mga0a205_315218_c1_63_1364 | 419 |
| 247 | 3300050515 | nmdc:mga0a205_59000_c1 | nmdc:mga0a205_59000_c1_1093_2391 | 419 |
| 248 | 3300003203 | JGI25406J46586_10000597 | JGI25406J46586_100005979 | 420 |
| 249 | 3300005290 | Ga0065712_10022415 | Ga0065712_100224152 | 420 |
| 250 | 3300005293 | Ga0065715_10002646 | Ga0065715_100026462 | 420 |
| 251 | 3300005364 | Ga0070673_100025636 | Ga0070673_1000256362 | 420 |
| 252 | 3300005467 | Ga0070706_100000015 | Ga0070706_100000015147 | 420 |
| 253 | 3300005545 | Ga0070695_100038698 | Ga0070695_1000386982 | 420 |
| 254 | 3300005615 | Ga0070702_100121564 | Ga0070702_1001215642 | 420 |
| 255 | 3300005617 | Ga0068859_100043506 | Ga0068859_1000435063 | 420 |
| 256 | 3300005617 | Ga0068859_100267687 | Ga0068859_1002676872 | 420 |
| 257 | 3300005718 | Ga0068866_10108567 | Ga0068866_101085672 | 420 |
| 258 | 3300005719 | Ga0068861_100021342 | Ga0068861_1000213423 | 420 |
| 259 | 3300005840 | Ga0068870_10009123 | Ga0068870_100091232 | 420 |
| 260 | 3300005842 | Ga0068858_100059034 | Ga0068858_1000590342 | 420 |
| 261 | 3300005842 | Ga0068858_100092522 | Ga0068858_1000925222 | 420 |
| 262 | 3300005843 | Ga0068860_100005979 | Ga0068860_1000059794 | 420 |
| 263 | 3300005844 | Ga0068862_100123294 | Ga0068862_1001232942 | 420 |
| 264 | 3300005985 | Ga0081539_10001369 | Ga0081539_100013695 | 420 |
| 265 | 3300006358 | Ga0068871_100003645 | Ga0068871_1000036453 | 420 |
| 266 | 3300006852 | Ga0075433_10036926 | Ga0075433_100369262 | 420 |
| 267 | 3300006931 | Ga0097620_100043504 | Ga0097620_1000435043 | 420 |
| 268 | 3300006931 | Ga0097620_100267708 | Ga0097620_1002677082 | 420 |
| 269 | 3300009551 | Ga0105238_10001447 | Ga0105238_1000144715 | 420 |
| 270 | 3300009553 | Ga0105249_10004552 | Ga0105249_100045522 | 420 |
| 271 | 3300010375 | Ga0105239_10271134 | Ga0105239_102711342 | 420 |
| 272 | 3300013100 | Ga0157373_10044151 | Ga0157373_100441512 | 420 |
| 273 | 3300013306 | Ga0163162_10047730 | Ga0163162_100477303 | 420 |
| 274 | 3300013308 | Ga0157375_10040454 | Ga0157375_100404543 | 420 |
| 275 | 3300013308 | Ga0157375_10109318 | Ga0157375_101093182 | 420 |
| 276 | 3300014325 | Ga0163163_10281418 | Ga0163163_102814182 | 420 |
| 277 | 3300014968 | Ga0157379_10145582 | Ga0157379_101455822 | 420 |
| 278 | 3300025904 | Ga0207647_10000808 | Ga0207647_100008084 | 420 |
| 279 | 3300025908 | Ga0207643_10005175 | Ga0207643_100051753 | 420 |
| 280 | 3300025908 | Ga0207643_10009782 | Ga0207643_100097823 | 420 |
| 281 | 3300025910 | Ga0207684_10000083 | Ga0207684_1000008316 | 420 |
| 282 | 3300025923 | Ga0207681_10074069 | Ga0207681_100740692 | 420 |
| 283 | 3300025924 | Ga0207694_10004881 | Ga0207694_100048817 | 420 |
| 284 | 3300025942 | Ga0207689_10052950 | Ga0207689_100529502 | 420 |
| 285 | 3300025981 | Ga0207640_10230789 | Ga0207640_102307891 | 420 |
| 286 | 3300026116 | Ga0207674_10287799 | Ga0207674_102877992 | 420 |
| 287 | 3300031911 | Ga0307412_10050550 | Ga0307412_100505502 | 420 |
| 288 | 3300035091 | Ga0373951_0012962 | Ga0373951_0012962_576_1862 | 420 |
| 289 | 3300042876 | Ga0451577_0088818 | Ga0451577_0088818_868_2178 | 420 |
| 290 | 3300048915 | Ga0496112_0063908 | Ga0496112_0063908_1187_2488 | 420 |
| 291 | 3300049574 | Ga0501038_0002371 | Ga0501038_0002371_568_1872 | 420 |
| 292 | 3300005290 | Ga0065712_10007765 | Ga0065712_100077653 | 421 |
| 293 | 3300005337 | Ga0070682_100038766 | Ga0070682_1000387662 | 421 |
| 294 | 3300005445 | Ga0070708_100000091 | Ga0070708_10000009114 | 421 |
| 295 | 3300005548 | Ga0070665_100036053 | Ga0070665_1000360535 | 421 |
| 296 | 3300009101 | Ga0105247_10001245 | Ga0105247_100012453 | 421 |
| 297 | 3300009177 | Ga0105248_10006052 | Ga0105248_100060522 | 421 |
| 298 | 3300009545 | Ga0105237_10153476 | Ga0105237_101534762 | 421 |
| 299 | 3300013104 | Ga0157370_10027101 | Ga0157370_100271013 | 421 |
| 300 | 3300013105 | Ga0157369_10003038 | Ga0157369_1000303810 | 421 |
| 301 | 3300021361 | Ga0213872_10001600 | Ga0213872_100016006 | 421 |
| 302 | 3300025900 | Ga0207710_10002083 | Ga0207710_100020833 | 421 |
| 303 | 3300025908 | Ga0207643_10110189 | Ga0207643_101101891 | 421 |
| 304 | 3300025941 | Ga0207711_10006273 | Ga0207711_100062732 | 421 |
| 305 | 3300028379 | Ga0268266_10025358 | Ga0268266_100253585 | 421 |
| 306 | 3300031241 | Ga0265325_10000457 | Ga0265325_1000045727 | 421 |
| 307 | 3300031548 | Ga0307408_100162349 | Ga0307408_1001623491 | 421 |
| 308 | 3300032004 | Ga0307414_10236942 | Ga0307414_102369422 | 421 |
| 309 | 3300035695 | Ga0373927_0130569 | Ga0373927_0130569_187_1599 | 421 |
| 310 | 3300035725 | Ga0373947_0014764 | Ga0373947_0014764_1018_2430 | 421 |
| 311 | 3300039447 | Ga0436361_0881637 | Ga0436361_0881637_9399_10802 | 421 |
| 312 | 3300044656 | Ga0466969_0022523 | Ga0466969_0022523_1306_2676 | 421 |
| 313 | 3300046472 | Ga0495580_0023592 | Ga0495580_0023592_1405_2817 | 421 |
| 314 | 3300046473 | Ga0495582_0030464 | Ga0495582_0030464_76_1488 | 421 |
| 315 | 3300046499 | Ga0495594_0099485 | Ga0495594_0099485_178_1590 | 421 |
| 316 | 3300046517 | Ga0495630_0052697 | Ga0495630_0052697_404_1816 | 421 |
| 317 | 3300046531 | Ga0495665_0026803 | Ga0495665_0026803_1431_2843 | 421 |
| 318 | 3300047315 | Ga0495581_0012547 | Ga0495581_0012547_1088_2500 | 421 |
| 319 | 3300048915 | Ga0496112_0245131 | Ga0496112_0245131_362_1666 | 421 |
| 320 | 3300049521 | Ga0501298_010840 | Ga0501298_010840_107_1444 | 421 |
| 321 | 3300049661 | Ga0501217_012307 | Ga0501217_012307_428_1765 | 421 |
| 322 | 3300049665 | Ga0501227_019704 | Ga0501227_019704_135_1472 | 421 |
| 323 | 3300049675 | Ga0501243_006991 | Ga0501243_006991_244_1581 | 421 |
| 324 | 3300049686 | Ga0501257_007181 | Ga0501257_007181_410_1747 | 421 |
| 325 | 3300049779 | Ga0501283_001997 | Ga0501283_001997_1154_2458 | 421 |
| 326 | 3300049850 | Ga0501204_004521 | Ga0501204_004521_125_1462 | 421 |
| 327 | 3300050513 | nmdc:mga0rr50_12455_c1 | nmdc:mga0rr50_12455_c1_1646_2977 | 421 |
| 328 | 3300005471 | Ga0070698_100016011 | Ga0070698_1000160113 | 422 |
| 329 | 3300005518 | Ga0070699_100135596 | Ga0070699_1001355962 | 422 |
| 330 | 3300005536 | Ga0070697_100104179 | Ga0070697_1001041792 | 422 |
| 331 | 3300005985 | Ga0081539_10000898 | Ga0081539_1000089819 | 422 |
| 332 | 3300006846 | Ga0075430_100011532 | Ga0075430_1000115324 | 422 |
| 333 | 3300006846 | Ga0075430_100015750 | Ga0075430_1000157504 | 422 |
| 334 | 3300006846 | Ga0075430_100019708 | Ga0075430_1000197084 | 422 |
| 335 | 3300006847 | Ga0075431_100019334 | Ga0075431_1000193343 | 422 |
| 336 | 3300006847 | Ga0075431_100053313 | Ga0075431_1000533132 | 422 |
| 337 | 3300031249 | Ga0265339_10005958 | Ga0265339_100059587 | 422 |
| 338 | 3300042876 | Ga0451577_0020861 | Ga0451577_0020861_2829_4112 | 422 |
| 339 | 3300046525 | Ga0495663_0000834 | Ga0495663_0000834_6780_8237 | 422 |
| 340 | 3300046537 | Ga0495598_0000152 | Ga0495598_0000152_1441_2898 | 422 |
| 341 | 3300046539 | Ga0495621_0000280 | Ga0495621_0000280_9097_10554 | 422 |
| 342 | 3300050509 | nmdc:mga0qj67_104439_c1 | nmdc:mga0qj67_104439_c1_458_1870 | 422 |
| 343 | 3300050509 | nmdc:mga0qj67_14701_c1 | nmdc:mga0qj67_14701_c1_3944_5311 | 422 |
| 344 | 3300050509 | nmdc:mga0qj67_35060_c1 | nmdc:mga0qj67_35060_c1_1201_2568 | 422 |
| 345 | 3300005466 | Ga0070685_10008928 | Ga0070685_100089284 | 423 |
| 346 | 3300006871 | Ga0075434_100087780 | Ga0075434_1000877802 | 423 |
| 347 | 3300009147 | Ga0114129_10114211 | Ga0114129_101142112 | 423 |
| 348 | 3300013100 | Ga0157373_10080386 | Ga0157373_100803862 | 423 |
| 349 | 3300014326 | Ga0157380_10000250 | Ga0157380_100002509 | 423 |
| 350 | 3300021384 | Ga0213876_10000295 | Ga0213876_1000029512 | 423 |
| 351 | 3300025911 | Ga0207654_10082444 | Ga0207654_100824442 | 423 |
| 352 | 3300031995 | Ga0307409_100030746 | Ga0307409_1000307462 | 423 |
| 353 | 3300035695 | Ga0373927_0007658 | Ga0373927_0007658_4337_5668 | 423 |
| 354 | 3300039437 | Ga0436365_1601972 | Ga0436365_1601972_15176_16615 | 423 |
| 355 | 3300050507 | nmdc:mga05p37_135924_c1 | nmdc:mga05p37_135924_c1_1345_2784 | 423 |
| 356 | 3300050508 | nmdc:mga09592_205071_c1 | nmdc:mga09592_205071_c1_120_1559 | 423 |
| 357 | 3300050515 | nmdc:mga0a205_146005_c1 | nmdc:mga0a205_146005_c1_911_2230 | 423 |
| 358 | 3300005546 | Ga0070696_100002421 | Ga0070696_1000024214 | 424 |
| 359 | 3300009093 | Ga0105240_10017556 | Ga0105240_100175562 | 424 |
| 360 | 3300025913 | Ga0207695_10013523 | Ga0207695_100135235 | 424 |
| 361 | 3300031251 | Ga0265327_10076793 | Ga0265327_100767932 | 424 |
| 362 | 3300031344 | Ga0265316_10001737 | Ga0265316_100017371 | 424 |
| 363 | 3300031344 | Ga0265316_10067967 | Ga0265316_100679672 | 424 |
| 364 | 3300031595 | Ga0265313_10018326 | Ga0265313_100183265 | 424 |
| 365 | 3300049568 | Ga0501031_0000122 | Ga0501031_0000122_22944_24284 | 424 |
| 366 | 3300049569 | Ga0501032_0027405 | Ga0501032_0027405_1917_3257 | 424 |
| 367 | 3300049570 | Ga0501033_0022595 | Ga0501033_0022595_1415_2755 | 424 |
| 368 | 3300049574 | Ga0501038_0120263 | Ga0501038_0120263_629_1960 | 424 |
| 369 | 3300049575 | Ga0501039_0058291 | Ga0501039_0058291_1230_2570 | 424 |
| 370 | 3300049580 | Ga0501046_0219975 | Ga0501046_0219975_16_1356 | 424 |
| 371 | 3300049822 | Ga0501035_0008777 | Ga0501035_0008777_7250_8590 | 424 |
| 372 | 3300049823 | Ga0501044_0000430 | Ga0501044_0000430_23363_24703 | 424 |
| 373 | 3300049824 | Ga0501045_0090560 | Ga0501045_0090560_261_1592 | 424 |
| 374 | 3300050511 | nmdc:mga08y16_158978_c1 | nmdc:mga08y16_158978_c1_556_2016 | 424 |
| 375 | 3300005327 | Ga0070658_10082619 | Ga0070658_100826191 | 425 |
| 376 | 3300005536 | Ga0070697_100113280 | Ga0070697_1001132802 | 425 |
| 377 | 3300005548 | Ga0070665_100037131 | Ga0070665_1000371314 | 425 |
| 378 | 3300005719 | Ga0068861_100004364 | Ga0068861_1000043643 | 425 |
| 379 | 3300005719 | Ga0068861_100009333 | Ga0068861_1000093332 | 425 |
| 380 | 3300005841 | Ga0068863_100134993 | Ga0068863_1001349932 | 425 |
| 381 | 3300005844 | Ga0068862_100024013 | Ga0068862_1000240133 | 425 |
| 382 | 3300006846 | Ga0075430_100093201 | Ga0075430_1000932013 | 425 |
| 383 | 3300009174 | Ga0105241_10037066 | Ga0105241_100370662 | 425 |
| 384 | 3300009177 | Ga0105248_10016065 | Ga0105248_100160653 | 425 |
| 385 | 3300013306 | Ga0163162_10066928 | Ga0163162_100669283 | 425 |
| 386 | 3300025909 | Ga0207705_10196097 | Ga0207705_101960971 | 425 |
| 387 | 3300025918 | Ga0207662_10000992 | Ga0207662_100009923 | 425 |
| 388 | 3300025941 | Ga0207711_10054349 | Ga0207711_100543492 | 425 |
| 389 | 3300025961 | Ga0207712_10000737 | Ga0207712_1000073715 | 425 |
| 390 | 3300026118 | Ga0207675_100024358 | Ga0207675_1000243582 | 425 |
| 391 | 3300026118 | Ga0207675_100084477 | Ga0207675_1000844772 | 425 |
| 392 | 3300028379 | Ga0268266_10026792 | Ga0268266_100267922 | 425 |
| 393 | 3300050510 | nmdc:mga06r32_38641_c1 | nmdc:mga06r32_38641_c1_2613_3953 | 425 |
| 394 | 3300005338 | Ga0068868_100127419 | Ga0068868_1001274192 | 426 |
| 395 | 3300005367 | Ga0070667_100200823 | Ga0070667_1002008232 | 426 |
| 396 | 3300005438 | Ga0070701_10000533 | Ga0070701_100005332 | 426 |
| 397 | 3300005459 | Ga0068867_100006105 | Ga0068867_1000061052 | 426 |
| 398 | 3300005518 | Ga0070699_100099321 | Ga0070699_1000993212 | 426 |
| 399 | 3300005546 | Ga0070696_100085918 | Ga0070696_1000859182 | 426 |
| 400 | 3300005548 | Ga0070665_100074853 | Ga0070665_1000748532 | 426 |
| 401 | 3300005564 | Ga0070664_100231305 | Ga0070664_1002313052 | 426 |
| 402 | 3300005844 | Ga0068862_100059699 | Ga0068862_1000596993 | 426 |
| 403 | 3300006038 | Ga0075365_10016339 | Ga0075365_100163393 | 426 |
| 404 | 3300006178 | Ga0075367_10011831 | Ga0075367_100118313 | 426 |
| 405 | 3300006195 | Ga0075366_10000251 | Ga0075366_1000025118 | 426 |
| 406 | 3300006880 | Ga0075429_100194729 | Ga0075429_1001947292 | 426 |
| 407 | 3300006881 | Ga0068865_100050625 | Ga0068865_1000506252 | 426 |
| 408 | 3300007076 | Ga0075435_100052016 | Ga0075435_1000520163 | 426 |
| 409 | 3300009094 | Ga0111539_10000333 | Ga0111539_1000033324 | 426 |
| 410 | 3300009177 | Ga0105248_10056492 | Ga0105248_100564923 | 426 |
| 411 | 3300009553 | Ga0105249_10001505 | Ga0105249_100015059 | 426 |
| 412 | 3300014745 | Ga0157377_10065686 | Ga0157377_100656862 | 426 |
| 413 | 3300025940 | Ga0207691_10065326 | Ga0207691_100653262 | 426 |
| 414 | 3300025961 | Ga0207712_10001491 | Ga0207712_100014917 | 426 |
| 415 | 3300025961 | Ga0207712_10139610 | Ga0207712_101396102 | 426 |
| 416 | 3300026023 | Ga0207677_10043608 | Ga0207677_100436082 | 426 |
| 417 | 3300026089 | Ga0207648_10000296 | Ga0207648_1000029626 | 426 |
| 418 | 3300027907 | Ga0207428_10000665 | Ga0207428_1000066510 | 426 |
| 419 | 3300028379 | Ga0268266_10133048 | Ga0268266_101330481 | 426 |
| 420 | 3300049669 | Ga0501235_004623 | Ga0501235_004623_1536_2909 | 426 |
| 421 | 3300050489 | nmdc:mga03683_17100_c1 | nmdc:mga03683_17100_c1_152_1489 | 426 |
| 422 | 3300050492 | nmdc:mga0yw44_80741_c1 | nmdc:mga0yw44_80741_c1_474_1811 | 426 |
| 423 | 3300050493 | nmdc:mga0k408_1976_c1 | nmdc:mga0k408_1976_c1_4558_5895 | 426 |
| 424 | 3300050513 | nmdc:mga0rr50_38935_c1 | nmdc:mga0rr50_38935_c1_1284_2621 | 426 |
| 425 | 3300013104 | Ga0157370_10129570 | Ga0157370_101295702 | 427 |
| 426 | 3300025942 | Ga0207689_10092824 | Ga0207689_100928243 | 427 |
| 427 | 3300025945 | Ga0207679_10022647 | Ga0207679_100226471 | 427 |
| 428 | 3300031995 | Ga0307409_100020708 | Ga0307409_1000207082 | 427 |
| 429 | 3300005340 | Ga0070689_100011882 | Ga0070689_1000118823 | 428 |
| 430 | 3300025936 | Ga0207670_10006870 | Ga0207670_100068703 | 428 |
| 431 | 3300050507 | nmdc:mga05p37_3031_c1 | nmdc:mga05p37_3031_c1_9936_11516 | 428 |
| 432 | 3300053129 | Ga0500628_000346 | Ga0500628_000346_1385_2782 | 428 |
| 433 | 3300005471 | Ga0070698_100013222 | Ga0070698_1000132225 | 429 |
| 434 | 3300005985 | Ga0081539_10007977 | Ga0081539_100079778 | 429 |
| 435 | 3300006852 | Ga0075433_10146047 | Ga0075433_101460472 | 429 |
| 436 | 3300009147 | Ga0114129_10495538 | Ga0114129_104955381 | 429 |
| 437 | 3300025910 | Ga0207684_10036389 | Ga0207684_100363893 | 429 |
| 438 | 3300031241 | Ga0265325_10011149 | Ga0265325_100111492 | 429 |
| 439 | 3300031731 | Ga0307405_10034757 | Ga0307405_100347571 | 429 |
| 440 | 3300031852 | Ga0307410_10061201 | Ga0307410_100612012 | 429 |
| 441 | 3300031901 | Ga0307406_10092021 | Ga0307406_100920212 | 429 |
| 442 | 3300031901 | Ga0307406_10121851 | Ga0307406_101218512 | 429 |
| 443 | 3300031995 | Ga0307409_100101220 | Ga0307409_1001012202 | 429 |
| 444 | 3300032005 | Ga0307411_10095498 | Ga0307411_100954982 | 429 |
| 445 | 3300050515 | nmdc:mga0a205_47408_c1 | nmdc:mga0a205_47408_c1_1780_3195 | 429 |
| 446 | 3300009147 | Ga0114129_10062700 | Ga0114129_100627002 | 430 |
| 447 | 3300037312 | Ga0395899_0085733 | Ga0395899_0085733_82_1455 | 430 |
| 448 | 3300050507 | nmdc:mga05p37_40739_c2 | nmdc:mga05p37_40739_c2_375_1769 | 430 |
| 449 | 3300005439 | Ga0070711_100000024 | Ga0070711_10000002435 | 431 |
| 450 | 3300006846 | Ga0075430_100006705 | Ga0075430_1000067054 | 431 |
| 451 | 3300007076 | Ga0075435_100099353 | Ga0075435_1000993532 | 431 |
| 452 | 3300009147 | Ga0114129_10046930 | Ga0114129_100469306 | 431 |
| 453 | 3300025916 | Ga0207663_10000012 | Ga0207663_1000001269 | 431 |
| 454 | 3300050507 | nmdc:mga05p37_40613_c1 | nmdc:mga05p37_40613_c1_672_2024 | 431 |
| 455 | 3300005327 | Ga0070658_10099506 | Ga0070658_100995061 | 432 |
| 456 | 3300005336 | Ga0070680_100059074 | Ga0070680_1000590742 | 432 |
| 457 | 3300005339 | Ga0070660_100081044 | Ga0070660_1000810442 | 432 |
| 458 | 3300005340 | Ga0070689_100011051 | Ga0070689_1000110515 | 432 |
| 459 | 3300005343 | Ga0070687_100022676 | Ga0070687_1000226762 | 432 |
| 460 | 3300005354 | Ga0070675_100020546 | Ga0070675_1000205462 | 432 |
| 461 | 3300005438 | Ga0070701_10072572 | Ga0070701_100725721 | 432 |
| 462 | 3300005457 | Ga0070662_100042818 | Ga0070662_1000428182 | 432 |
| 463 | 3300005457 | Ga0070662_100058417 | Ga0070662_1000584172 | 432 |
| 464 | 3300005458 | Ga0070681_10000650 | Ga0070681_100006504 | 432 |
| 465 | 3300005458 | Ga0070681_10075881 | Ga0070681_100758812 | 432 |
| 466 | 3300005471 | Ga0070698_100226695 | Ga0070698_1002266952 | 432 |
| 467 | 3300005530 | Ga0070679_100021013 | Ga0070679_1000210132 | 432 |
| 468 | 3300005535 | Ga0070684_100008305 | Ga0070684_1000083052 | 432 |
| 469 | 3300005543 | Ga0070672_100012675 | Ga0070672_1000126753 | 432 |
| 470 | 3300005577 | Ga0068857_100007858 | Ga0068857_1000078585 | 432 |
| 471 | 3300005616 | Ga0068852_100137429 | Ga0068852_1001374292 | 432 |
| 472 | 3300005844 | Ga0068862_100017780 | Ga0068862_1000177803 | 432 |
| 473 | 3300005983 | Ga0081540_1034260 | Ga0081540_10342602 | 432 |
| 474 | 3300006175 | Ga0070712_100071862 | Ga0070712_1000718622 | 432 |
| 475 | 3300006846 | Ga0075430_100013476 | Ga0075430_1000134762 | 432 |
| 476 | 3300006847 | Ga0075431_100056685 | Ga0075431_1000566852 | 432 |
| 477 | 3300006871 | Ga0075434_100007923 | Ga0075434_1000079234 | 432 |
| 478 | 3300006880 | Ga0075429_100045841 | Ga0075429_1000458412 | 432 |
| 479 | 3300006880 | Ga0075429_100053028 | Ga0075429_1000530282 | 432 |
| 480 | 3300009147 | Ga0114129_10009296 | Ga0114129_100092969 | 432 |
| 481 | 3300009177 | Ga0105248_10126036 | Ga0105248_101260361 | 432 |
| 482 | 3300013102 | Ga0157371_10015567 | Ga0157371_100155673 | 432 |
| 483 | 3300013105 | Ga0157369_10077923 | Ga0157369_100779232 | 432 |
| 484 | 3300013296 | Ga0157374_10100933 | Ga0157374_101009332 | 432 |
| 485 | 3300013307 | Ga0157372_10115014 | Ga0157372_101150142 | 432 |
| 486 | 3300013308 | Ga0157375_10023014 | Ga0157375_100230143 | 432 |
| 487 | 3300025315 | Ga0207697_10002830 | Ga0207697_100028302 | 432 |
| 488 | 3300025912 | Ga0207707_10018498 | Ga0207707_100184985 | 432 |
| 489 | 3300025912 | Ga0207707_10081821 | Ga0207707_100818212 | 432 |
| 490 | 3300025915 | Ga0207693_10042582 | Ga0207693_100425823 | 432 |
| 491 | 3300025917 | Ga0207660_10111099 | Ga0207660_101110991 | 432 |
| 492 | 3300025919 | Ga0207657_10024758 | Ga0207657_100247583 | 432 |
| 493 | 3300025920 | Ga0207649_10035092 | Ga0207649_100350922 | 432 |
| 494 | 3300025931 | Ga0207644_10053911 | Ga0207644_100539112 | 432 |
| 495 | 3300025933 | Ga0207706_10007513 | Ga0207706_100075132 | 432 |
| 496 | 3300025933 | Ga0207706_10048274 | Ga0207706_100482742 | 432 |
| 497 | 3300025940 | Ga0207691_10049983 | Ga0207691_100499832 | 432 |
| 498 | 3300025940 | Ga0207691_10060961 | Ga0207691_100609612 | 432 |
| 499 | 3300025944 | Ga0207661_10051129 | Ga0207661_100511292 | 432 |
| 500 | 3300025945 | Ga0207679_10009018 | Ga0207679_100090183 | 432 |
| 501 | 3300026041 | Ga0207639_10028051 | Ga0207639_100280512 | 432 |
| 502 | 3300026116 | Ga0207674_10010797 | Ga0207674_100107975 | 432 |
| 503 | 3300027907 | Ga0207428_10077553 | Ga0207428_100775532 | 432 |
| 504 | 3300028381 | Ga0268264_10070920 | Ga0268264_100709202 | 432 |
| 505 | 3300046684 | Ga0495669_0033350 | Ga0495669_0033350_350_1750 | 432 |
| 506 | 3300050507 | nmdc:mga05p37_139733_c1 | nmdc:mga05p37_139733_c1_1074_2441 | 432 |
| 507 | 3300050508 | nmdc:mga09592_153791_c1 | nmdc:mga09592_153791_c1_450_1847 | 432 |
| 508 | 3300050508 | nmdc:mga09592_58937_c1 | nmdc:mga09592_58937_c1_750_2117 | 432 |
| 509 | 3300050509 | nmdc:mga0qj67_7100_c1 | nmdc:mga0qj67_7100_c1_678_2045 | 432 |
| 510 | 3300050510 | nmdc:mga06r32_18255_c1 | nmdc:mga06r32_18255_c1_1696_3093 | 432 |
| 511 | 3300050511 | nmdc:mga08y16_304108_c1 | nmdc:mga08y16_304108_c1_51_1448 | 432 |
| 512 | 3300050511 | nmdc:mga08y16_65708_c1 | nmdc:mga08y16_65708_c1_1258_2643 | 432 |
| 513 | 3300050515 | nmdc:mga0a205_132770_c1 | nmdc:mga0a205_132770_c1_473_1840 | 432 |
| 514 | 3300050515 | nmdc:mga0a205_20308_c1 | nmdc:mga0a205_20308_c1_3776_5182 | 432 |
| 515 | 3300005353 | Ga0070669_100002722 | Ga0070669_1000027227 | 433 |
| 516 | 3300005577 | Ga0068857_100052018 | Ga0068857_1000520182 | 433 |
| 517 | 3300005719 | Ga0068861_100006547 | Ga0068861_1000065472 | 433 |
| 518 | 3300005844 | Ga0068862_100000865 | Ga0068862_1000008659 | 433 |
| 519 | 3300009553 | Ga0105249_10000407 | Ga0105249_1000040714 | 433 |
| 520 | 3300013306 | Ga0163162_10049121 | Ga0163162_100491212 | 433 |
| 521 | 3300014326 | Ga0157380_10090955 | Ga0157380_100909552 | 433 |
| 522 | 3300025923 | Ga0207681_10024632 | Ga0207681_100246323 | 433 |
| 523 | 3300025938 | Ga0207704_10124958 | Ga0207704_101249582 | 433 |
| 524 | 3300025940 | Ga0207691_10158067 | Ga0207691_101580672 | 433 |
| 525 | 3300025961 | Ga0207712_10000878 | Ga0207712_100008784 | 433 |
| 526 | 3300026075 | Ga0207708_10026489 | Ga0207708_100264892 | 433 |
| 527 | 3300026116 | Ga0207674_10034076 | Ga0207674_100340764 | 433 |
| 528 | 3300026118 | Ga0207675_100003058 | Ga0207675_1000030582 | 433 |
| 529 | 3300028380 | Ga0268265_10001765 | Ga0268265_100017655 | 433 |
| 530 | 3300032002 | Ga0307416_100099182 | Ga0307416_1000991822 | 433 |
| 531 | 3300032002 | Ga0307416_100100048 | Ga0307416_1001000482 | 433 |
| 532 | 3300005343 | Ga0070687_100033052 | Ga0070687_1000330521 | 434 |
| 533 | 3300005467 | Ga0070706_100001562 | Ga0070706_1000015623 | 434 |
| 534 | 3300025910 | Ga0207684_10057563 | Ga0207684_100575632 | 434 |
| 535 | 3300025918 | Ga0207662_10075226 | Ga0207662_100752262 | 434 |
| 536 | 3300005563 | Ga0068855_100302784 | Ga0068855_1003027842 | 435 |
| 537 | 3300025949 | Ga0207667_10255884 | Ga0207667_102558842 | 435 |
| 538 | 3300005331 | Ga0070670_100151984 | Ga0070670_1001519842 | 436 |
| 539 | 3300005337 | Ga0070682_100148475 | Ga0070682_1001484751 | 436 |
| 540 | 3300005339 | Ga0070660_100038191 | Ga0070660_1000381912 | 436 |
| 541 | 3300005353 | Ga0070669_100000581 | Ga0070669_1000005816 | 436 |
| 542 | 3300005577 | Ga0068857_100023990 | Ga0068857_1000239902 | 436 |
| 543 | 3300005577 | Ga0068857_100071833 | Ga0068857_1000718332 | 436 |
| 544 | 3300005578 | Ga0068854_100033576 | Ga0068854_1000335762 | 436 |
| 545 | 3300009147 | Ga0114129_10459301 | Ga0114129_104593011 | 436 |
| 546 | 3300009174 | Ga0105241_10060016 | Ga0105241_100600162 | 436 |
| 547 | 3300013100 | Ga0157373_10038367 | Ga0157373_100383672 | 436 |
| 548 | 3300025923 | Ga0207681_10004151 | Ga0207681_100041513 | 436 |
| 549 | 3300025925 | Ga0207650_10099355 | Ga0207650_100993551 | 436 |
| 550 | 3300037471 | Ga0395905_0008205 | Ga0395905_0008205_7403_8755 | 436 |
| 551 | 3300050515 | nmdc:mga0a205_51429_c1 | nmdc:mga0a205_51429_c1_1420_2886 | 436 |
| 552 | 3300005289 | Ga0065704_10001544 | Ga0065704_100015443 | 437 |
| 553 | 3300005295 | Ga0065707_10003824 | Ga0065707_100038242 | 437 |
| 554 | 3300005434 | Ga0070709_10000023 | Ga0070709_1000002352 | 437 |
| 555 | 3300005618 | Ga0068864_100089887 | Ga0068864_1000898872 | 437 |
| 556 | 3300006871 | Ga0075434_100103085 | Ga0075434_1001030852 | 437 |
| 557 | 3300006914 | Ga0075436_100022879 | Ga0075436_1000228792 | 437 |
| 558 | 3300006914 | Ga0075436_100068084 | Ga0075436_1000680841 | 437 |
| 559 | 3300009094 | Ga0111539_10012815 | Ga0111539_100128154 | 437 |
| 560 | 3300009176 | Ga0105242_10141489 | Ga0105242_101414892 | 437 |
| 561 | 3300011119 | Ga0105246_10021264 | Ga0105246_100212643 | 437 |
| 562 | 3300014325 | Ga0163163_10091911 | Ga0163163_100919112 | 437 |
| 563 | 3300025906 | Ga0207699_10000008 | Ga0207699_10000008245 | 437 |
| 564 | 3300025935 | Ga0207709_10003673 | Ga0207709_100036733 | 437 |
| 565 | 3300026095 | Ga0207676_10050181 | Ga0207676_100501813 | 437 |
| 566 | 3300027907 | Ga0207428_10003354 | Ga0207428_100033546 | 437 |
| 567 | 3300044673 | Ga0453683_0012241 | Ga0453683_0012241_105_1502 | 437 |
| 568 | 3300049577 | Ga0501041_0032028 | Ga0501041_0032028_97_1539 | 437 |
| 569 | 3300049580 | Ga0501046_0061178 | Ga0501046_0061178_307_1749 | 437 |
| 570 | 3300049591 | Ga0501075_0051560 | Ga0501075_0051560_1564_3006 | 437 |
| 571 | 3300049592 | Ga0501076_0051770 | Ga0501076_0051770_1447_2889 | 437 |
| 572 | 3300049593 | Ga0501077_0053904 | Ga0501077_0053904_731_2173 | 437 |
| 573 | 3300049824 | Ga0501045_0044473 | Ga0501045_0044473_480_1922 | 437 |
| 574 | 3300050511 | nmdc:mga08y16_3897_c1 | nmdc:mga08y16_3897_c1_4973_6379 | 437 |
| 575 | 3300050512 | nmdc:mga0n895_165483_c1 | nmdc:mga0n895_165483_c1_750_2177 | 437 |
| 576 | 3300050514 | nmdc:mga08x19_14576_c1 | nmdc:mga08x19_14576_c1_1660_3069 | 437 |
| 577 | 3300050514 | nmdc:mga08x19_14823_c1 | nmdc:mga08x19_14823_c1_594_2021 | 437 |
| 578 | 3300050515 | nmdc:mga0a205_51041_c2 | nmdc:mga0a205_51041_c2_299_1705 | 437 |
| 579 | 3300003203 | JGI25406J46586_10004308 | JGI25406J46586_100043084 | 438 |
| 580 | 3300005337 | Ga0070682_100000145 | Ga0070682_10000014543 | 438 |
| 581 | 3300005471 | Ga0070698_100004135 | Ga0070698_1000041358 | 438 |
| 582 | 3300005985 | Ga0081539_10000073 | Ga0081539_1000007399 | 438 |
| 583 | 3300005985 | Ga0081539_10054186 | Ga0081539_100541862 | 438 |
| 584 | 3300006163 | Ga0070715_10000002 | Ga0070715_1000000250 | 438 |
| 585 | 3300006914 | Ga0075436_100007044 | Ga0075436_1000070443 | 438 |
| 586 | 3300006914 | Ga0075436_100063125 | Ga0075436_1000631252 | 438 |
| 587 | 3300007076 | Ga0075435_100072136 | Ga0075435_1000721362 | 438 |
| 588 | 3300009147 | Ga0114129_10035088 | Ga0114129_100350884 | 438 |
| 589 | 3300009147 | Ga0114129_10046934 | Ga0114129_100469344 | 438 |
| 590 | 3300009147 | Ga0114129_10069480 | Ga0114129_100694802 | 438 |
| 591 | 3300009148 | Ga0105243_10000349 | Ga0105243_100003494 | 438 |
| 592 | 3300009176 | Ga0105242_10001577 | Ga0105242_1000157710 | 438 |
| 593 | 3300013297 | Ga0157378_10000094 | Ga0157378_1000009450 | 438 |
| 594 | 3300013308 | Ga0157375_10000943 | Ga0157375_100009438 | 438 |
| 595 | 3300014325 | Ga0163163_10076031 | Ga0163163_100760312 | 438 |
| 596 | 3300025905 | Ga0207685_10000030 | Ga0207685_1000003049 | 438 |
| 597 | 3300025934 | Ga0207686_10002076 | Ga0207686_100020764 | 438 |
| 598 | 3300025935 | Ga0207709_10000896 | Ga0207709_1000089611 | 438 |
| 599 | 3300039437 | Ga0436365_1783306 | Ga0436365_1783306_375_1781 | 438 |
| 600 | 3300046522 | Ga0495643_0000069 | Ga0495643_0000069_73138_74550 | 438 |
| 601 | 3300050507 | nmdc:mga05p37_210318_c1 | nmdc:mga05p37_210318_c1_122_1540 | 438 |
| 602 | 3300050507 | nmdc:mga05p37_282476_c1 | nmdc:mga05p37_282476_c1_555_1967 | 438 |
| 603 | 3300050514 | nmdc:mga08x19_7_c1 | nmdc:mga08x19_7_c1_129771_131198 | 438 |
| 604 | 3300005289 | Ga0065704_10108457 | Ga0065704_101084572 | 439 |
| 605 | 3300005293 | Ga0065715_10095431 | Ga0065715_100954312 | 439 |
| 606 | 3300005295 | Ga0065707_10011320 | Ga0065707_100113202 | 439 |
| 607 | 3300005330 | Ga0070690_100004860 | Ga0070690_1000048604 | 439 |
| 608 | 3300005334 | Ga0068869_100081597 | Ga0068869_1000815972 | 439 |
| 609 | 3300005336 | Ga0070680_100002058 | Ga0070680_1000020587 | 439 |
| 610 | 3300005343 | Ga0070687_100006970 | Ga0070687_1000069702 | 439 |
| 611 | 3300005353 | Ga0070669_100008824 | Ga0070669_1000088244 | 439 |
| 612 | 3300005355 | Ga0070671_100024213 | Ga0070671_1000242132 | 439 |
| 613 | 3300005438 | Ga0070701_10083807 | Ga0070701_100838071 | 439 |
| 614 | 3300005441 | Ga0070700_100013610 | Ga0070700_1000136102 | 439 |
| 615 | 3300005444 | Ga0070694_100040127 | Ga0070694_1000401272 | 439 |
| 616 | 3300005445 | Ga0070708_100014111 | Ga0070708_1000141111 | 439 |
| 617 | 3300005445 | Ga0070708_100014189 | Ga0070708_1000141893 | 439 |
| 618 | 3300005457 | Ga0070662_100000088 | Ga0070662_10000008822 | 439 |
| 619 | 3300005457 | Ga0070662_100047570 | Ga0070662_1000475702 | 439 |
| 620 | 3300005458 | Ga0070681_10000048 | Ga0070681_1000004825 | 439 |
| 621 | 3300005467 | Ga0070706_100037799 | Ga0070706_1000377993 | 439 |
| 622 | 3300005468 | Ga0070707_100158595 | Ga0070707_1001585952 | 439 |
| 623 | 3300005471 | Ga0070698_100027818 | Ga0070698_1000278185 | 439 |
| 624 | 3300005518 | Ga0070699_100050066 | Ga0070699_1000500662 | 439 |
| 625 | 3300005530 | Ga0070679_100000079 | Ga0070679_1000000795 | 439 |
| 626 | 3300005536 | Ga0070697_100000366 | Ga0070697_10000036622 | 439 |
| 627 | 3300005536 | Ga0070697_100008900 | Ga0070697_1000089005 | 439 |
| 628 | 3300005536 | Ga0070697_100032897 | Ga0070697_1000328971 | 439 |
| 629 | 3300005536 | Ga0070697_100086956 | Ga0070697_1000869562 | 439 |
| 630 | 3300005536 | Ga0070697_100146986 | Ga0070697_1001469862 | 439 |
| 631 | 3300005544 | Ga0070686_100007820 | Ga0070686_1000078202 | 439 |
| 632 | 3300005547 | Ga0070693_100032371 | Ga0070693_1000323712 | 439 |
| 633 | 3300005549 | Ga0070704_100026646 | Ga0070704_1000266461 | 439 |
| 634 | 3300005577 | Ga0068857_100059506 | Ga0068857_1000595062 | 439 |
| 635 | 3300005578 | Ga0068854_100096313 | Ga0068854_1000963131 | 439 |
| 636 | 3300005614 | Ga0068856_100006040 | Ga0068856_1000060406 | 439 |
| 637 | 3300005617 | Ga0068859_100167063 | Ga0068859_1001670632 | 439 |
| 638 | 3300005719 | Ga0068861_100014416 | Ga0068861_1000144162 | 439 |
| 639 | 3300005843 | Ga0068860_100025860 | Ga0068860_1000258602 | 439 |
| 640 | 3300005844 | Ga0068862_100013332 | Ga0068862_1000133322 | 439 |
| 641 | 3300005844 | Ga0068862_100048770 | Ga0068862_1000487702 | 439 |
| 642 | 3300006173 | Ga0070716_100000010 | Ga0070716_10000001098 | 439 |
| 643 | 3300006358 | Ga0068871_100144608 | Ga0068871_1001446081 | 439 |
| 644 | 3300006852 | Ga0075433_10011742 | Ga0075433_100117424 | 439 |
| 645 | 3300006881 | Ga0068865_100025715 | Ga0068865_1000257152 | 439 |
| 646 | 3300006914 | Ga0075436_100000006 | Ga0075436_100000006211 | 439 |
| 647 | 3300006931 | Ga0097620_100167063 | Ga0097620_1001670632 | 439 |
| 648 | 3300007076 | Ga0075435_100002065 | Ga0075435_1000020657 | 439 |
| 649 | 3300009094 | Ga0111539_10005719 | Ga0111539_100057192 | 439 |
| 650 | 3300009147 | Ga0114129_10102962 | Ga0114129_101029623 | 439 |
| 651 | 3300009147 | Ga0114129_10107181 | Ga0114129_101071811 | 439 |
| 652 | 3300009553 | Ga0105249_10043675 | Ga0105249_100436751 | 439 |
| 653 | 3300009553 | Ga0105249_10099497 | Ga0105249_100994972 | 439 |
| 654 | 3300010375 | Ga0105239_10013822 | Ga0105239_100138222 | 439 |
| 655 | 3300011119 | Ga0105246_10087284 | Ga0105246_100872842 | 439 |
| 656 | 3300013297 | Ga0157378_10008075 | Ga0157378_100080752 | 439 |
| 657 | 3300013306 | Ga0163162_10252759 | Ga0163162_102527592 | 439 |
| 658 | 3300013307 | Ga0157372_10027079 | Ga0157372_100270793 | 439 |
| 659 | 3300013308 | Ga0157375_10053440 | Ga0157375_100534402 | 439 |
| 660 | 3300014325 | Ga0163163_10000696 | Ga0163163_1000069610 | 439 |
| 661 | 3300014325 | Ga0163163_10168698 | Ga0163163_101686983 | 439 |
| 662 | 3300014326 | Ga0157380_10006205 | Ga0157380_100062054 | 439 |
| 663 | 3300014968 | Ga0157379_10019834 | Ga0157379_100198343 | 439 |
| 664 | 3300025910 | Ga0207684_10016018 | Ga0207684_100160183 | 439 |
| 665 | 3300025912 | Ga0207707_10000015 | Ga0207707_1000001548 | 439 |
| 666 | 3300025917 | Ga0207660_10068881 | Ga0207660_100688812 | 439 |
| 667 | 3300025918 | Ga0207662_10001313 | Ga0207662_100013133 | 439 |
| 668 | 3300025921 | Ga0207652_10002603 | Ga0207652_100026034 | 439 |
| 669 | 3300025922 | Ga0207646_10133037 | Ga0207646_101330372 | 439 |
| 670 | 3300025923 | Ga0207681_10025857 | Ga0207681_100258573 | 439 |
| 671 | 3300025931 | Ga0207644_10016062 | Ga0207644_100160623 | 439 |
| 672 | 3300025933 | Ga0207706_10000527 | Ga0207706_1000052715 | 439 |
| 673 | 3300025933 | Ga0207706_10216389 | Ga0207706_102163891 | 439 |
| 674 | 3300025935 | Ga0207709_10180753 | Ga0207709_101807531 | 439 |
| 675 | 3300025939 | Ga0207665_10000010 | Ga0207665_1000001095 | 439 |
| 676 | 3300025942 | Ga0207689_10010447 | Ga0207689_100104472 | 439 |
| 677 | 3300025942 | Ga0207689_10010745 | Ga0207689_100107455 | 439 |
| 678 | 3300025961 | Ga0207712_10017399 | Ga0207712_100173991 | 439 |
| 679 | 3300026075 | Ga0207708_10024183 | Ga0207708_100241832 | 439 |
| 680 | 3300026078 | Ga0207702_10043753 | Ga0207702_100437531 | 439 |
| 681 | 3300026089 | Ga0207648_10173314 | Ga0207648_101733141 | 439 |
| 682 | 3300026116 | Ga0207674_10065914 | Ga0207674_100659142 | 439 |
| 683 | 3300026116 | Ga0207674_10098551 | Ga0207674_100985512 | 439 |
| 684 | 3300026118 | Ga0207675_100001216 | Ga0207675_10000121613 | 439 |
| 685 | 3300027907 | Ga0207428_10045502 | Ga0207428_100455021 | 439 |
| 686 | 3300028380 | Ga0268265_10089173 | Ga0268265_100891732 | 439 |
| 687 | 3300028381 | Ga0268264_10053326 | Ga0268264_100533262 | 439 |
| 688 | 3300028381 | Ga0268264_10070007 | Ga0268264_100700073 | 439 |
| 689 | 3300031548 | Ga0307408_100204466 | Ga0307408_1002044661 | 439 |
| 690 | 3300036401 | Ga0373937_0050393 | Ga0373937_0050393_450_1847 | 439 |
| 691 | 3300048905 | Ga0496102_0070132 | Ga0496102_0070132_1023_2420 | 439 |
| 692 | 3300048916 | Ga0496113_0194176 | Ga0496113_0194176_163_1560 | 439 |
| 693 | 3300050513 | nmdc:mga0rr50_697_c1 | nmdc:mga0rr50_697_c1_9666_11096 | 439 |
| 694 | 3300050514 | nmdc:mga08x19_13_c1 | nmdc:mga08x19_13_c1_268440_269870 | 439 |
| 695 | 3300005434 | Ga0070709_10014270 | Ga0070709_100142702 | 440 |
| 696 | 3300005435 | Ga0070714_100027183 | Ga0070714_1000271832 | 440 |
| 697 | 3300005435 | Ga0070714_100083861 | Ga0070714_1000838612 | 440 |
| 698 | 3300005436 | Ga0070713_100002665 | Ga0070713_10000266511 | 440 |
| 699 | 3300005458 | Ga0070681_10003381 | Ga0070681_100033815 | 440 |
| 700 | 3300005530 | Ga0070679_100015360 | Ga0070679_1000153602 | 440 |
| 701 | 3300005547 | Ga0070693_100004171 | Ga0070693_1000041712 | 440 |
| 702 | 3300006028 | Ga0070717_10004414 | Ga0070717_100044142 | 440 |
| 703 | 3300006844 | Ga0075428_100011220 | Ga0075428_1000112204 | 440 |
| 704 | 3300025915 | Ga0207693_10040532 | Ga0207693_100405322 | 440 |
| 705 | 3300025928 | Ga0207700_10001659 | Ga0207700_100016597 | 440 |
| 706 | 3300025929 | Ga0207664_10196822 | Ga0207664_101968221 | 440 |
| 707 | 3300035083 | Ga0373926_0001478 | Ga0373926_0001478_3311_4687 | 440 |
| 708 | 3300035089 | Ga0373944_0012820 | Ga0373944_0012820_307_1683 | 440 |
| 709 | 3300035116 | Ga0373945_0019222 | Ga0373945_0019222_149_1525 | 440 |
| 710 | 3300035170 | Ga0373943_0002406 | Ga0373943_0002406_202_1578 | 440 |
| 711 | 3300035171 | Ga0373946_0009803 | Ga0373946_0009803_869_2245 | 440 |
| 712 | 3300035692 | Ga0373935_0020467 | Ga0373935_0020467_1900_3276 | 440 |
| 713 | 3300035695 | Ga0373927_0009011 | Ga0373927_0009011_3173_4549 | 440 |
| 714 | 3300035725 | Ga0373947_0013582 | Ga0373947_0013582_644_2020 | 440 |
| 715 | 3300037068 | Ga0373925_0013499 | Ga0373925_0013499_2646_4022 | 440 |
| 716 | 3300046459 | Ga0495629_0015341 | Ga0495629_0015341_951_2336 | 440 |
| 717 | 3300046472 | Ga0495580_0025509 | Ga0495580_0025509_1062_2438 | 440 |
| 718 | 3300046475 | Ga0495639_0000589 | Ga0495639_0000589_772_2148 | 440 |
| 719 | 3300046517 | Ga0495630_0001355 | Ga0495630_0001355_4305_5681 | 440 |
| 720 | 3300046531 | Ga0495665_0002050 | Ga0495665_0002050_8764_10140 | 440 |
| 721 | 3300046674 | Ga0495588_0002108 | Ga0495588_0002108_5959_7335 | 440 |
| 722 | 3300046683 | Ga0495658_0001117 | Ga0495658_0001117_7758_9134 | 440 |
| 723 | 3300046689 | Ga0495613_0010333 | Ga0495613_0010333_3844_5220 | 440 |
| 724 | 3300047315 | Ga0495581_0000780 | Ga0495581_0000780_9144_10520 | 440 |
| 725 | 3300047673 | Ga0495593_0000587 | Ga0495593_0000587_8538_9914 | 440 |
| 726 | 3300048089 | Ga0495614_0000014 | Ga0495614_0000014_34369_35745 | 440 |
| 727 | 3300009551 | Ga0105238_10000193 | Ga0105238_1000019315 | 441 |
| 728 | 3300025924 | Ga0207694_10000150 | Ga0207694_1000015015 | 441 |
| 729 | 3300037471 | Ga0395905_0060560 | Ga0395905_0060560_1715_3151 | 441 |
| 730 | 3300037471 | Ga0395905_0223554 | Ga0395905_0223554_289_1728 | 441 |
| 731 | 3300044693 | Ga0466961_0008116 | Ga0466961_0008116_5206_6624 | 441 |
| 732 | 3300000549 | LJQas_1000004 | LJQas_100000417 | 442 |
| 733 | 3300009093 | Ga0105240_10000186 | Ga0105240_1000018612 | 442 |
| 734 | 3300021384 | Ga0213876_10000031 | Ga0213876_10000031119 | 442 |
| 735 | 3300025913 | Ga0207695_10000281 | Ga0207695_1000028176 | 442 |
| 736 | 3300025918 | Ga0207662_10005114 | Ga0207662_100051142 | 442 |
| 737 | 3300031456 | Ga0307513_10004115 | Ga0307513_100041157 | 442 |
| 738 | 3300038443 | Ga0395901_0022256 | Ga0395901_0022256_2611_3990 | 442 |
| 739 | 3300039437 | Ga0436365_0882969 | Ga0436365_0882969_159092_160510 | 442 |
| 740 | 3300053102 | Ga0500554_025611 | Ga0500554_025611_122_1519 | 442 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8293 | 2 | 413 |
| 6kkl-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) | 0.8231 | 2 | 413 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8005 | 2 | 413 |
| 6kkk-assembly3.cif.gz_C | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation (h115a mutant) | 0.7948 | 2 | 412 |
| 6kkl-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) | 0.7862 | 2 | 413 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZPP5_275_405_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9188 | 231 | 350 | 1.20.1250.20 |
| af_F1R4M7_275_416_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9036 | 226 | 350 | 1.20.1250.20 |
| af_E7EYD2_580_800_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8945 | 226 | 419 | 1.20.1250.20 |
| af_Q7KWK4_204_629_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8935 | 2 | 411 | 1.20.1250.20 |
| af_Q6YK44_74_579_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8881 | 11 | 414 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2DTF3-F1-model_v4 | MFS transporter | 0.9911 | 1 | 395 |
GO:0016020
GO:0022857 |
| AF-A0A3M1SK15-F1-model_v4 | MFS transporter | 0.9821 | 1 | 304 |
GO:0016020
GO:0022857 |
| AF-A0A7Y2DTF3-F1-model_v4 | MFS transporter | 0.9812 | 1 | 395 |
GO:0016020
GO:0022857 |
| AF-A0A2V7VBQ4-F1-model_v4 | MFS transporter | 0.9809 | 213 | 416 |
GO:0016020
|
| AF-A0A350YX58-F1-model_v4 | MFS transporter | 0.9803 | 229 | 416 |
GO:0016020
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar