F478366
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 737 | 386 | 736 | 203 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221547|2643754966 |
| Length | 238 |
| Sequence | QNLKATVRPKAGKGASRAARFSGRVPGVVYGDNQSPLLVLLDHDELKQRIYAGRFTTTLYELDVDGKKHRVIPRDFQLDAIKDLPMHVDFLRVPEGATIRVKVAVHVLNGETAPGVKRGGAVNIVTHTINLECPADRIPRSIDVDIGDLDINHSKHLSDVKLPEGVRVLAQGDITLVTVVPPSGYAEELKQQAAAAASAAAAAAAPAAAAPATGGTAAPGAAPAAGAAPAAGAAPAKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 95 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 96 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 196 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 200 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 202 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 247 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 248 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 249 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 359 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 376 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 377 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 378 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.8 |
| Nodule | 0 |
| Rhizoplane | 5.29 |
| Rhizosphere | 89.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10001065 | 3300002077 | Bacteria | 5305 |
| 2 | JGI24034J26672_10011273 | 3300002239 | Bacteria | 1337 |
| 3 | Ga0070658_10045516 | 3300005327 | Bacteria | 3548 |
| 4 | Ga0070658_10294924 | 3300005327 | Bacteria | 1382 |
| 5 | Ga0070676_10110307 | 3300005328 | Bacteria | 1712 |
| 6 | Ga0070683_100071308 | 3300005329 | Bacteria | 3242 |
| 7 | Ga0070683_100281939 | 3300005329 | Bacteria | 1580 |
| 8 | Ga0070690_100010169 | 3300005330 | Bacteria | 5466 |
| 9 | Ga0070690_100046888 | 3300005330 | Bacteria | 2748 |
| 10 | Ga0070670_100003926 | 3300005331 | Bacteria | 12402 |
| 11 | Ga0070677_10001233 | 3300005333 | Bacteria | 8211 |
| 12 | Ga0070666_10013033 | 3300005335 | Bacteria | 5264 |
| 13 | Ga0070680_100025931 | 3300005336 | Bacteria | 4687 |
| 14 | Ga0070680_100075581 | 3300005336 | Bacteria | 2773 |
| 15 | Ga0070680_100320522 | 3300005336 | Bacteria | 1316 |
| 16 | Ga0070682_100031300 | 3300005337 | Bacteria | 3217 |
| 17 | Ga0070682_100211783 | 3300005337 | Bacteria | 1374 |
| 18 | Ga0068868_100043832 | 3300005338 | Bacteria | 3495 |
| 19 | Ga0070660_100021115 | 3300005339 | Bacteria | 4797 |
| 20 | Ga0070687_100014500 | 3300005343 | Bacteria | 3540 |
| 21 | Ga0070661_100027394 | 3300005344 | Bacteria | 4103 |
| 22 | Ga0070661_100135390 | 3300005344 | Bacteria | 1853 |
| 23 | Ga0070692_10286820 | 3300005345 | Bacteria | 1000 |
| 24 | Ga0070675_100149359 | 3300005354 | Bacteria | 2002 |
| 25 | Ga0070671_100067499 | 3300005355 | Bacteria | 2982 |
| 26 | Ga0070674_100058922 | 3300005356 | Bacteria | 2671 |
| 27 | Ga0070673_100022646 | 3300005364 | Bacteria | 4576 |
| 28 | Ga0070673_100368996 | 3300005364 | Bacteria | 1278 |
| 29 | Ga0070688_100015921 | 3300005365 | Bacteria | 4288 |
| 30 | Ga0070659_100065802 | 3300005366 | Bacteria | 2871 |
| 31 | Ga0070659_100078059 | 3300005366 | Bacteria | 2642 |
| 32 | Ga0070667_100049507 | 3300005367 | Bacteria | 3539 |
| 33 | Ga0070667_100066283 | 3300005367 | Bacteria | 3067 |
| 34 | Ga0070667_100143734 | 3300005367 | Bacteria | 2091 |
| 35 | Ga0070709_10036741 | 3300005434 | Bacteria | 2987 |
| 36 | Ga0070709_10039706 | 3300005434 | Bacteria | 2889 |
| 37 | Ga0070709_10089638 | 3300005434 | Bacteria | 2025 |
| 38 | Ga0070714_100038357 | 3300005435 | Bacteria | 4028 |
| 39 | Ga0070714_100105676 | 3300005435 | Bacteria | 2486 |
| 40 | Ga0070713_100233617 | 3300005436 | Bacteria | 1672 |
| 41 | Ga0070713_100427347 | 3300005436 | Bacteria | 1241 |
| 42 | Ga0070710_10127166 | 3300005437 | Bacteria | 1549 |
| 43 | Ga0070710_10180439 | 3300005437 | Bacteria | 1321 |
| 44 | Ga0070711_100285363 | 3300005439 | Bacteria | 1308 |
| 45 | Ga0070705_100235401 | 3300005440 | Bacteria | 1276 |
| 46 | Ga0070705_100409269 | 3300005440 | Bacteria | 1007 |
| 47 | Ga0070700_100049650 | 3300005441 | Bacteria | 2606 |
| 48 | Ga0070663_100016023 | 3300005455 | Bacteria | 4854 |
| 49 | Ga0070663_100147422 | 3300005455 | Bacteria | 1801 |
| 50 | Ga0070678_100041566 | 3300005456 | Bacteria | 3260 |
| 51 | Ga0070681_10048764 | 3300005458 | Bacteria | 4231 |
| 52 | Ga0070681_10113759 | 3300005458 | Bacteria | 2645 |
| 53 | Ga0070681_10219210 | 3300005458 | Bacteria | 1818 |
| 54 | Ga0070681_10221895 | 3300005458 | Bacteria | 1805 |
| 55 | Ga0070681_10363512 | 3300005458 | Bacteria | 1357 |
| 56 | Ga0070681_10590887 | 3300005458 | Bacteria | 1024 |
| 57 | Ga0068867_100100804 | 3300005459 | Bacteria | 2205 |
| 58 | Ga0068867_100119241 | 3300005459 | Bacteria | 2037 |
| 59 | Ga0070685_10039316 | 3300005466 | Bacteria | 2686 |
| 60 | Ga0070698_100313360 | 3300005471 | Bacteria | 1500 |
| 61 | Ga0070679_100045107 | 3300005530 | Bacteria | 4392 |
| 62 | Ga0070679_100074695 | 3300005530 | Bacteria | 3380 |
| 63 | Ga0070679_100098270 | 3300005530 | Bacteria | 2915 |
| 64 | Ga0070679_100123213 | 3300005530 | Bacteria | 2576 |
| 65 | Ga0070697_100195748 | 3300005536 | Bacteria | 1717 |
| 66 | Ga0070672_100107008 | 3300005543 | Bacteria | 2276 |
| 67 | Ga0070686_100121230 | 3300005544 | Bacteria | 1796 |
| 68 | Ga0070693_100132926 | 3300005547 | Bacteria | 1558 |
| 69 | Ga0070693_100264491 | 3300005547 | Bacteria | 1145 |
| 70 | Ga0070704_100543810 | 3300005549 | Bacteria | 1014 |
| 71 | Ga0068855_100077098 | 3300005563 | Bacteria | 3867 |
| 72 | Ga0068855_100095501 | 3300005563 | Bacteria | 3426 |
| 73 | Ga0070664_100057416 | 3300005564 | Bacteria | 3309 |
| 74 | Ga0070664_100158450 | 3300005564 | Bacteria | 2001 |
| 75 | Ga0068857_100002095 | 3300005577 | Bacteria | 16205 |
| 76 | Ga0068857_100137309 | 3300005577 | Bacteria | 2208 |
| 77 | Ga0068856_100046052 | 3300005614 | Bacteria | 4296 |
| 78 | Ga0068856_100046477 | 3300005614 | Bacteria | 4275 |
| 79 | Ga0070702_100080387 | 3300005615 | Bacteria | 1950 |
| 80 | Ga0068852_100106647 | 3300005616 | Bacteria | 2540 |
| 81 | Ga0068859_100524464 | 3300005617 | Bacteria | 1279 |
| 82 | Ga0068864_100001534 | 3300005618 | Bacteria | 19014 |
| 83 | Ga0068864_100160002 | 3300005618 | Bacteria | 2046 |
| 84 | Ga0068866_10002030 | 3300005718 | Bacteria | 8431 |
| 85 | Ga0068866_10018406 | 3300005718 | Bacteria | 3159 |
| 86 | Ga0068851_10089551 | 3300005834 | Bacteria | 1618 |
| 87 | Ga0068870_10013282 | 3300005840 | Bacteria | 3868 |
| 88 | Ga0068863_100135924 | 3300005841 | Bacteria | 2349 |
| 89 | Ga0068858_100221902 | 3300005842 | Bacteria | 1790 |
| 90 | Ga0068860_100348153 | 3300005843 | Bacteria | 1458 |
| 91 | Ga0068860_100622998 | 3300005843 | Bacteria | 1085 |
| 92 | Ga0068862_100004584 | 3300005844 | Bacteria | 11654 |
| 93 | Ga0081455_10008649 | 3300005937 | Bacteria | 10552 |
| 94 | Ga0081455_10024396 | 3300005937 | Bacteria | 5601 |
| 95 | Ga0070717_10002945 | 3300006028 | Bacteria | 12093 |
| 96 | Ga0070717_10041442 | 3300006028 | Bacteria | 3754 |
| 97 | Ga0070717_10235308 | 3300006028 | Bacteria | 1614 |
| 98 | Ga0075432_10004302 | 3300006058 | Bacteria | 4849 |
| 99 | Ga0075432_10027156 | 3300006058 | Bacteria | 1970 |
| 100 | Ga0070716_100047671 | 3300006173 | Bacteria | 2418 |
| 101 | Ga0070716_100075159 | 3300006173 | Bacteria | 1999 |
| 102 | Ga0070712_100320766 | 3300006175 | Bacteria | 1260 |
| 103 | Ga0075362_10102872 | 3300006177 | Bacteria | 1337 |
| 104 | Ga0075367_10065237 | 3300006178 | Bacteria | 2180 |
| 105 | Ga0075367_10079858 | 3300006178 | Bacteria | 1977 |
| 106 | Ga0075367_10206671 | 3300006178 | Bacteria | 1227 |
| 107 | Ga0075369_10012816 | 3300006186 | Bacteria | 3315 |
| 108 | Ga0075427_10000953 | 3300006194 | Bacteria | 3570 |
| 109 | Ga0097621_100013993 | 3300006237 | Bacteria | 5993 |
| 110 | Ga0097621_100015096 | 3300006237 | Bacteria | 5800 |
| 111 | Ga0075370_10037259 | 3300006353 | Bacteria | 2734 |
| 112 | Ga0075370_10194263 | 3300006353 | Bacteria | 1196 |
| 113 | Ga0075370_10262368 | 3300006353 | Bacteria | 1025 |
| 114 | Ga0068871_100018875 | 3300006358 | Bacteria | 5254 |
| 115 | Ga0068871_100056437 | 3300006358 | Bacteria | 3192 |
| 116 | Ga0075428_100004320 | 3300006844 | Bacteria | 15659 |
| 117 | Ga0075430_100000275 | 3300006846 | Bacteria | 36030 |
| 118 | Ga0075430_100000426 | 3300006846 | Bacteria | 31396 |
| 119 | Ga0075431_100020560 | 3300006847 | Bacteria | 6745 |
| 120 | Ga0075433_10000029 | 3300006852 | Bacteria | 55893 |
| 121 | Ga0075433_10549952 | 3300006852 | Bacteria | 1015 |
| 122 | Ga0075434_100000208 | 3300006871 | Bacteria | 39868 |
| 123 | Ga0075434_100001333 | 3300006871 | Bacteria | 20677 |
| 124 | Ga0075434_100286635 | 3300006871 | Bacteria | 1667 |
| 125 | Ga0075429_100000734 | 3300006880 | Bacteria | 25672 |
| 126 | Ga0068865_100099074 | 3300006881 | Bacteria | 2130 |
| 127 | Ga0068865_100281288 | 3300006881 | Bacteria | 1325 |
| 128 | Ga0075436_100029960 | 3300006914 | Bacteria | 3743 |
| 129 | Ga0075436_100188824 | 3300006914 | Bacteria | 1458 |
| 130 | Ga0075436_100315984 | 3300006914 | Bacteria | 1122 |
| 131 | Ga0097620_100524507 | 3300006931 | Bacteria | 1279 |
| 132 | Ga0075435_100046941 | 3300007076 | Bacteria | 3466 |
| 133 | Ga0075435_100095474 | 3300007076 | Bacteria | 2459 |
| 134 | Ga0105251_10005445 | 3300009011 | Bacteria | 8312 |
| 135 | Ga0105240_10069867 | 3300009093 | Bacteria | 4346 |
| 136 | Ga0105240_10109147 | 3300009093 | Bacteria | 3352 |
| 137 | Ga0105240_10853712 | 3300009093 | Bacteria | 982 |
| 138 | Ga0111539_10000345 | 3300009094 | Bacteria | 57093 |
| 139 | Ga0111539_10108778 | 3300009094 | Bacteria | 3253 |
| 140 | Ga0111539_10261937 | 3300009094 | Bacteria | 2013 |
| 141 | Ga0105247_10029287 | 3300009101 | Bacteria | 3336 |
| 142 | Ga0105247_10288663 | 3300009101 | Bacteria | 1134 |
| 143 | Ga0114129_10003572 | 3300009147 | Bacteria | 21879 |
| 144 | Ga0105243_10116370 | 3300009148 | Bacteria | 2246 |
| 145 | Ga0105243_10156681 | 3300009148 | Bacteria | 1959 |
| 146 | Ga0105243_10242456 | 3300009148 | Bacteria | 1605 |
| 147 | Ga0105241_10012966 | 3300009174 | Bacteria | 6113 |
| 148 | Ga0105242_10109212 | 3300009176 | Bacteria | 2355 |
| 149 | Ga0105242_10181924 | 3300009176 | Bacteria | 1855 |
| 150 | Ga0105242_10206864 | 3300009176 | Bacteria | 1746 |
| 151 | Ga0105237_10034469 | 3300009545 | Bacteria | 5125 |
| 152 | Ga0105237_10067254 | 3300009545 | Bacteria | 3577 |
| 153 | Ga0105237_10100286 | 3300009545 | Bacteria | 2887 |
| 154 | Ga0105238_10025119 | 3300009551 | Bacteria | 6072 |
| 155 | Ga0105238_10028682 | 3300009551 | Bacteria | 5670 |
| 156 | Ga0105238_10136040 | 3300009551 | Bacteria | 2435 |
| 157 | Ga0105238_10475692 | 3300009551 | Bacteria | 1248 |
| 158 | Ga0105249_10119394 | 3300009553 | Bacteria | 2504 |
| 159 | Ga0105239_10109546 | 3300010375 | Bacteria | 3060 |
| 160 | Ga0105246_10112198 | 3300011119 | Bacteria | 2005 |
| 161 | Ga0157340_1001339 | 3300012473 | Bacteria | 1116 |
| 162 | Ga0157339_1003319 | 3300012505 | Bacteria | 1154 |
| 163 | Ga0157316_1006246 | 3300012510 | Bacteria | 971 |
| 164 | Ga0157373_10164715 | 3300013100 | Bacteria | 1560 |
| 165 | Ga0157371_10238339 | 3300013102 | Bacteria | 1308 |
| 166 | Ga0157370_10056299 | 3300013104 | Bacteria | 3742 |
| 167 | Ga0157370_10058433 | 3300013104 | Bacteria | 3666 |
| 168 | Ga0157370_10202959 | 3300013104 | Bacteria | 1839 |
| 169 | Ga0157369_10834923 | 3300013105 | Bacteria | 946 |
| 170 | Ga0157369_11094281 | 3300013105 | Bacteria | 815 |
| 171 | Ga0157374_10272671 | 3300013296 | Bacteria | 1669 |
| 172 | Ga0157378_10069624 | 3300013297 | Bacteria | 3157 |
| 173 | Ga0163162_11221534 | 3300013306 | Bacteria | 853 |
| 174 | Ga0163163_10001710 | 3300014325 | Bacteria | 18534 |
| 175 | Ga0157380_10065474 | 3300014326 | Bacteria | 2921 |
| 176 | Ga0182008_10096947 | 3300014497 | Bacteria | 1455 |
| 177 | Ga0157377_10003804 | 3300014745 | Bacteria | 6857 |
| 178 | Ga0157379_10190381 | 3300014968 | Bacteria | 1854 |
| 179 | Ga0157379_10380040 | 3300014968 | Bacteria | 1296 |
| 180 | Ga0157376_10008671 | 3300014969 | Bacteria | 7351 |
| 181 | Ga0157376_10037869 | 3300014969 | Bacteria | 3920 |
| 182 | Ga0157376_10214471 | 3300014969 | Bacteria | 1779 |
| 183 | Ga0163161_10001476 | 3300017792 | Bacteria | 17368 |
| 184 | Ga0163161_10065350 | 3300017792 | Bacteria | 2655 |
| 185 | Ga0213876_10047692 | 3300021384 | Bacteria | 2264 |
| 186 | Ga0224572_1001585 | 3300024225 | Bacteria | 3417 |
| 187 | Ga0228598_1014536 | 3300024227 | Bacteria | 1557 |
| 188 | Ga0207673_1000232 | 3300025290 | Bacteria | 5664 |
| 189 | Ga0207697_10002797 | 3300025315 | Bacteria | 8890 |
| 190 | Ga0207653_10014160 | 3300025885 | Bacteria | 2501 |
| 191 | Ga0207682_10000056 | 3300025893 | Bacteria | 48265 |
| 192 | Ga0207692_10011767 | 3300025898 | Bacteria | 3737 |
| 193 | Ga0207692_10032532 | 3300025898 | Bacteria | 2507 |
| 194 | Ga0207692_10103770 | 3300025898 | Bacteria | 1566 |
| 195 | Ga0207692_10193538 | 3300025898 | Bacteria | 1191 |
| 196 | Ga0207710_10001206 | 3300025900 | Bacteria | 13122 |
| 197 | Ga0207710_10062498 | 3300025900 | Bacteria | 1692 |
| 198 | Ga0207680_10006395 | 3300025903 | Bacteria | 5695 |
| 199 | Ga0207647_10011486 | 3300025904 | Bacteria | 6209 |
| 200 | Ga0207685_10052223 | 3300025905 | Bacteria | 1583 |
| 201 | Ga0207699_10016764 | 3300025906 | Bacteria | 3840 |
| 202 | Ga0207699_10047203 | 3300025906 | Bacteria | 2524 |
| 203 | Ga0207699_10187115 | 3300025906 | Bacteria | 1395 |
| 204 | Ga0207645_10000249 | 3300025907 | Bacteria | 44921 |
| 205 | Ga0207645_10076117 | 3300025907 | Bacteria | 2149 |
| 206 | Ga0207643_10000187 | 3300025908 | Bacteria | 42567 |
| 207 | Ga0207705_10322986 | 3300025909 | Bacteria | 1186 |
| 208 | Ga0207705_10340141 | 3300025909 | Bacteria | 1155 |
| 209 | Ga0207705_10468241 | 3300025909 | Bacteria | 978 |
| 210 | Ga0207654_10141539 | 3300025911 | Bacteria | 1535 |
| 211 | Ga0207654_10239987 | 3300025911 | Bacteria | 1211 |
| 212 | Ga0207707_10035389 | 3300025912 | Bacteria | 4367 |
| 213 | Ga0207707_10038851 | 3300025912 | Bacteria | 4160 |
| 214 | Ga0207695_10169713 | 3300025913 | Bacteria | 2108 |
| 215 | Ga0207695_10354509 | 3300025913 | Bacteria | 1354 |
| 216 | Ga0207695_10571334 | 3300025913 | Bacteria | 1012 |
| 217 | Ga0207671_10199873 | 3300025914 | Bacteria | 1561 |
| 218 | Ga0207671_10381922 | 3300025914 | Bacteria | 1119 |
| 219 | Ga0207693_10004402 | 3300025915 | Bacteria | 11913 |
| 220 | Ga0207693_10027666 | 3300025915 | Bacteria | 4482 |
| 221 | Ga0207693_10308346 | 3300025915 | Bacteria | 1239 |
| 222 | Ga0207663_10007931 | 3300025916 | Bacteria | 5539 |
| 223 | Ga0207663_10046657 | 3300025916 | Bacteria | 2670 |
| 224 | Ga0207660_10007537 | 3300025917 | Bacteria | 7045 |
| 225 | Ga0207660_10009967 | 3300025917 | Bacteria | 6155 |
| 226 | Ga0207662_10082578 | 3300025918 | Bacteria | 1963 |
| 227 | Ga0207662_10347431 | 3300025918 | Bacteria | 995 |
| 228 | Ga0207657_10012303 | 3300025919 | Bacteria | 8456 |
| 229 | Ga0207657_10036760 | 3300025919 | Bacteria | 4381 |
| 230 | Ga0207657_10046279 | 3300025919 | Bacteria | 3812 |
| 231 | Ga0207649_10000852 | 3300025920 | Bacteria | 19557 |
| 232 | Ga0207649_10063353 | 3300025920 | Bacteria | 2334 |
| 233 | Ga0207649_10147106 | 3300025920 | Bacteria | 1618 |
| 234 | Ga0207652_10078097 | 3300025921 | Bacteria | 2889 |
| 235 | Ga0207652_10100350 | 3300025921 | Bacteria | 2555 |
| 236 | Ga0207652_10250411 | 3300025921 | Bacteria | 1597 |
| 237 | Ga0207694_10018888 | 3300025924 | Bacteria | 5211 |
| 238 | Ga0207694_10174373 | 3300025924 | Bacteria | 1742 |
| 239 | Ga0207694_10284615 | 3300025924 | Bacteria | 1358 |
| 240 | Ga0207659_10001325 | 3300025926 | Bacteria | 14791 |
| 241 | Ga0207687_10018841 | 3300025927 | Bacteria | 4563 |
| 242 | Ga0207687_10028412 | 3300025927 | Bacteria | 3757 |
| 243 | Ga0207687_10168823 | 3300025927 | Bacteria | 1686 |
| 244 | Ga0207700_10000623 | 3300025928 | Bacteria | 20712 |
| 245 | Ga0207700_10136114 | 3300025928 | Bacteria | 2012 |
| 246 | Ga0207664_10068339 | 3300025929 | Bacteria | 2854 |
| 247 | Ga0207664_10550414 | 3300025929 | Bacteria | 1035 |
| 248 | Ga0207644_10008645 | 3300025931 | Bacteria | 6659 |
| 249 | Ga0207644_10057454 | 3300025931 | Bacteria | 2809 |
| 250 | Ga0207644_10118703 | 3300025931 | Bacteria | 2010 |
| 251 | Ga0207690_10001793 | 3300025932 | Bacteria | 13192 |
| 252 | Ga0207706_10017303 | 3300025933 | Bacteria | 6495 |
| 253 | Ga0207706_10041807 | 3300025933 | Bacteria | 4063 |
| 254 | Ga0207686_10000898 | 3300025934 | Bacteria | 17933 |
| 255 | Ga0207709_10003144 | 3300025935 | Bacteria | 9924 |
| 256 | Ga0207709_10178383 | 3300025935 | Bacteria | 1498 |
| 257 | Ga0207670_10018372 | 3300025936 | Bacteria | 4250 |
| 258 | Ga0207704_10031431 | 3300025938 | Bacteria | 2991 |
| 259 | Ga0207665_10001669 | 3300025939 | Bacteria | 14935 |
| 260 | Ga0207665_10353646 | 3300025939 | Bacteria | 1109 |
| 261 | Ga0207691_10042188 | 3300025940 | Bacteria | 4206 |
| 262 | Ga0207691_10053344 | 3300025940 | Bacteria | 3691 |
| 263 | Ga0207691_10352009 | 3300025940 | Bacteria | 1260 |
| 264 | Ga0207711_10014151 | 3300025941 | Bacteria | 6628 |
| 265 | Ga0207711_10041241 | 3300025941 | Bacteria | 3930 |
| 266 | Ga0207711_10228839 | 3300025941 | Bacteria | 1702 |
| 267 | Ga0207689_10007833 | 3300025942 | Bacteria | 9338 |
| 268 | Ga0207661_10002538 | 3300025944 | Bacteria | 12565 |
| 269 | Ga0207679_10000187 | 3300025945 | Bacteria | 49895 |
| 270 | Ga0207667_10016532 | 3300025949 | Bacteria | 8334 |
| 271 | Ga0207667_10082569 | 3300025949 | Bacteria | 3328 |
| 272 | Ga0207651_10127001 | 3300025960 | Bacteria | 1945 |
| 273 | Ga0207712_10006029 | 3300025961 | Bacteria | 7648 |
| 274 | Ga0207640_10071065 | 3300025981 | Bacteria | 2343 |
| 275 | Ga0207658_10057325 | 3300025986 | Bacteria | 2894 |
| 276 | Ga0207658_10065697 | 3300025986 | Bacteria | 2726 |
| 277 | Ga0207658_10095816 | 3300025986 | Bacteria | 2313 |
| 278 | Ga0207677_10372145 | 3300026023 | Bacteria | 1203 |
| 279 | Ga0207677_10714629 | 3300026023 | Bacteria | 890 |
| 280 | Ga0207703_10087739 | 3300026035 | Bacteria | 2609 |
| 281 | Ga0207639_10089022 | 3300026041 | Bacteria | 2465 |
| 282 | Ga0207678_10007624 | 3300026067 | Bacteria | 9559 |
| 283 | Ga0207678_10015613 | 3300026067 | Bacteria | 6677 |
| 284 | Ga0207678_10043789 | 3300026067 | Bacteria | 3873 |
| 285 | Ga0207702_10054324 | 3300026078 | Bacteria | 3394 |
| 286 | Ga0207702_10830076 | 3300026078 | Bacteria | 914 |
| 287 | Ga0207641_10143683 | 3300026088 | Bacteria | 2155 |
| 288 | Ga0207641_10640019 | 3300026088 | Bacteria | 1044 |
| 289 | Ga0207648_10001031 | 3300026089 | Bacteria | 31313 |
| 290 | Ga0207648_10174077 | 3300026089 | Bacteria | 1903 |
| 291 | Ga0207676_10134624 | 3300026095 | Bacteria | 2106 |
| 292 | Ga0207676_10333146 | 3300026095 | Bacteria | 1397 |
| 293 | Ga0207674_10000686 | 3300026116 | Bacteria | 44016 |
| 294 | Ga0207674_10180152 | 3300026116 | Bacteria | 2064 |
| 295 | Ga0207674_10694744 | 3300026116 | Bacteria | 982 |
| 296 | Ga0207675_100048378 | 3300026118 | Bacteria | 3969 |
| 297 | Ga0207683_10000727 | 3300026121 | Bacteria | 29910 |
| 298 | Ga0207683_10004115 | 3300026121 | Bacteria | 12577 |
| 299 | Ga0207683_10041162 | 3300026121 | Bacteria | 4033 |
| 300 | Ga0207698_10672089 | 3300026142 | Bacteria | 1028 |
| 301 | Ga0209970_1002946 | 3300027614 | Bacteria | 2871 |
| 302 | Ga0209983_1001199 | 3300027665 | Bacteria | 5741 |
| 303 | Ga0209971_1001243 | 3300027682 | Bacteria | 6384 |
| 304 | Ga0209966_1000714 | 3300027695 | Bacteria | 7077 |
| 305 | Ga0209998_10064008 | 3300027717 | Bacteria | 870 |
| 306 | Ga0209998_10067826 | 3300027717 | Bacteria | 849 |
| 307 | Ga0209813_10011774 | 3300027866 | Bacteria | 2295 |
| 308 | Ga0209974_10010473 | 3300027876 | Bacteria | 3129 |
| 309 | Ga0207428_10000150 | 3300027907 | Bacteria | 94699 |
| 310 | Ga0207428_10000360 | 3300027907 | Bacteria | 58478 |
| 311 | Ga0207428_10000556 | 3300027907 | Bacteria | 44098 |
| 312 | Ga0268266_10004404 | 3300028379 | Bacteria | 13495 |
| 313 | Ga0268266_10281305 | 3300028379 | Bacteria | 1547 |
| 314 | Ga0268266_10666268 | 3300028379 | Bacteria | 1002 |
| 315 | Ga0268265_10000526 | 3300028380 | Bacteria | 39043 |
| 316 | Ga0268264_10002038 | 3300028381 | Bacteria | 18063 |
| 317 | Ga0268264_10122323 | 3300028381 | Bacteria | 2295 |
| 318 | Ga0268264_10557975 | 3300028381 | Bacteria | 1124 |
| 319 | Ga0265337_1019818 | 3300028556 | Bacteria | 2115 |
| 320 | Ga0265336_10043542 | 3300028666 | Bacteria | 1368 |
| 321 | Ga0265338_10085845 | 3300028800 | Bacteria | 2622 |
| 322 | Ga0265338_10115103 | 3300028800 | Bacteria | 2156 |
| 323 | Ga0265330_10046345 | 3300031235 | Bacteria | 1915 |
| 324 | Ga0265332_10000812 | 3300031238 | Bacteria | 18981 |
| 325 | Ga0265332_10082336 | 3300031238 | Bacteria | 1365 |
| 326 | Ga0265325_10000030 | 3300031241 | Bacteria | 103532 |
| 327 | Ga0265325_10017849 | 3300031241 | Bacteria | 3941 |
| 328 | Ga0265325_10108720 | 3300031241 | Bacteria | 1350 |
| 329 | Ga0265340_10002134 | 3300031247 | Bacteria | 11343 |
| 330 | Ga0265340_10005177 | 3300031247 | Bacteria | 7250 |
| 331 | Ga0265340_10065466 | 3300031247 | Bacteria | 1730 |
| 332 | Ga0265340_10099641 | 3300031247 | Bacteria | 1351 |
| 333 | Ga0265339_10000669 | 3300031249 | Bacteria | 26471 |
| 334 | Ga0265339_10008520 | 3300031249 | Bacteria | 6519 |
| 335 | Ga0265339_10077030 | 3300031249 | Bacteria | 1767 |
| 336 | Ga0265331_10194498 | 3300031250 | Bacteria | 914 |
| 337 | Ga0307513_10143091 | 3300031456 | Bacteria | 2314 |
| 338 | Ga0265313_10003681 | 3300031595 | Bacteria | 12245 |
| 339 | Ga0265313_10006110 | 3300031595 | Bacteria | 8665 |
| 340 | Ga0265313_10030904 | 3300031595 | Bacteria | 2751 |
| 341 | Ga0265313_10082256 | 3300031595 | Bacteria | 1460 |
| 342 | Ga0316579_10027180 | 3300031691 | Bacteria | 2596 |
| 343 | Ga0265314_10004041 | 3300031711 | Bacteria | 13864 |
| 344 | Ga0265314_10009643 | 3300031711 | Bacteria | 8132 |
| 345 | Ga0265314_10030010 | 3300031711 | Bacteria | 4030 |
| 346 | Ga0265314_10249456 | 3300031711 | Bacteria | 1020 |
| 347 | Ga0265342_10000281 | 3300031712 | Bacteria | 57398 |
| 348 | Ga0265342_10004069 | 3300031712 | Bacteria | 11662 |
| 349 | Ga0265342_10110551 | 3300031712 | Bacteria | 1555 |
| 350 | Ga0307415_100250089 | 3300032126 | Bacteria | 1440 |
| 351 | Ga0316583_10000116 | 3300032133 | Bacteria | 18613 |
| 352 | Ga0373930_0000129 | 3300034816 | Bacteria | 8362 |
| 353 | Ga0373930_0003062 | 3300034816 | Bacteria | 2631 |
| 354 | Ga0373948_0007773 | 3300034817 | Bacteria | 1812 |
| 355 | Ga0373950_0000820 | 3300034818 | Bacteria | 3906 |
| 356 | Ga0373959_0001750 | 3300034820 | Bacteria | 3469 |
| 357 | Ga0373959_0001950 | 3300034820 | Bacteria | 3288 |
| 358 | Ga0373938_0002546 | 3300034957 | Bacteria | 2941 |
| 359 | Ga0373938_0006708 | 3300034957 | Bacteria | 2000 |
| 360 | Ga0373926_0006649 | 3300035083 | Bacteria | 3838 |
| 361 | Ga0373926_0023880 | 3300035083 | Bacteria | 2125 |
| 362 | Ga0373926_0032415 | 3300035083 | Bacteria | 1843 |
| 363 | Ga0373928_0000375 | 3300035084 | Bacteria | 8963 |
| 364 | Ga0373929_0000146 | 3300035085 | Bacteria | 12154 |
| 365 | Ga0373929_0001869 | 3300035085 | Bacteria | 3946 |
| 366 | Ga0373940_0008049 | 3300035088 | Bacteria | 2404 |
| 367 | Ga0373940_0058780 | 3300035088 | Bacteria | 1095 |
| 368 | Ga0373944_0005274 | 3300035089 | Bacteria | 3400 |
| 369 | Ga0373944_0006918 | 3300035089 | Bacteria | 3028 |
| 370 | Ga0373944_0015430 | 3300035089 | Bacteria | 2144 |
| 371 | Ga0373949_0010201 | 3300035090 | Bacteria | 2057 |
| 372 | Ga0373951_0000214 | 3300035091 | Bacteria | 20411 |
| 373 | Ga0373952_0001494 | 3300035092 | Bacteria | 4252 |
| 374 | Ga0373923_0000187 | 3300035111 | Bacteria | 12538 |
| 375 | Ga0373932_0000473 | 3300035112 | Bacteria | 12328 |
| 376 | Ga0373932_0000584 | 3300035112 | Bacteria | 11134 |
| 377 | Ga0373939_0000602 | 3300035114 | Bacteria | 8943 |
| 378 | Ga0373939_0003756 | 3300035114 | Bacteria | 3579 |
| 379 | Ga0373941_0004906 | 3300035115 | Bacteria | 3117 |
| 380 | Ga0373945_0000395 | 3300035116 | Bacteria | 12509 |
| 381 | Ga0373945_0003626 | 3300035116 | Bacteria | 4864 |
| 382 | Ga0373945_0040494 | 3300035116 | Bacteria | 1682 |
| 383 | Ga0373953_0006040 | 3300035117 | Bacteria | 3968 |
| 384 | Ga0373954_0003581 | 3300035118 | Bacteria | 6602 |
| 385 | Ga0373954_0006846 | 3300035118 | Bacteria | 4975 |
| 386 | Ga0373954_0103932 | 3300035118 | Bacteria | 1371 |
| 387 | Ga0373954_0104203 | 3300035118 | Bacteria | 1369 |
| 388 | Ga0373956_0003765 | 3300035119 | Bacteria | 6107 |
| 389 | Ga0373956_0040778 | 3300035119 | Bacteria | 2060 |
| 390 | Ga0373957_0019755 | 3300035120 | Bacteria | 2374 |
| 391 | Ga0373960_0001283 | 3300035121 | Bacteria | 5530 |
| 392 | Ga0373943_0003892 | 3300035170 | Bacteria | 6797 |
| 393 | Ga0373943_0005034 | 3300035170 | Bacteria | 5960 |
| 394 | Ga0373943_0008480 | 3300035170 | Bacteria | 4610 |
| 395 | Ga0373943_0031860 | 3300035170 | Bacteria | 2503 |
| 396 | Ga0373946_0024257 | 3300035171 | Bacteria | 2375 |
| 397 | Ga0373946_0074135 | 3300035171 | Bacteria | 1476 |
| 398 | Ga0373955_0024147 | 3300035172 | Bacteria | 3105 |
| 399 | Ga0373955_0070304 | 3300035172 | Bacteria | 1955 |
| 400 | Ga0373955_0083295 | 3300035172 | Bacteria | 1811 |
| 401 | Ga0373955_0101614 | 3300035172 | Bacteria | 1651 |
| 402 | Ga0373942_0008104 | 3300035207 | Bacteria | 2444 |
| 403 | Ga0373942_0017422 | 3300035207 | Bacteria | 1770 |
| 404 | Ga0373961_0000749 | 3300035241 | Bacteria | 11204 |
| 405 | Ga0373924_0022179 | 3300035410 | Bacteria | 2481 |
| 406 | Ga0373931_0109680 | 3300035691 | Bacteria | 1564 |
| 407 | Ga0373935_0004894 | 3300035692 | Bacteria | 7873 |
| 408 | Ga0373935_0179646 | 3300035692 | Bacteria | 1452 |
| 409 | Ga0373927_0006438 | 3300035695 | Bacteria | 8002 |
| 410 | Ga0373927_0064286 | 3300035695 | Bacteria | 2373 |
| 411 | Ga0373927_0081759 | 3300035695 | Bacteria | 2093 |
| 412 | Ga0373927_0095756 | 3300035695 | Bacteria | 1929 |
| 413 | Ga0373927_0283154 | 3300035695 | Bacteria | 1091 |
| 414 | Ga0373933_0001082 | 3300035724 | Bacteria | 16333 |
| 415 | Ga0373933_0008751 | 3300035724 | Bacteria | 5518 |
| 416 | Ga0373933_0009814 | 3300035724 | Bacteria | 5238 |
| 417 | Ga0373933_0035906 | 3300035724 | Bacteria | 2898 |
| 418 | Ga0373933_0173498 | 3300035724 | Bacteria | 1373 |
| 419 | Ga0373947_0001922 | 3300035725 | Bacteria | 12704 |
| 420 | Ga0373947_0016251 | 3300035725 | Bacteria | 4277 |
| 421 | Ga0373947_0040243 | 3300035725 | Bacteria | 2783 |
| 422 | Ga0373947_0069790 | 3300035725 | Bacteria | 2152 |
| 423 | Ga0373937_0002931 | 3300036401 | Bacteria | 14272 |
| 424 | Ga0373937_0007191 | 3300036401 | Bacteria | 9629 |
| 425 | Ga0373937_0124163 | 3300036401 | Bacteria | 2407 |
| 426 | Ga0373925_0001686 | 3300037068 | Bacteria | 18583 |
| 427 | Ga0373925_0009753 | 3300037068 | Bacteria | 6975 |
| 428 | Ga0373925_0050437 | 3300037068 | Bacteria | 3103 |
| 429 | Ga0395899_0006936 | 3300037312 | Bacteria | 8776 |
| 430 | Ga0395899_0257309 | 3300037312 | Bacteria | 1195 |
| 431 | Ga0395900_0012710 | 3300037418 | Bacteria | 8602 |
| 432 | Ga0395900_0122362 | 3300037418 | Bacteria | 2669 |
| 433 | Ga0395898_0012047 | 3300037466 | Bacteria | 8951 |
| 434 | Ga0436364_0168099 | 3300037853 | Bacteria | 818 |
| 435 | Ga0436364_1441472 | 3300037853 | Bacteria | 3831 |
| 436 | Ga0395901_0007158 | 3300038443 | Bacteria | 11258 |
| 437 | Ga0395901_0109021 | 3300038443 | Bacteria | 2906 |
| 438 | Ga0436365_0769383 | 3300039437 | Bacteria | 9423 |
| 439 | Ga0436365_0983586 | 3300039437 | Bacteria | 1050 |
| 440 | Ga0436362_0869149 | 3300039453 | Bacteria | 2119 |
| 441 | Ga0451791_0612931 | 3300041451 | Bacteria | 2017 |
| 442 | Ga0451802_1957638 | 3300041460 | Bacteria | 1306 |
| 443 | Ga0451807_2314777 | 3300041486 | Bacteria | 1759 |
| 444 | Ga0451841_0706006 | 3300041498 | Bacteria | 1038 |
| 445 | Ga0439463_012770 | 3300042016 | Bacteria | 2065 |
| 446 | Ga0439446_0063715 | 3300042156 | Bacteria | 1118 |
| 447 | Ga0439459_0015823 | 3300042438 | Bacteria | 1387 |
| 448 | Ga0451577_0127376 | 3300042876 | Bacteria | 2282 |
| 449 | Ga0466965_0113074 | 3300044683 | Bacteria | 1397 |
| 450 | Ga0466965_0299891 | 3300044683 | Bacteria | 872 |
| 451 | Ga0466963_0370252 | 3300044694 | Bacteria | 1009 |
| 452 | Ga0451576_0018136 | 3300045051 | Bacteria | 7721 |
| 453 | Ga0466967_0094290 | 3300045976 | Bacteria | 2725 |
| 454 | Ga0495603_0001272 | 3300046455 | Bacteria | 14676 |
| 455 | Ga0495603_0082254 | 3300046455 | Bacteria | 1886 |
| 456 | Ga0495629_0000026 | 3300046459 | Bacteria | 134719 |
| 457 | Ga0495629_0015488 | 3300046459 | Bacteria | 5474 |
| 458 | Ga0495629_0036259 | 3300046459 | Bacteria | 3482 |
| 459 | Ga0495638_0013371 | 3300046460 | Bacteria | 5590 |
| 460 | Ga0495641_0018469 | 3300046461 | Bacteria | 3597 |
| 461 | Ga0495651_0017093 | 3300046462 | Bacteria | 5621 |
| 462 | Ga0495651_0220127 | 3300046462 | Bacteria | 1314 |
| 463 | Ga0495651_0256863 | 3300046462 | Bacteria | 1190 |
| 464 | Ga0495651_0301221 | 3300046462 | Bacteria | 1075 |
| 465 | Ga0495653_0017706 | 3300046463 | Bacteria | 5793 |
| 466 | Ga0495653_0227717 | 3300046463 | Bacteria | 1249 |
| 467 | Ga0495653_0239184 | 3300046463 | Bacteria | 1211 |
| 468 | Ga0495580_0013840 | 3300046472 | Bacteria | 6142 |
| 469 | Ga0495580_0068647 | 3300046472 | Bacteria | 2478 |
| 470 | Ga0495582_0014383 | 3300046473 | Bacteria | 4350 |
| 471 | Ga0495639_0006240 | 3300046475 | Bacteria | 5120 |
| 472 | Ga0495639_0009341 | 3300046475 | Bacteria | 4205 |
| 473 | Ga0495639_0024784 | 3300046475 | Bacteria | 2642 |
| 474 | Ga0495662_0002967 | 3300046476 | Bacteria | 8560 |
| 475 | Ga0495662_0086545 | 3300046476 | Bacteria | 1526 |
| 476 | Ga0495664_0002862 | 3300046477 | Bacteria | 9299 |
| 477 | Ga0495664_0027670 | 3300046477 | Bacteria | 3307 |
| 478 | Ga0495584_0040128 | 3300046491 | Bacteria | 2364 |
| 479 | Ga0495585_0002078 | 3300046492 | Bacteria | 14696 |
| 480 | Ga0495594_0030525 | 3300046499 | Bacteria | 2917 |
| 481 | Ga0495607_0004674 | 3300046501 | Bacteria | 10022 |
| 482 | Ga0495606_0169337 | 3300046507 | Bacteria | 1268 |
| 483 | Ga0495608_0003087 | 3300046511 | Bacteria | 11890 |
| 484 | Ga0495608_0041050 | 3300046511 | Bacteria | 3098 |
| 485 | Ga0495608_0056482 | 3300046511 | Bacteria | 2592 |
| 486 | Ga0495608_0105750 | 3300046511 | Bacteria | 1812 |
| 487 | Ga0495616_0038691 | 3300046513 | Bacteria | 2448 |
| 488 | Ga0495618_0015090 | 3300046514 | Bacteria | 4712 |
| 489 | Ga0495628_0019066 | 3300046516 | Bacteria | 5673 |
| 490 | Ga0495628_0073293 | 3300046516 | Bacteria | 2668 |
| 491 | Ga0495628_0090285 | 3300046516 | Bacteria | 2372 |
| 492 | Ga0495630_0026726 | 3300046517 | Bacteria | 4275 |
| 493 | Ga0495630_0087010 | 3300046517 | Bacteria | 2360 |
| 494 | Ga0495644_0000312 | 3300046523 | Bacteria | 22452 |
| 495 | Ga0495666_0001337 | 3300046526 | Bacteria | 11947 |
| 496 | Ga0495652_0011840 | 3300046529 | Bacteria | 7883 |
| 497 | Ga0495652_0022671 | 3300046529 | Bacteria | 5571 |
| 498 | Ga0495652_0026811 | 3300046529 | Bacteria | 5084 |
| 499 | Ga0495652_0101928 | 3300046529 | Bacteria | 2326 |
| 500 | Ga0495665_0006056 | 3300046531 | Bacteria | 6524 |
| 501 | Ga0495665_0127196 | 3300046531 | Bacteria | 1334 |
| 502 | Ga0495640_0006356 | 3300046533 | Bacteria | 9360 |
| 503 | Ga0495586_0008435 | 3300046535 | Bacteria | 5484 |
| 504 | Ga0495586_0008693 | 3300046535 | Bacteria | 5407 |
| 505 | Ga0495587_0001048 | 3300046536 | Bacteria | 18208 |
| 506 | Ga0495587_0021036 | 3300046536 | Bacteria | 4024 |
| 507 | Ga0495587_0199300 | 3300046536 | Bacteria | 1132 |
| 508 | Ga0495598_0031147 | 3300046537 | Bacteria | 1499 |
| 509 | Ga0495609_0020209 | 3300046538 | Bacteria | 3078 |
| 510 | Ga0495645_0002634 | 3300046543 | Bacteria | 12204 |
| 511 | Ga0495645_0014085 | 3300046543 | Bacteria | 5667 |
| 512 | Ga0495645_0087093 | 3300046543 | Bacteria | 2234 |
| 513 | Ga0495645_0113346 | 3300046543 | Bacteria | 1917 |
| 514 | Ga0495622_0016292 | 3300046557 | Bacteria | 3459 |
| 515 | Ga0495622_0092083 | 3300046557 | Bacteria | 1392 |
| 516 | Ga0495633_0001295 | 3300046558 | Bacteria | 19775 |
| 517 | Ga0495667_0003431 | 3300046559 | Bacteria | 10630 |
| 518 | Ga0495667_0011221 | 3300046559 | Bacteria | 6068 |
| 519 | Ga0495667_0014036 | 3300046559 | Bacteria | 5408 |
| 520 | Ga0495667_0039048 | 3300046559 | Bacteria | 3159 |
| 521 | Ga0495656_0000338 | 3300046615 | Bacteria | 16110 |
| 522 | Ga0495611_0102403 | 3300046648 | Bacteria | 1330 |
| 523 | Ga0495611_0162183 | 3300046648 | Bacteria | 1045 |
| 524 | Ga0495635_0048853 | 3300046663 | Bacteria | 2916 |
| 525 | Ga0495635_0118183 | 3300046663 | Bacteria | 1809 |
| 526 | Ga0495635_0144080 | 3300046663 | Bacteria | 1622 |
| 527 | Ga0495661_0113218 | 3300046665 | Bacteria | 1509 |
| 528 | Ga0495588_0017196 | 3300046674 | Bacteria | 3507 |
| 529 | Ga0495588_0030675 | 3300046674 | Bacteria | 2703 |
| 530 | Ga0495657_0023571 | 3300046675 | Bacteria | 4395 |
| 531 | Ga0495657_0051023 | 3300046675 | Bacteria | 2779 |
| 532 | Ga0495599_0191987 | 3300046678 | Bacteria | 1256 |
| 533 | Ga0495599_0405502 | 3300046678 | Unclassified | 811 |
| 534 | Ga0495623_0000394 | 3300046679 | Bacteria | 28821 |
| 535 | Ga0495623_0030999 | 3300046679 | Bacteria | 3440 |
| 536 | Ga0495623_0031891 | 3300046679 | Bacteria | 3387 |
| 537 | Ga0495646_0002685 | 3300046680 | Bacteria | 11010 |
| 538 | Ga0495646_0024348 | 3300046680 | Bacteria | 3812 |
| 539 | Ga0495647_0002213 | 3300046681 | Bacteria | 6085 |
| 540 | Ga0495647_0003379 | 3300046681 | Bacteria | 5113 |
| 541 | Ga0495647_0005918 | 3300046681 | Bacteria | 4025 |
| 542 | Ga0495658_0054247 | 3300046683 | Bacteria | 2279 |
| 543 | Ga0495669_0183046 | 3300046684 | Bacteria | 999 |
| 544 | Ga0495613_0040648 | 3300046689 | Bacteria | 3445 |
| 545 | Ga0495613_0106636 | 3300046689 | Bacteria | 2021 |
| 546 | Ga0495613_0122963 | 3300046689 | Bacteria | 1862 |
| 547 | Ga0495624_0038263 | 3300046690 | Bacteria | 3082 |
| 548 | Ga0495670_0000232 | 3300046691 | Bacteria | 25466 |
| 549 | Ga0495600_0002491 | 3300046809 | Bacteria | 10572 |
| 550 | Ga0495600_0011998 | 3300046809 | Bacteria | 5410 |
| 551 | Ga0495600_0014421 | 3300046809 | Bacteria | 4981 |
| 552 | Ga0495600_0019514 | 3300046809 | Bacteria | 4330 |
| 553 | Ga0495581_0021531 | 3300047315 | Bacteria | 3735 |
| 554 | Ga0495581_0027479 | 3300047315 | Bacteria | 3299 |
| 555 | Ga0495581_0150574 | 3300047315 | Bacteria | 1359 |
| 556 | Ga0495604_0009413 | 3300047317 | Bacteria | 7727 |
| 557 | Ga0495604_0010035 | 3300047317 | Bacteria | 7498 |
| 558 | Ga0495604_0105379 | 3300047317 | Bacteria | 2064 |
| 559 | Ga0495674_0009887 | 3300047319 | Bacteria | 9054 |
| 560 | Ga0495674_0015538 | 3300047319 | Bacteria | 7114 |
| 561 | Ga0495674_0059871 | 3300047319 | Bacteria | 3325 |
| 562 | Ga0495676_0117383 | 3300047321 | Bacteria | 1941 |
| 563 | Ga0495676_0167932 | 3300047321 | Bacteria | 1546 |
| 564 | Ga0495680_0008836 | 3300047322 | Bacteria | 9116 |
| 565 | Ga0495680_0009493 | 3300047322 | Bacteria | 8743 |
| 566 | Ga0495680_0015460 | 3300047322 | Bacteria | 6585 |
| 567 | Ga0495680_0031980 | 3300047322 | Bacteria | 4276 |
| 568 | Ga0495675_0001159 | 3300047444 | Bacteria | 15992 |
| 569 | Ga0495675_0030865 | 3300047444 | Bacteria | 3419 |
| 570 | Ga0495675_0058767 | 3300047444 | Bacteria | 2438 |
| 571 | Ga0495675_0060449 | 3300047444 | Bacteria | 2402 |
| 572 | Ga0495684_0018338 | 3300047471 | Bacteria | 5394 |
| 573 | Ga0495684_0066340 | 3300047471 | Bacteria | 2744 |
| 574 | Ga0495593_0060211 | 3300047673 | Bacteria | 1988 |
| 575 | Ga0495593_0219300 | 3300047673 | Bacteria | 954 |
| 576 | Ga0495602_0001877 | 3300048088 | Bacteria | 21025 |
| 577 | Ga0495602_0005817 | 3300048088 | Bacteria | 12942 |
| 578 | Ga0495602_0012468 | 3300048088 | Bacteria | 8734 |
| 579 | Ga0495602_0025567 | 3300048088 | Bacteria | 5712 |
| 580 | Ga0495602_0065563 | 3300048088 | Bacteria | 3134 |
| 581 | Ga0495614_0032344 | 3300048089 | Bacteria | 2251 |
| 582 | Ga0496100_0080900 | 3300048903 | Bacteria | 2193 |
| 583 | Ga0496101_0003343 | 3300048904 | Bacteria | 9991 |
| 584 | Ga0496101_0356708 | 3300048904 | Bacteria | 1149 |
| 585 | Ga0496101_0469356 | 3300048904 | Bacteria | 993 |
| 586 | Ga0496102_0056996 | 3300048905 | Bacteria | 3565 |
| 587 | Ga0496102_0401554 | 3300048905 | Bacteria | 1288 |
| 588 | Ga0496103_0000963 | 3300048906 | Bacteria | 20444 |
| 589 | Ga0496103_0072687 | 3300048906 | Bacteria | 2154 |
| 590 | Ga0496104_0000065 | 3300048907 | Bacteria | 108770 |
| 591 | Ga0496104_0066037 | 3300048907 | Bacteria | 3435 |
| 592 | Ga0496104_0335672 | 3300048907 | Bacteria | 1424 |
| 593 | Ga0496104_0374549 | 3300048907 | Bacteria | 1336 |
| 594 | Ga0496105_0000170 | 3300048908 | Bacteria | 43535 |
| 595 | Ga0496105_0012481 | 3300048908 | Bacteria | 6727 |
| 596 | Ga0496106_0007782 | 3300048909 | Bacteria | 7928 |
| 597 | Ga0496106_0428517 | 3300048909 | Bacteria | 1063 |
| 598 | Ga0496107_0077413 | 3300048910 | Bacteria | 2422 |
| 599 | Ga0496107_0156602 | 3300048910 | Bacteria | 1687 |
| 600 | Ga0496108_0001681 | 3300048911 | Bacteria | 17532 |
| 601 | Ga0496108_0009662 | 3300048911 | Bacteria | 7818 |
| 602 | Ga0496108_0012623 | 3300048911 | Bacteria | 6884 |
| 603 | Ga0496108_0305784 | 3300048911 | Bacteria | 1385 |
| 604 | Ga0496109_0009805 | 3300048912 | Bacteria | 8175 |
| 605 | Ga0496109_0010944 | 3300048912 | Bacteria | 7771 |
| 606 | Ga0496109_0042701 | 3300048912 | Bacteria | 4108 |
| 607 | Ga0496111_0002766 | 3300048914 | Bacteria | 10673 |
| 608 | Ga0496111_0029265 | 3300048914 | Bacteria | 3911 |
| 609 | Ga0496111_0065887 | 3300048914 | Bacteria | 2629 |
| 610 | Ga0496112_0021287 | 3300048915 | Bacteria | 6164 |
| 611 | Ga0496112_0072154 | 3300048915 | Bacteria | 3412 |
| 612 | Ga0496113_0000329 | 3300048916 | Bacteria | 22567 |
| 613 | Ga0496113_0054565 | 3300048916 | Bacteria | 2991 |
| 614 | Ga0496114_0005283 | 3300048917 | Bacteria | 10089 |
| 615 | Ga0496115_0001117 | 3300048918 | Bacteria | 19364 |
| 616 | Ga0496115_0030109 | 3300048918 | Bacteria | 4268 |
| 617 | Ga0496115_0051087 | 3300048918 | Bacteria | 3314 |
| 618 | Ga0496121_0062764 | 3300048924 | Bacteria | 3040 |
| 619 | Ga0501032_0039459 | 3300049569 | Bacteria | 3211 |
| 620 | Ga0501033_0016861 | 3300049570 | Bacteria | 5522 |
| 621 | Ga0501033_0279975 | 3300049570 | Bacteria | 1177 |
| 622 | Ga0501034_0009382 | 3300049571 | Bacteria | 10250 |
| 623 | Ga0501034_0018508 | 3300049571 | Bacteria | 7141 |
| 624 | Ga0501034_0144973 | 3300049571 | Bacteria | 2352 |
| 625 | Ga0501034_0263481 | 3300049571 | Bacteria | 1666 |
| 626 | Ga0501034_0295917 | 3300049571 | Bacteria | 1556 |
| 627 | Ga0501036_0006023 | 3300049572 | Bacteria | 9830 |
| 628 | Ga0501036_0190174 | 3300049572 | Bacteria | 1727 |
| 629 | Ga0501037_0001187 | 3300049573 | Bacteria | 19240 |
| 630 | Ga0501037_0035912 | 3300049573 | Bacteria | 3652 |
| 631 | Ga0501038_0018527 | 3300049574 | Bacteria | 6286 |
| 632 | Ga0501038_0064453 | 3300049574 | Bacteria | 3124 |
| 633 | Ga0501038_0243949 | 3300049574 | Bacteria | 1425 |
| 634 | Ga0501039_0177062 | 3300049575 | Bacteria | 1677 |
| 635 | Ga0501039_0181280 | 3300049575 | Bacteria | 1656 |
| 636 | Ga0501042_0011666 | 3300049578 | Bacteria | 5938 |
| 637 | Ga0501043_0001872 | 3300049579 | Bacteria | 18031 |
| 638 | Ga0501043_0005568 | 3300049579 | Bacteria | 10150 |
| 639 | Ga0501043_0326338 | 3300049579 | Bacteria | 1169 |
| 640 | Ga0501046_0010184 | 3300049580 | Bacteria | 8089 |
| 641 | Ga0501046_0120583 | 3300049580 | Bacteria | 1995 |
| 642 | Ga0501047_0007248 | 3300049581 | Bacteria | 10425 |
| 643 | Ga0501047_0010049 | 3300049581 | Bacteria | 8944 |
| 644 | Ga0501047_0114621 | 3300049581 | Bacteria | 2577 |
| 645 | Ga0501047_0229953 | 3300049581 | Bacteria | 1708 |
| 646 | Ga0501047_0587082 | 3300049581 | Bacteria | 936 |
| 647 | Ga0501048_0000039 | 3300049582 | Bacteria | 63521 |
| 648 | Ga0501048_0207496 | 3300049582 | Bacteria | 1389 |
| 649 | Ga0501067_0006870 | 3300049583 | Bacteria | 6313 |
| 650 | Ga0501067_0099590 | 3300049583 | Bacteria | 1614 |
| 651 | Ga0501068_0003533 | 3300049584 | Bacteria | 8445 |
| 652 | Ga0501068_0005646 | 3300049584 | Bacteria | 6853 |
| 653 | Ga0501069_0015022 | 3300049585 | Bacteria | 4147 |
| 654 | Ga0501069_0018212 | 3300049585 | Bacteria | 3788 |
| 655 | Ga0501072_0385604 | 3300049588 | Bacteria | 1112 |
| 656 | Ga0501073_0138955 | 3300049589 | Bacteria | 1683 |
| 657 | Ga0501073_0197021 | 3300049589 | Bacteria | 1393 |
| 658 | Ga0501074_0127621 | 3300049590 | Bacteria | 1820 |
| 659 | Ga0501074_0451795 | 3300049590 | Bacteria | 911 |
| 660 | Ga0501076_0196459 | 3300049592 | Bacteria | 1647 |
| 661 | Ga0501079_0366796 | 3300049741 | Bacteria | 1129 |
| 662 | Ga0501080_0000022 | 3300049742 | Bacteria | 90630 |
| 663 | Ga0501080_0006329 | 3300049742 | Bacteria | 10625 |
| 664 | Ga0501080_0254760 | 3300049742 | Bacteria | 1600 |
| 665 | Ga0501080_0487711 | 3300049742 | Bacteria | 1102 |
| 666 | Ga0501080_0580421 | 3300049742 | Bacteria | 996 |
| 667 | Ga0501083_0015876 | 3300049744 | Bacteria | 5271 |
| 668 | Ga0501083_0040545 | 3300049744 | Bacteria | 3160 |
| 669 | Ga0501035_0000655 | 3300049822 | Bacteria | 38162 |
| 670 | Ga0501035_0020097 | 3300049822 | Bacteria | 6133 |
| 671 | Ga0501044_0000255 | 3300049823 | Bacteria | 67530 |
| 672 | Ga0501044_0003019 | 3300049823 | Bacteria | 19039 |
| 673 | Ga0501044_0009346 | 3300049823 | Bacteria | 10692 |
| 674 | Ga0501044_0027373 | 3300049823 | Bacteria | 6026 |
| 675 | Ga0501044_0028439 | 3300049823 | Bacteria | 5901 |
| 676 | Ga0501044_0041488 | 3300049823 | Bacteria | 4791 |
| 677 | Ga0501044_0228464 | 3300049823 | Bacteria | 1809 |
| 678 | Ga0501045_0036447 | 3300049824 | Bacteria | 3571 |
| 679 | Ga0501045_0060639 | 3300049824 | Bacteria | 2773 |
| 680 | nmdc:mga00v17_30150_c1 | 3300050491 | Bacteria | 3190 |
| 681 | nmdc:mga0yw44_251197_c1 | 3300050492 | Bacteria | 1177 |
| 682 | nmdc:mga06z11_127471_c1 | 3300050494 | Bacteria | 1426 |
| 683 | nmdc:mga06z11_40821_c1 | 3300050494 | Bacteria | 2318 |
| 684 | nmdc:mga06z11_8072_c1 | 3300050494 | Bacteria | 4367 |
| 685 | nmdc:mga04h51_43209_c1 | 3300050495 | Bacteria | 1482 |
| 686 | nmdc:mga07m45_21541_c1 | 3300050496 | Bacteria | 3511 |
| 687 | nmdc:mga07m45_24981_c1 | 3300050496 | Bacteria | 3275 |
| 688 | nmdc:mga05p37_786_c1 | 3300050507 | Bacteria | 35281 |
| 689 | nmdc:mga09592_4641_c1 | 3300050508 | Bacteria | 11128 |
| 690 | nmdc:mga0qj67_4_c1 | 3300050509 | Bacteria | 176711 |
| 691 | nmdc:mga0qj67_537_c1 | 3300050509 | Bacteria | 25810 |
| 692 | nmdc:mga06r32_121_c1 | 3300050510 | Bacteria | 55968 |
| 693 | nmdc:mga08y16_13767_c1 | 3300050511 | Bacteria | 8515 |
| 694 | nmdc:mga08y16_224205_c1 | 3300050511 | Bacteria | 1945 |
| 695 | nmdc:mga08y16_309_c1 | 3300050511 | Bacteria | 44098 |
| 696 | nmdc:mga08y16_3336_c1 | 3300050511 | Bacteria | 16629 |
| 697 | nmdc:mga08y16_33889_c1 | 3300050511 | Bacteria | 5364 |
| 698 | nmdc:mga0n895_104_c1 | 3300050512 | Bacteria | 49584 |
| 699 | nmdc:mga0n895_409756_c1 | 3300050512 | Bacteria | 1371 |
| 700 | nmdc:mga0n895_670434_c1 | 3300050512 | Bacteria | 1034 |
| 701 | nmdc:mga0rr50_2087_c1 | 3300050513 | Bacteria | 11168 |
| 702 | nmdc:mga0rr50_23711_c1 | 3300050513 | Bacteria | 4238 |
| 703 | nmdc:mga08x19_178012_c1 | 3300050514 | Bacteria | 1451 |
| 704 | nmdc:mga0a205_121530_c1 | 3300050515 | Bacteria | 2511 |
| 705 | nmdc:mga0a205_94045_c1 | 3300050515 | Bacteria | 2896 |
| 706 | nmdc:mga0sz30_77639_c1 | 3300050516 | Bacteria | 1435 |
| 707 | Ga0495601_0000225 | 3300053077 | Bacteria | 30328 |
| 708 | Ga0495601_0011337 | 3300053077 | Bacteria | 5328 |
| 709 | Ga0495601_0066002 | 3300053077 | Bacteria | 2303 |
| 710 | Ga0495601_0283737 | 3300053077 | Bacteria | 1079 |
| 711 | Ga0495612_0000405 | 3300053078 | Bacteria | 17265 |
| 712 | Ga0495595_0000616 | 3300053084 | Bacteria | 13570 |
| 713 | Ga0495595_0003158 | 3300053084 | Bacteria | 6535 |
| 714 | Ga0495595_0130032 | 3300053084 | Bacteria | 1230 |
| 715 | Ga0495619_0000360 | 3300053085 | Bacteria | 31637 |
| 716 | Ga0495619_0001284 | 3300053085 | Bacteria | 16486 |
| 717 | Ga0495619_0004668 | 3300053085 | Bacteria | 8728 |
| 718 | Ga0495619_0236589 | 3300053085 | Bacteria | 1266 |
| 719 | Ga0495619_0285443 | 3300053085 | Bacteria | 1143 |
| 720 | Ga0500646_0103030 | 3300053090 | Bacteria | 898 |
| 721 | Ga0500651_0104067 | 3300053093 | Bacteria | 1738 |
| 722 | Ga0500566_0001157 | 3300053094 | Bacteria | 15353 |
| 723 | Ga0500562_072749 | 3300053108 | Bacteria | 928 |
| 724 | Ga0500593_002128 | 3300053117 | Bacteria | 7200 |
| 725 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 726 | Ga0500642_0064805 | 3300053130 | Bacteria | 1650 |
| 727 | Ga0500604_0081051 | 3300053151 | Bacteria | 1048 |
| 728 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 729 | Ga0500616_0077288 | 3300053153 | Bacteria | 1681 |
| 730 | Ga0501084_0012665 | 3300054114 | Bacteria | 6988 |
| 731 | Ga0501084_0105557 | 3300054114 | Bacteria | 2366 |
| 732 | Ga0501082_0022695 | 3300060353 | Bacteria | 5404 |
| 733 | Ga0501082_0032432 | 3300060353 | Bacteria | 4506 |
| 734 | Ga0501082_0225986 | 3300060353 | Bacteria | 1629 |
| 735 | Ga0466962_0069631 | 3300061719 | Bacteria | 1680 |
| 736 | Ga0466962_0115370 | 3300061719 | Bacteria | 1294 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050492 | nmdc:mga0yw44_251197_c1 | nmdc:mga0yw44_251197_c1_18_662 | 169 |
| 2 | 3300050494 | nmdc:mga06z11_127471_c1 | nmdc:mga06z11_127471_c1_36_713 | 169 |
| 3 | 3300050495 | nmdc:mga04h51_43209_c1 | nmdc:mga04h51_43209_c1_771_1448 | 169 |
| 4 | 3300050516 | nmdc:mga0sz30_77639_c1 | nmdc:mga0sz30_77639_c1_696_1373 | 169 |
| 5 | 3300049742 | Ga0501080_0487711 | Ga0501080_0487711_412_1080 | 186 |
| 6 | 3300053085 | Ga0495619_0236589 | Ga0495619_0236589_306_1034 | 192 |
| 7 | 3300035724 | Ga0373933_0173498 | Ga0373933_0173498_14_772 | 193 |
| 8 | 3300046517 | Ga0495630_0026726 | Ga0495630_0026726_2369_3109 | 193 |
| 9 | 3300032126 | Ga0307415_100250089 | Ga0307415_1002500892 | 194 |
| 10 | 3300047471 | Ga0495684_0066340 | Ga0495684_0066340_1989_2732 | 194 |
| 11 | 3300005439 | Ga0070711_100285363 | Ga0070711_1002853632 | 195 |
| 12 | 3300006178 | Ga0075367_10079858 | Ga0075367_100798582 | 195 |
| 13 | 3300009545 | Ga0105237_10100286 | Ga0105237_101002863 | 195 |
| 14 | 3300012505 | Ga0157339_1003319 | Ga0157339_10033191 | 195 |
| 15 | 3300031247 | Ga0265340_10099641 | Ga0265340_100996412 | 195 |
| 16 | 3300046477 | Ga0495664_0027670 | Ga0495664_0027670_706_1437 | 195 |
| 17 | 3300046511 | Ga0495608_0041050 | Ga0495608_0041050_1239_1970 | 195 |
| 18 | 3300046516 | Ga0495628_0073293 | Ga0495628_0073293_710_1441 | 195 |
| 19 | 3300046529 | Ga0495652_0026811 | Ga0495652_0026811_1214_1945 | 195 |
| 20 | 3300046543 | Ga0495645_0113346 | Ga0495645_0113346_628_1359 | 195 |
| 21 | 3300046663 | Ga0495635_0118183 | Ga0495635_0118183_156_887 | 195 |
| 22 | 3300046675 | Ga0495657_0023571 | Ga0495657_0023571_3510_4241 | 195 |
| 23 | 3300046679 | Ga0495623_0031891 | Ga0495623_0031891_157_888 | 195 |
| 24 | 3300046680 | Ga0495646_0024348 | Ga0495646_0024348_208_939 | 195 |
| 25 | 3300047317 | Ga0495604_0009413 | Ga0495604_0009413_1859_2590 | 195 |
| 26 | 3300047319 | Ga0495674_0015538 | Ga0495674_0015538_4393_5124 | 195 |
| 27 | 3300047322 | Ga0495680_0031980 | Ga0495680_0031980_3015_3746 | 195 |
| 28 | 3300047444 | Ga0495675_0030865 | Ga0495675_0030865_524_1255 | 195 |
| 29 | 3300048088 | Ga0495602_0005817 | Ga0495602_0005817_9274_10005 | 195 |
| 30 | 3300050494 | nmdc:mga06z11_40821_c1 | nmdc:mga06z11_40821_c1_585_1307 | 195 |
| 31 | 3300006177 | Ga0075362_10102872 | Ga0075362_101028721 | 196 |
| 32 | 3300006178 | Ga0075367_10206671 | Ga0075367_102066712 | 196 |
| 33 | 3300021384 | Ga0213876_10047692 | Ga0213876_100476923 | 196 |
| 34 | 3300028800 | Ga0265338_10115103 | Ga0265338_101151032 | 196 |
| 35 | 3300031235 | Ga0265330_10046345 | Ga0265330_100463453 | 196 |
| 36 | 3300031241 | Ga0265325_10017849 | Ga0265325_100178494 | 196 |
| 37 | 3300031247 | Ga0265340_10065466 | Ga0265340_100654662 | 196 |
| 38 | 3300031249 | Ga0265339_10077030 | Ga0265339_100770302 | 196 |
| 39 | 3300031711 | Ga0265314_10249456 | Ga0265314_102494561 | 196 |
| 40 | 3300037418 | Ga0395900_0012710 | Ga0395900_0012710_145_888 | 196 |
| 41 | 3300039437 | Ga0436365_0769383 | Ga0436365_0769383_6733_7482 | 196 |
| 42 | 3300039453 | Ga0436362_0869149 | Ga0436362_0869149_78_827 | 196 |
| 43 | 3300049575 | Ga0501039_0181280 | Ga0501039_0181280_234_959 | 196 |
| 44 | 3300049581 | Ga0501047_0229953 | Ga0501047_0229953_408_1133 | 196 |
| 45 | 3300049589 | Ga0501073_0138955 | Ga0501073_0138955_670_1395 | 196 |
| 46 | 3300049823 | Ga0501044_0228464 | Ga0501044_0228464_308_1033 | 196 |
| 47 | 3300053084 | Ga0495595_0130032 | Ga0495595_0130032_61_834 | 196 |
| 48 | 3300053153 | Ga0500616_0077288 | Ga0500616_0077288_573_1310 | 196 |
| 49 | 3300061719 | Ga0466962_0069631 | Ga0466962_0069631_910_1659 | 196 |
| 50 | iso_pu_bacteria | 2643221547 | 2643754966 | 196 |
| 51 | 3300005327 | Ga0070658_10045516 | Ga0070658_100455165 | 197 |
| 52 | 3300005327 | Ga0070658_10294924 | Ga0070658_102949242 | 197 |
| 53 | 3300005336 | Ga0070680_100025931 | Ga0070680_1000259311 | 197 |
| 54 | 3300005339 | Ga0070660_100021115 | Ga0070660_1000211153 | 197 |
| 55 | 3300005436 | Ga0070713_100427347 | Ga0070713_1004273471 | 197 |
| 56 | 3300005437 | Ga0070710_10127166 | Ga0070710_101271662 | 197 |
| 57 | 3300005458 | Ga0070681_10048764 | Ga0070681_100487643 | 197 |
| 58 | 3300005471 | Ga0070698_100313360 | Ga0070698_1003133602 | 197 |
| 59 | 3300005530 | Ga0070679_100074695 | Ga0070679_1000746954 | 197 |
| 60 | 3300005563 | Ga0068855_100077098 | Ga0068855_1000770984 | 197 |
| 61 | 3300006028 | Ga0070717_10041442 | Ga0070717_100414423 | 197 |
| 62 | 3300006353 | Ga0075370_10194263 | Ga0075370_101942632 | 197 |
| 63 | 3300006846 | Ga0075430_100000275 | Ga0075430_10000027521 | 197 |
| 64 | 3300009093 | Ga0105240_10109147 | Ga0105240_101091474 | 197 |
| 65 | 3300013104 | Ga0157370_10056299 | Ga0157370_100562993 | 197 |
| 66 | 3300025909 | Ga0207705_10468241 | Ga0207705_104682411 | 197 |
| 67 | 3300025912 | Ga0207707_10035389 | Ga0207707_100353894 | 197 |
| 68 | 3300025913 | Ga0207695_10169713 | Ga0207695_101697132 | 197 |
| 69 | 3300025917 | Ga0207660_10009967 | Ga0207660_100099676 | 197 |
| 70 | 3300025919 | Ga0207657_10046279 | Ga0207657_100462793 | 197 |
| 71 | 3300025921 | Ga0207652_10078097 | Ga0207652_100780973 | 197 |
| 72 | 3300025949 | Ga0207667_10016532 | Ga0207667_1001653211 | 197 |
| 73 | 3300025981 | Ga0207640_10071065 | Ga0207640_100710652 | 197 |
| 74 | 3300026078 | Ga0207702_10054324 | Ga0207702_100543243 | 197 |
| 75 | 3300028381 | Ga0268264_10557975 | Ga0268264_105579751 | 197 |
| 76 | 3300028666 | Ga0265336_10043542 | Ga0265336_100435421 | 197 |
| 77 | 3300031241 | Ga0265325_10108720 | Ga0265325_101087202 | 197 |
| 78 | 3300031595 | Ga0265313_10030904 | Ga0265313_100309043 | 197 |
| 79 | 3300037312 | Ga0395899_0257309 | Ga0395899_0257309_279_1016 | 197 |
| 80 | 3300037418 | Ga0395900_0122362 | Ga0395900_0122362_998_1735 | 197 |
| 81 | 3300037853 | Ga0436364_0168099 | Ga0436364_0168099_24_746 | 197 |
| 82 | 3300038443 | Ga0395901_0109021 | Ga0395901_0109021_1633_2370 | 197 |
| 83 | 3300039437 | Ga0436365_0983586 | Ga0436365_0983586_54_830 | 197 |
| 84 | 3300044694 | Ga0466963_0370252 | Ga0466963_0370252_45_779 | 197 |
| 85 | 3300045976 | Ga0466967_0094290 | Ga0466967_0094290_662_1396 | 197 |
| 86 | 3300048909 | Ga0496106_0428517 | Ga0496106_0428517_147_881 | 197 |
| 87 | 3300049570 | Ga0501033_0279975 | Ga0501033_0279975_163_894 | 197 |
| 88 | 3300049571 | Ga0501034_0018508 | Ga0501034_0018508_4587_5318 | 197 |
| 89 | 3300049571 | Ga0501034_0263481 | Ga0501034_0263481_804_1541 | 197 |
| 90 | 3300049574 | Ga0501038_0064453 | Ga0501038_0064453_2345_3076 | 197 |
| 91 | 3300049590 | Ga0501074_0451795 | Ga0501074_0451795_115_846 | 197 |
| 92 | 3300049742 | Ga0501080_0580421 | Ga0501080_0580421_238_969 | 197 |
| 93 | 3300049744 | Ga0501083_0040545 | Ga0501083_0040545_243_965 | 197 |
| 94 | 3300049823 | Ga0501044_0000255 | Ga0501044_0000255_47724_48455 | 197 |
| 95 | 3300049823 | Ga0501044_0027373 | Ga0501044_0027373_4930_5661 | 197 |
| 96 | 3300054114 | Ga0501084_0105557 | Ga0501084_0105557_1022_1744 | 197 |
| 97 | 3300060353 | Ga0501082_0225986 | Ga0501082_0225986_757_1479 | 197 |
| 98 | 3300005328 | Ga0070676_10110307 | Ga0070676_101103071 | 198 |
| 99 | 3300005366 | Ga0070659_100065802 | Ga0070659_1000658022 | 198 |
| 100 | 3300005458 | Ga0070681_10363512 | Ga0070681_103635121 | 198 |
| 101 | 3300005843 | Ga0068860_100348153 | Ga0068860_1003481531 | 198 |
| 102 | 3300009093 | Ga0105240_10853712 | Ga0105240_108537121 | 198 |
| 103 | 3300009094 | Ga0111539_10108778 | Ga0111539_101087784 | 198 |
| 104 | 3300009551 | Ga0105238_10025119 | Ga0105238_100251193 | 198 |
| 105 | 3300024225 | Ga0224572_1001585 | Ga0224572_10015852 | 198 |
| 106 | 3300024227 | Ga0228598_1014536 | Ga0228598_10145361 | 198 |
| 107 | 3300025909 | Ga0207705_10340141 | Ga0207705_103401412 | 198 |
| 108 | 3300025912 | Ga0207707_10038851 | Ga0207707_100388514 | 198 |
| 109 | 3300025913 | Ga0207695_10571334 | Ga0207695_105713341 | 198 |
| 110 | 3300025920 | Ga0207649_10147106 | Ga0207649_101471062 | 198 |
| 111 | 3300025921 | Ga0207652_10100350 | Ga0207652_101003502 | 198 |
| 112 | 3300025924 | Ga0207694_10018888 | Ga0207694_100188883 | 198 |
| 113 | 3300025928 | Ga0207700_10136114 | Ga0207700_101361142 | 198 |
| 114 | 3300025929 | Ga0207664_10550414 | Ga0207664_105504142 | 198 |
| 115 | 3300026116 | Ga0207674_10694744 | Ga0207674_106947441 | 198 |
| 116 | 3300028379 | Ga0268266_10666268 | Ga0268266_106662682 | 198 |
| 117 | 3300028800 | Ga0265338_10085845 | Ga0265338_100858454 | 198 |
| 118 | 3300031238 | Ga0265332_10082336 | Ga0265332_100823362 | 198 |
| 119 | 3300031247 | Ga0265340_10005177 | Ga0265340_100051772 | 198 |
| 120 | 3300031249 | Ga0265339_10008520 | Ga0265339_100085206 | 198 |
| 121 | 3300031595 | Ga0265313_10003681 | Ga0265313_1000368111 | 198 |
| 122 | 3300031711 | Ga0265314_10004041 | Ga0265314_1000404117 | 198 |
| 123 | 3300031711 | Ga0265314_10009643 | Ga0265314_1000964310 | 198 |
| 124 | 3300031711 | Ga0265314_10030010 | Ga0265314_100300103 | 198 |
| 125 | 3300031712 | Ga0265342_10004069 | Ga0265342_1000406915 | 198 |
| 126 | 3300031712 | Ga0265342_10110551 | Ga0265342_101105512 | 198 |
| 127 | 3300032133 | Ga0316583_10000116 | Ga0316583_1000011615 | 198 |
| 128 | 3300036401 | Ga0373937_0124163 | Ga0373937_0124163_500_1249 | 198 |
| 129 | 3300037312 | Ga0395899_0006936 | Ga0395899_0006936_7270_8013 | 198 |
| 130 | 3300037466 | Ga0395898_0012047 | Ga0395898_0012047_2536_3279 | 198 |
| 131 | 3300038443 | Ga0395901_0007158 | Ga0395901_0007158_9752_10495 | 198 |
| 132 | 3300044683 | Ga0466965_0113074 | Ga0466965_0113074_19_762 | 198 |
| 133 | 3300044683 | Ga0466965_0299891 | Ga0466965_0299891_62_811 | 198 |
| 134 | 3300046460 | Ga0495638_0013371 | Ga0495638_0013371_1699_2400 | 198 |
| 135 | 3300048907 | Ga0496104_0066037 | Ga0496104_0066037_721_1443 | 198 |
| 136 | 3300048908 | Ga0496105_0012481 | Ga0496105_0012481_807_1529 | 198 |
| 137 | 3300048910 | Ga0496107_0156602 | Ga0496107_0156602_477_1199 | 198 |
| 138 | 3300048918 | Ga0496115_0030109 | Ga0496115_0030109_1279_2001 | 198 |
| 139 | 3300048924 | Ga0496121_0062764 | Ga0496121_0062764_731_1453 | 198 |
| 140 | 3300049571 | Ga0501034_0144973 | Ga0501034_0144973_1535_2296 | 198 |
| 141 | 3300049571 | Ga0501034_0295917 | Ga0501034_0295917_524_1246 | 198 |
| 142 | 3300049573 | Ga0501037_0035912 | Ga0501037_0035912_177_935 | 198 |
| 143 | 3300049579 | Ga0501043_0005568 | Ga0501043_0005568_9382_10140 | 198 |
| 144 | 3300049580 | Ga0501046_0120583 | Ga0501046_0120583_172_930 | 198 |
| 145 | 3300049581 | Ga0501047_0007248 | Ga0501047_0007248_30_788 | 198 |
| 146 | 3300049581 | Ga0501047_0587082 | Ga0501047_0587082_153_896 | 198 |
| 147 | 3300049582 | Ga0501048_0000039 | Ga0501048_0000039_51723_52481 | 198 |
| 148 | 3300049582 | Ga0501048_0207496 | Ga0501048_0207496_203_1027 | 198 |
| 149 | 3300049585 | Ga0501069_0018212 | Ga0501069_0018212_273_1097 | 198 |
| 150 | 3300049589 | Ga0501073_0197021 | Ga0501073_0197021_115_894 | 198 |
| 151 | 3300049590 | Ga0501074_0127621 | Ga0501074_0127621_284_1027 | 198 |
| 152 | 3300049742 | Ga0501080_0000022 | Ga0501080_0000022_9251_10009 | 198 |
| 153 | 3300049742 | Ga0501080_0254760 | Ga0501080_0254760_594_1355 | 198 |
| 154 | 3300049822 | Ga0501035_0000655 | Ga0501035_0000655_4608_5360 | 198 |
| 155 | 3300049823 | Ga0501044_0003019 | Ga0501044_0003019_5039_5797 | 198 |
| 156 | 3300049823 | Ga0501044_0028439 | Ga0501044_0028439_718_1461 | 198 |
| 157 | 3300049824 | Ga0501045_0036447 | Ga0501045_0036447_1960_2718 | 198 |
| 158 | 3300050509 | nmdc:mga0qj67_4_c1 | nmdc:mga0qj67_4_c1_83755_84471 | 198 |
| 159 | 3300050511 | nmdc:mga08y16_33889_c1 | nmdc:mga08y16_33889_c1_1505_2293 | 198 |
| 160 | 3300053090 | Ga0500646_0103030 | Ga0500646_0103030_22_720 | 198 |
| 161 | 3300053093 | Ga0500651_0104067 | Ga0500651_0104067_261_992 | 198 |
| 162 | 3300053094 | Ga0500566_0001157 | Ga0500566_0001157_14621_15343 | 198 |
| 163 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_234846_235577 | 198 |
| 164 | 3300053130 | Ga0500642_0064805 | Ga0500642_0064805_402_1103 | 198 |
| 165 | 3300053151 | Ga0500604_0081051 | Ga0500604_0081051_145_846 | 198 |
| 166 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1426172_1426903 | 198 |
| 167 | 3300061719 | Ga0466962_0115370 | Ga0466962_0115370_99_842 | 198 |
| 168 | 3300002239 | JGI24034J26672_10011273 | JGI24034J26672_100112732 | 199 |
| 169 | 3300005329 | Ga0070683_100071308 | Ga0070683_1000713084 | 199 |
| 170 | 3300005330 | Ga0070690_100010169 | Ga0070690_1000101696 | 199 |
| 171 | 3300005335 | Ga0070666_10013033 | Ga0070666_100130336 | 199 |
| 172 | 3300005336 | Ga0070680_100320522 | Ga0070680_1003205222 | 199 |
| 173 | 3300005337 | Ga0070682_100211783 | Ga0070682_1002117831 | 199 |
| 174 | 3300005338 | Ga0068868_100043832 | Ga0068868_1000438325 | 199 |
| 175 | 3300005344 | Ga0070661_100135390 | Ga0070661_1001353901 | 199 |
| 176 | 3300005354 | Ga0070675_100149359 | Ga0070675_1001493592 | 199 |
| 177 | 3300005355 | Ga0070671_100067499 | Ga0070671_1000674993 | 199 |
| 178 | 3300005356 | Ga0070674_100058922 | Ga0070674_1000589223 | 199 |
| 179 | 3300005364 | Ga0070673_100022646 | Ga0070673_1000226463 | 199 |
| 180 | 3300005365 | Ga0070688_100015921 | Ga0070688_1000159215 | 199 |
| 181 | 3300005366 | Ga0070659_100078059 | Ga0070659_1000780593 | 199 |
| 182 | 3300005367 | Ga0070667_100049507 | Ga0070667_1000495071 | 199 |
| 183 | 3300005434 | Ga0070709_10036741 | Ga0070709_100367412 | 199 |
| 184 | 3300005434 | Ga0070709_10039706 | Ga0070709_100397062 | 199 |
| 185 | 3300005434 | Ga0070709_10089638 | Ga0070709_100896382 | 199 |
| 186 | 3300005435 | Ga0070714_100038357 | Ga0070714_1000383573 | 199 |
| 187 | 3300005436 | Ga0070713_100233617 | Ga0070713_1002336172 | 199 |
| 188 | 3300005440 | Ga0070705_100235401 | Ga0070705_1002354011 | 199 |
| 189 | 3300005441 | Ga0070700_100049650 | Ga0070700_1000496502 | 199 |
| 190 | 3300005455 | Ga0070663_100016023 | Ga0070663_1000160233 | 199 |
| 191 | 3300005458 | Ga0070681_10219210 | Ga0070681_102192103 | 199 |
| 192 | 3300005459 | Ga0068867_100119241 | Ga0068867_1001192411 | 199 |
| 193 | 3300005530 | Ga0070679_100045107 | Ga0070679_1000451075 | 199 |
| 194 | 3300005543 | Ga0070672_100107008 | Ga0070672_1001070082 | 199 |
| 195 | 3300005544 | Ga0070686_100121230 | Ga0070686_1001212304 | 199 |
| 196 | 3300005547 | Ga0070693_100132926 | Ga0070693_1001329262 | 199 |
| 197 | 3300005577 | Ga0068857_100137309 | Ga0068857_1001373092 | 199 |
| 198 | 3300005614 | Ga0068856_100046477 | Ga0068856_1000464774 | 199 |
| 199 | 3300005615 | Ga0070702_100080387 | Ga0070702_1000803873 | 199 |
| 200 | 3300005616 | Ga0068852_100106647 | Ga0068852_1001066473 | 199 |
| 201 | 3300005618 | Ga0068864_100160002 | Ga0068864_1001600023 | 199 |
| 202 | 3300005718 | Ga0068866_10018406 | Ga0068866_100184064 | 199 |
| 203 | 3300005834 | Ga0068851_10089551 | Ga0068851_100895512 | 199 |
| 204 | 3300005842 | Ga0068858_100221902 | Ga0068858_1002219021 | 199 |
| 205 | 3300005843 | Ga0068860_100622998 | Ga0068860_1006229981 | 199 |
| 206 | 3300005937 | Ga0081455_10024396 | Ga0081455_100243965 | 199 |
| 207 | 3300006028 | Ga0070717_10002945 | Ga0070717_100029454 | 199 |
| 208 | 3300006058 | Ga0075432_10004302 | Ga0075432_100043026 | 199 |
| 209 | 3300006173 | Ga0070716_100075159 | Ga0070716_1000751594 | 199 |
| 210 | 3300006194 | Ga0075427_10000953 | Ga0075427_100009534 | 199 |
| 211 | 3300006237 | Ga0097621_100015096 | Ga0097621_1000150964 | 199 |
| 212 | 3300006358 | Ga0068871_100056437 | Ga0068871_1000564374 | 199 |
| 213 | 3300006844 | Ga0075428_100004320 | Ga0075428_1000043201 | 199 |
| 214 | 3300006846 | Ga0075430_100000426 | Ga0075430_10000042611 | 199 |
| 215 | 3300006847 | Ga0075431_100020560 | Ga0075431_1000205609 | 199 |
| 216 | 3300006852 | Ga0075433_10000029 | Ga0075433_1000002922 | 199 |
| 217 | 3300006852 | Ga0075433_10549952 | Ga0075433_105499522 | 199 |
| 218 | 3300006871 | Ga0075434_100000208 | Ga0075434_10000020823 | 199 |
| 219 | 3300006880 | Ga0075429_100000734 | Ga0075429_10000073428 | 199 |
| 220 | 3300006914 | Ga0075436_100029960 | Ga0075436_1000299602 | 199 |
| 221 | 3300006914 | Ga0075436_100315984 | Ga0075436_1003159842 | 199 |
| 222 | 3300007076 | Ga0075435_100046941 | Ga0075435_1000469412 | 199 |
| 223 | 3300009011 | Ga0105251_10005445 | Ga0105251_100054454 | 199 |
| 224 | 3300009094 | Ga0111539_10000345 | Ga0111539_1000034523 | 199 |
| 225 | 3300009094 | Ga0111539_10261937 | Ga0111539_102619372 | 199 |
| 226 | 3300009101 | Ga0105247_10288663 | Ga0105247_102886631 | 199 |
| 227 | 3300009147 | Ga0114129_10003572 | Ga0114129_1000357225 | 199 |
| 228 | 3300009148 | Ga0105243_10156681 | Ga0105243_101566814 | 199 |
| 229 | 3300009176 | Ga0105242_10109212 | Ga0105242_101092122 | 199 |
| 230 | 3300009545 | Ga0105237_10034469 | Ga0105237_100344694 | 199 |
| 231 | 3300009551 | Ga0105238_10028682 | Ga0105238_100286824 | 199 |
| 232 | 3300009551 | Ga0105238_10475692 | Ga0105238_104756922 | 199 |
| 233 | 3300011119 | Ga0105246_10112198 | Ga0105246_101121982 | 199 |
| 234 | 3300012510 | Ga0157316_1006246 | Ga0157316_10062461 | 199 |
| 235 | 3300013100 | Ga0157373_10164715 | Ga0157373_101647152 | 199 |
| 236 | 3300013102 | Ga0157371_10238339 | Ga0157371_102383391 | 199 |
| 237 | 3300013104 | Ga0157370_10202959 | Ga0157370_102029592 | 199 |
| 238 | 3300013105 | Ga0157369_10834923 | Ga0157369_108349231 | 199 |
| 239 | 3300013306 | Ga0163162_11221534 | Ga0163162_112215341 | 199 |
| 240 | 3300014326 | Ga0157380_10065474 | Ga0157380_100654742 | 199 |
| 241 | 3300014968 | Ga0157379_10380040 | Ga0157379_103800403 | 199 |
| 242 | 3300014969 | Ga0157376_10214471 | Ga0157376_102144711 | 199 |
| 243 | 3300025898 | Ga0207692_10032532 | Ga0207692_100325322 | 199 |
| 244 | 3300025898 | Ga0207692_10193538 | Ga0207692_101935382 | 199 |
| 245 | 3300025906 | Ga0207699_10047203 | Ga0207699_100472032 | 199 |
| 246 | 3300025906 | Ga0207699_10187115 | Ga0207699_101871151 | 199 |
| 247 | 3300025915 | Ga0207693_10004402 | Ga0207693_100044023 | 199 |
| 248 | 3300025916 | Ga0207663_10007931 | Ga0207663_100079313 | 199 |
| 249 | 3300025929 | Ga0207664_10068339 | Ga0207664_100683393 | 199 |
| 250 | 3300025939 | Ga0207665_10353646 | Ga0207665_103536461 | 199 |
| 251 | 3300026116 | Ga0207674_10180152 | Ga0207674_101801522 | 199 |
| 252 | 3300026142 | Ga0207698_10672089 | Ga0207698_106720892 | 199 |
| 253 | 3300028556 | Ga0265337_1019818 | Ga0265337_10198182 | 199 |
| 254 | 3300031241 | Ga0265325_10000030 | Ga0265325_1000003026 | 199 |
| 255 | 3300031595 | Ga0265313_10006110 | Ga0265313_1000611010 | 199 |
| 256 | 3300031595 | Ga0265313_10082256 | Ga0265313_100822562 | 199 |
| 257 | 3300035118 | Ga0373954_0003581 | Ga0373954_0003581_4708_5541 | 199 |
| 258 | 3300035118 | Ga0373954_0104203 | Ga0373954_0104203_190_1008 | 199 |
| 259 | 3300035119 | Ga0373956_0040778 | Ga0373956_0040778_428_1261 | 199 |
| 260 | 3300035172 | Ga0373955_0070304 | Ga0373955_0070304_691_1509 | 199 |
| 261 | 3300035410 | Ga0373924_0022179 | Ga0373924_0022179_1346_2164 | 199 |
| 262 | 3300035695 | Ga0373927_0283154 | Ga0373927_0283154_126_944 | 199 |
| 263 | 3300035724 | Ga0373933_0035906 | Ga0373933_0035906_1507_2325 | 199 |
| 264 | 3300035725 | Ga0373947_0069790 | Ga0373947_0069790_1278_2096 | 199 |
| 265 | 3300036401 | Ga0373937_0002931 | Ga0373937_0002931_11326_12144 | 199 |
| 266 | 3300037068 | Ga0373925_0001686 | Ga0373925_0001686_12067_12885 | 199 |
| 267 | 3300037853 | Ga0436364_1441472 | Ga0436364_1441472_2514_3239 | 199 |
| 268 | 3300042156 | Ga0439446_0063715 | Ga0439446_0063715_221_946 | 199 |
| 269 | 3300042438 | Ga0439459_0015823 | Ga0439459_0015823_105_830 | 199 |
| 270 | 3300046462 | Ga0495651_0220127 | Ga0495651_0220127_79_897 | 199 |
| 271 | 3300046463 | Ga0495653_0239184 | Ga0495653_0239184_365_1183 | 199 |
| 272 | 3300046511 | Ga0495608_0105750 | Ga0495608_0105750_1035_1790 | 199 |
| 273 | 3300046529 | Ga0495652_0011840 | Ga0495652_0011840_2215_3033 | 199 |
| 274 | 3300046536 | Ga0495587_0021036 | Ga0495587_0021036_820_1638 | 199 |
| 275 | 3300046543 | Ga0495645_0002634 | Ga0495645_0002634_9793_10611 | 199 |
| 276 | 3300046559 | Ga0495667_0011221 | Ga0495667_0011221_496_1314 | 199 |
| 277 | 3300046678 | Ga0495599_0191987 | Ga0495599_0191987_282_1100 | 199 |
| 278 | 3300046809 | Ga0495600_0002491 | Ga0495600_0002491_2920_3738 | 199 |
| 279 | 3300046809 | Ga0495600_0019514 | Ga0495600_0019514_1664_2497 | 199 |
| 280 | 3300047319 | Ga0495674_0059871 | Ga0495674_0059871_2125_2943 | 199 |
| 281 | 3300047322 | Ga0495680_0008836 | Ga0495680_0008836_6286_7104 | 199 |
| 282 | 3300048088 | Ga0495602_0012468 | Ga0495602_0012468_3097_3915 | 199 |
| 283 | 3300048088 | Ga0495602_0025567 | Ga0495602_0025567_4181_5014 | 199 |
| 284 | 3300048907 | Ga0496104_0000065 | Ga0496104_0000065_92829_93650 | 199 |
| 285 | 3300048908 | Ga0496105_0000170 | Ga0496105_0000170_35067_35888 | 199 |
| 286 | 3300049572 | Ga0501036_0006023 | Ga0501036_0006023_5986_6735 | 199 |
| 287 | 3300049574 | Ga0501038_0018527 | Ga0501038_0018527_465_1214 | 199 |
| 288 | 3300049578 | Ga0501042_0011666 | Ga0501042_0011666_2915_3664 | 199 |
| 289 | 3300049580 | Ga0501046_0010184 | Ga0501046_0010184_1737_2486 | 199 |
| 290 | 3300049583 | Ga0501067_0006870 | Ga0501067_0006870_718_1467 | 199 |
| 291 | 3300049584 | Ga0501068_0005646 | Ga0501068_0005646_352_1101 | 199 |
| 292 | 3300049588 | Ga0501072_0385604 | Ga0501072_0385604_105_854 | 199 |
| 293 | 3300049744 | Ga0501083_0015876 | Ga0501083_0015876_1453_2202 | 199 |
| 294 | 3300049824 | Ga0501045_0060639 | Ga0501045_0060639_1924_2673 | 199 |
| 295 | 3300050512 | nmdc:mga0n895_670434_c1 | nmdc:mga0n895_670434_c1_179_964 | 199 |
| 296 | 3300053077 | Ga0495601_0000225 | Ga0495601_0000225_27817_28635 | 199 |
| 297 | 3300053078 | Ga0495612_0000405 | Ga0495612_0000405_4668_5486 | 199 |
| 298 | 3300053085 | Ga0495619_0001284 | Ga0495619_0001284_13681_14499 | 199 |
| 299 | 3300060353 | Ga0501082_0022695 | Ga0501082_0022695_4453_5202 | 199 |
| 300 | 3300002077 | JGI24744J21845_10001065 | JGI24744J21845_100010652 | 200 |
| 301 | 3300005329 | Ga0070683_100281939 | Ga0070683_1002819392 | 200 |
| 302 | 3300005330 | Ga0070690_100046888 | Ga0070690_1000468882 | 200 |
| 303 | 3300005331 | Ga0070670_100003926 | Ga0070670_10000392610 | 200 |
| 304 | 3300005333 | Ga0070677_10001233 | Ga0070677_100012332 | 200 |
| 305 | 3300005336 | Ga0070680_100075581 | Ga0070680_1000755812 | 200 |
| 306 | 3300005337 | Ga0070682_100031300 | Ga0070682_1000313005 | 200 |
| 307 | 3300005343 | Ga0070687_100014500 | Ga0070687_1000145005 | 200 |
| 308 | 3300005344 | Ga0070661_100027394 | Ga0070661_1000273944 | 200 |
| 309 | 3300005345 | Ga0070692_10286820 | Ga0070692_102868201 | 200 |
| 310 | 3300005364 | Ga0070673_100368996 | Ga0070673_1003689962 | 200 |
| 311 | 3300005367 | Ga0070667_100066283 | Ga0070667_1000662833 | 200 |
| 312 | 3300005367 | Ga0070667_100143734 | Ga0070667_1001437342 | 200 |
| 313 | 3300005435 | Ga0070714_100105676 | Ga0070714_1001056762 | 200 |
| 314 | 3300005437 | Ga0070710_10180439 | Ga0070710_101804392 | 200 |
| 315 | 3300005440 | Ga0070705_100409269 | Ga0070705_1004092691 | 200 |
| 316 | 3300005455 | Ga0070663_100147422 | Ga0070663_1001474222 | 200 |
| 317 | 3300005456 | Ga0070678_100041566 | Ga0070678_1000415664 | 200 |
| 318 | 3300005458 | Ga0070681_10113759 | Ga0070681_101137591 | 200 |
| 319 | 3300005458 | Ga0070681_10221895 | Ga0070681_102218952 | 200 |
| 320 | 3300005458 | Ga0070681_10590887 | Ga0070681_105908871 | 200 |
| 321 | 3300005459 | Ga0068867_100100804 | Ga0068867_1001008041 | 200 |
| 322 | 3300005466 | Ga0070685_10039316 | Ga0070685_100393162 | 200 |
| 323 | 3300005530 | Ga0070679_100098270 | Ga0070679_1000982703 | 200 |
| 324 | 3300005530 | Ga0070679_100123213 | Ga0070679_1001232133 | 200 |
| 325 | 3300005536 | Ga0070697_100195748 | Ga0070697_1001957483 | 200 |
| 326 | 3300005547 | Ga0070693_100264491 | Ga0070693_1002644912 | 200 |
| 327 | 3300005549 | Ga0070704_100543810 | Ga0070704_1005438101 | 200 |
| 328 | 3300005563 | Ga0068855_100095501 | Ga0068855_1000955015 | 200 |
| 329 | 3300005564 | Ga0070664_100057416 | Ga0070664_1000574163 | 200 |
| 330 | 3300005564 | Ga0070664_100158450 | Ga0070664_1001584502 | 200 |
| 331 | 3300005577 | Ga0068857_100002095 | Ga0068857_1000020952 | 200 |
| 332 | 3300005614 | Ga0068856_100046052 | Ga0068856_1000460522 | 200 |
| 333 | 3300005617 | Ga0068859_100524464 | Ga0068859_1005244642 | 200 |
| 334 | 3300005618 | Ga0068864_100001534 | Ga0068864_1000015346 | 200 |
| 335 | 3300005718 | Ga0068866_10002030 | Ga0068866_1000203010 | 200 |
| 336 | 3300005840 | Ga0068870_10013282 | Ga0068870_100132823 | 200 |
| 337 | 3300005841 | Ga0068863_100135924 | Ga0068863_1001359243 | 200 |
| 338 | 3300005844 | Ga0068862_100004584 | Ga0068862_1000045841 | 200 |
| 339 | 3300005937 | Ga0081455_10008649 | Ga0081455_100086497 | 200 |
| 340 | 3300006028 | Ga0070717_10235308 | Ga0070717_102353082 | 200 |
| 341 | 3300006058 | Ga0075432_10027156 | Ga0075432_100271562 | 200 |
| 342 | 3300006173 | Ga0070716_100047671 | Ga0070716_1000476713 | 200 |
| 343 | 3300006175 | Ga0070712_100320766 | Ga0070712_1003207662 | 200 |
| 344 | 3300006178 | Ga0075367_10065237 | Ga0075367_100652372 | 200 |
| 345 | 3300006186 | Ga0075369_10012816 | Ga0075369_100128164 | 200 |
| 346 | 3300006237 | Ga0097621_100013993 | Ga0097621_1000139937 | 200 |
| 347 | 3300006353 | Ga0075370_10037259 | Ga0075370_100372593 | 200 |
| 348 | 3300006353 | Ga0075370_10262368 | Ga0075370_102623681 | 200 |
| 349 | 3300006358 | Ga0068871_100018875 | Ga0068871_1000188754 | 200 |
| 350 | 3300006871 | Ga0075434_100001333 | Ga0075434_10000133325 | 200 |
| 351 | 3300006871 | Ga0075434_100286635 | Ga0075434_1002866352 | 200 |
| 352 | 3300006881 | Ga0068865_100099074 | Ga0068865_1000990743 | 200 |
| 353 | 3300006881 | Ga0068865_100281288 | Ga0068865_1002812882 | 200 |
| 354 | 3300006914 | Ga0075436_100188824 | Ga0075436_1001888241 | 200 |
| 355 | 3300006931 | Ga0097620_100524507 | Ga0097620_1005245072 | 200 |
| 356 | 3300007076 | Ga0075435_100095474 | Ga0075435_1000954743 | 200 |
| 357 | 3300009093 | Ga0105240_10069867 | Ga0105240_100698673 | 200 |
| 358 | 3300009101 | Ga0105247_10029287 | Ga0105247_100292875 | 200 |
| 359 | 3300009148 | Ga0105243_10116370 | Ga0105243_101163702 | 200 |
| 360 | 3300009148 | Ga0105243_10242456 | Ga0105243_102424562 | 200 |
| 361 | 3300009174 | Ga0105241_10012966 | Ga0105241_100129662 | 200 |
| 362 | 3300009176 | Ga0105242_10181924 | Ga0105242_101819242 | 200 |
| 363 | 3300009176 | Ga0105242_10206864 | Ga0105242_102068642 | 200 |
| 364 | 3300009545 | Ga0105237_10067254 | Ga0105237_100672545 | 200 |
| 365 | 3300009551 | Ga0105238_10136040 | Ga0105238_101360403 | 200 |
| 366 | 3300009553 | Ga0105249_10119394 | Ga0105249_101193941 | 200 |
| 367 | 3300010375 | Ga0105239_10109546 | Ga0105239_101095462 | 200 |
| 368 | 3300012473 | Ga0157340_1001339 | Ga0157340_10013391 | 200 |
| 369 | 3300013104 | Ga0157370_10058433 | Ga0157370_100584333 | 200 |
| 370 | 3300013105 | Ga0157369_11094281 | Ga0157369_110942811 | 200 |
| 371 | 3300013296 | Ga0157374_10272671 | Ga0157374_102726712 | 200 |
| 372 | 3300013297 | Ga0157378_10069624 | Ga0157378_100696243 | 200 |
| 373 | 3300014325 | Ga0163163_10001710 | Ga0163163_1000171020 | 200 |
| 374 | 3300014497 | Ga0182008_10096947 | Ga0182008_100969471 | 200 |
| 375 | 3300014745 | Ga0157377_10003804 | Ga0157377_100038047 | 200 |
| 376 | 3300014968 | Ga0157379_10190381 | Ga0157379_101903813 | 200 |
| 377 | 3300014969 | Ga0157376_10008671 | Ga0157376_100086718 | 200 |
| 378 | 3300014969 | Ga0157376_10037869 | Ga0157376_100378693 | 200 |
| 379 | 3300017792 | Ga0163161_10001476 | Ga0163161_100014762 | 200 |
| 380 | 3300017792 | Ga0163161_10065350 | Ga0163161_100653504 | 200 |
| 381 | 3300025290 | Ga0207673_1000232 | Ga0207673_10002326 | 200 |
| 382 | 3300025315 | Ga0207697_10002797 | Ga0207697_100027974 | 200 |
| 383 | 3300025885 | Ga0207653_10014160 | Ga0207653_100141604 | 200 |
| 384 | 3300025893 | Ga0207682_10000056 | Ga0207682_1000005631 | 200 |
| 385 | 3300025898 | Ga0207692_10011767 | Ga0207692_100117672 | 200 |
| 386 | 3300025898 | Ga0207692_10103770 | Ga0207692_101037701 | 200 |
| 387 | 3300025900 | Ga0207710_10001206 | Ga0207710_100012062 | 200 |
| 388 | 3300025900 | Ga0207710_10062498 | Ga0207710_100624982 | 200 |
| 389 | 3300025903 | Ga0207680_10006395 | Ga0207680_100063951 | 200 |
| 390 | 3300025904 | Ga0207647_10011486 | Ga0207647_100114862 | 200 |
| 391 | 3300025905 | Ga0207685_10052223 | Ga0207685_100522234 | 200 |
| 392 | 3300025906 | Ga0207699_10016764 | Ga0207699_100167644 | 200 |
| 393 | 3300025907 | Ga0207645_10000249 | Ga0207645_1000024910 | 200 |
| 394 | 3300025907 | Ga0207645_10076117 | Ga0207645_100761172 | 200 |
| 395 | 3300025908 | Ga0207643_10000187 | Ga0207643_1000018725 | 200 |
| 396 | 3300025909 | Ga0207705_10322986 | Ga0207705_103229861 | 200 |
| 397 | 3300025911 | Ga0207654_10141539 | Ga0207654_101415392 | 200 |
| 398 | 3300025911 | Ga0207654_10239987 | Ga0207654_102399871 | 200 |
| 399 | 3300025913 | Ga0207695_10354509 | Ga0207695_103545092 | 200 |
| 400 | 3300025914 | Ga0207671_10199873 | Ga0207671_101998733 | 200 |
| 401 | 3300025914 | Ga0207671_10381922 | Ga0207671_103819221 | 200 |
| 402 | 3300025915 | Ga0207693_10027666 | Ga0207693_100276663 | 200 |
| 403 | 3300025915 | Ga0207693_10308346 | Ga0207693_103083462 | 200 |
| 404 | 3300025916 | Ga0207663_10046657 | Ga0207663_100466574 | 200 |
| 405 | 3300025917 | Ga0207660_10007537 | Ga0207660_100075378 | 200 |
| 406 | 3300025918 | Ga0207662_10082578 | Ga0207662_100825782 | 200 |
| 407 | 3300025918 | Ga0207662_10347431 | Ga0207662_103474311 | 200 |
| 408 | 3300025919 | Ga0207657_10012303 | Ga0207657_100123033 | 200 |
| 409 | 3300025919 | Ga0207657_10036760 | Ga0207657_100367605 | 200 |
| 410 | 3300025920 | Ga0207649_10000852 | Ga0207649_100008526 | 200 |
| 411 | 3300025920 | Ga0207649_10063353 | Ga0207649_100633533 | 200 |
| 412 | 3300025921 | Ga0207652_10250411 | Ga0207652_102504111 | 200 |
| 413 | 3300025924 | Ga0207694_10174373 | Ga0207694_101743733 | 200 |
| 414 | 3300025924 | Ga0207694_10284615 | Ga0207694_102846151 | 200 |
| 415 | 3300025926 | Ga0207659_10001325 | Ga0207659_1000132520 | 200 |
| 416 | 3300025927 | Ga0207687_10018841 | Ga0207687_100188416 | 200 |
| 417 | 3300025927 | Ga0207687_10028412 | Ga0207687_100284124 | 200 |
| 418 | 3300025927 | Ga0207687_10168823 | Ga0207687_101688233 | 200 |
| 419 | 3300025928 | Ga0207700_10000623 | Ga0207700_100006233 | 200 |
| 420 | 3300025931 | Ga0207644_10008645 | Ga0207644_100086459 | 200 |
| 421 | 3300025931 | Ga0207644_10057454 | Ga0207644_100574544 | 200 |
| 422 | 3300025931 | Ga0207644_10118703 | Ga0207644_101187032 | 200 |
| 423 | 3300025932 | Ga0207690_10001793 | Ga0207690_1000179320 | 200 |
| 424 | 3300025933 | Ga0207706_10017303 | Ga0207706_100173032 | 200 |
| 425 | 3300025933 | Ga0207706_10041807 | Ga0207706_100418074 | 200 |
| 426 | 3300025934 | Ga0207686_10000898 | Ga0207686_100008985 | 200 |
| 427 | 3300025935 | Ga0207709_10003144 | Ga0207709_100031446 | 200 |
| 428 | 3300025935 | Ga0207709_10178383 | Ga0207709_101783833 | 200 |
| 429 | 3300025936 | Ga0207670_10018372 | Ga0207670_100183725 | 200 |
| 430 | 3300025938 | Ga0207704_10031431 | Ga0207704_100314312 | 200 |
| 431 | 3300025939 | Ga0207665_10001669 | Ga0207665_1000166918 | 200 |
| 432 | 3300025940 | Ga0207691_10042188 | Ga0207691_100421883 | 200 |
| 433 | 3300025940 | Ga0207691_10053344 | Ga0207691_100533445 | 200 |
| 434 | 3300025940 | Ga0207691_10352009 | Ga0207691_103520091 | 200 |
| 435 | 3300025941 | Ga0207711_10014151 | Ga0207711_100141518 | 200 |
| 436 | 3300025941 | Ga0207711_10041241 | Ga0207711_100412412 | 200 |
| 437 | 3300025941 | Ga0207711_10228839 | Ga0207711_102288393 | 200 |
| 438 | 3300025942 | Ga0207689_10007833 | Ga0207689_100078337 | 200 |
| 439 | 3300025944 | Ga0207661_10002538 | Ga0207661_100025386 | 200 |
| 440 | 3300025945 | Ga0207679_10000187 | Ga0207679_1000018725 | 200 |
| 441 | 3300025949 | Ga0207667_10082569 | Ga0207667_100825692 | 200 |
| 442 | 3300025960 | Ga0207651_10127001 | Ga0207651_101270013 | 200 |
| 443 | 3300025961 | Ga0207712_10006029 | Ga0207712_100060298 | 200 |
| 444 | 3300025986 | Ga0207658_10057325 | Ga0207658_100573253 | 200 |
| 445 | 3300025986 | Ga0207658_10065697 | Ga0207658_100656974 | 200 |
| 446 | 3300025986 | Ga0207658_10095816 | Ga0207658_100958163 | 200 |
| 447 | 3300026023 | Ga0207677_10372145 | Ga0207677_103721452 | 200 |
| 448 | 3300026023 | Ga0207677_10714629 | Ga0207677_107146291 | 200 |
| 449 | 3300026035 | Ga0207703_10087739 | Ga0207703_100877394 | 200 |
| 450 | 3300026041 | Ga0207639_10089022 | Ga0207639_100890223 | 200 |
| 451 | 3300026067 | Ga0207678_10007624 | Ga0207678_1000762411 | 200 |
| 452 | 3300026067 | Ga0207678_10015613 | Ga0207678_1001561310 | 200 |
| 453 | 3300026067 | Ga0207678_10043789 | Ga0207678_100437894 | 200 |
| 454 | 3300026078 | Ga0207702_10830076 | Ga0207702_108300761 | 200 |
| 455 | 3300026088 | Ga0207641_10143683 | Ga0207641_101436832 | 200 |
| 456 | 3300026088 | Ga0207641_10640019 | Ga0207641_106400192 | 200 |
| 457 | 3300026089 | Ga0207648_10001031 | Ga0207648_1000103111 | 200 |
| 458 | 3300026089 | Ga0207648_10174077 | Ga0207648_101740771 | 200 |
| 459 | 3300026095 | Ga0207676_10134624 | Ga0207676_101346242 | 200 |
| 460 | 3300026095 | Ga0207676_10333146 | Ga0207676_103331462 | 200 |
| 461 | 3300026116 | Ga0207674_10000686 | Ga0207674_1000068645 | 200 |
| 462 | 3300026118 | Ga0207675_100048378 | Ga0207675_1000483784 | 200 |
| 463 | 3300026121 | Ga0207683_10000727 | Ga0207683_100007273 | 200 |
| 464 | 3300026121 | Ga0207683_10004115 | Ga0207683_1000411518 | 200 |
| 465 | 3300026121 | Ga0207683_10041162 | Ga0207683_100411624 | 200 |
| 466 | 3300027614 | Ga0209970_1002946 | Ga0209970_10029463 | 200 |
| 467 | 3300027665 | Ga0209983_1001199 | Ga0209983_10011994 | 200 |
| 468 | 3300027682 | Ga0209971_1001243 | Ga0209971_10012436 | 200 |
| 469 | 3300027695 | Ga0209966_1000714 | Ga0209966_10007143 | 200 |
| 470 | 3300027717 | Ga0209998_10064008 | Ga0209998_100640081 | 200 |
| 471 | 3300027717 | Ga0209998_10067826 | Ga0209998_100678261 | 200 |
| 472 | 3300027866 | Ga0209813_10011774 | Ga0209813_100117743 | 200 |
| 473 | 3300027876 | Ga0209974_10010473 | Ga0209974_100104732 | 200 |
| 474 | 3300027907 | Ga0207428_10000150 | Ga0207428_1000015099 | 200 |
| 475 | 3300027907 | Ga0207428_10000360 | Ga0207428_1000036024 | 200 |
| 476 | 3300027907 | Ga0207428_10000556 | Ga0207428_100005568 | 200 |
| 477 | 3300028379 | Ga0268266_10004404 | Ga0268266_1000440415 | 200 |
| 478 | 3300028379 | Ga0268266_10281305 | Ga0268266_102813052 | 200 |
| 479 | 3300028380 | Ga0268265_10000526 | Ga0268265_100005266 | 200 |
| 480 | 3300028381 | Ga0268264_10002038 | Ga0268264_100020386 | 200 |
| 481 | 3300028381 | Ga0268264_10122323 | Ga0268264_101223233 | 200 |
| 482 | 3300031238 | Ga0265332_10000812 | Ga0265332_100008124 | 200 |
| 483 | 3300031247 | Ga0265340_10002134 | Ga0265340_100021347 | 200 |
| 484 | 3300031249 | Ga0265339_10000669 | Ga0265339_1000066930 | 200 |
| 485 | 3300031250 | Ga0265331_10194498 | Ga0265331_101944981 | 200 |
| 486 | 3300031456 | Ga0307513_10143091 | Ga0307513_101430913 | 200 |
| 487 | 3300031691 | Ga0316579_10027180 | Ga0316579_100271803 | 200 |
| 488 | 3300031712 | Ga0265342_10000281 | Ga0265342_1000028112 | 200 |
| 489 | 3300034816 | Ga0373930_0000129 | Ga0373930_0000129_1305_2132 | 200 |
| 490 | 3300034816 | Ga0373930_0003062 | Ga0373930_0003062_306_1067 | 200 |
| 491 | 3300034817 | Ga0373948_0007773 | Ga0373948_0007773_585_1412 | 200 |
| 492 | 3300034818 | Ga0373950_0000820 | Ga0373950_0000820_187_1014 | 200 |
| 493 | 3300034820 | Ga0373959_0001750 | Ga0373959_0001750_922_1749 | 200 |
| 494 | 3300034820 | Ga0373959_0001950 | Ga0373959_0001950_2227_2988 | 200 |
| 495 | 3300034957 | Ga0373938_0002546 | Ga0373938_0002546_1681_2505 | 200 |
| 496 | 3300034957 | Ga0373938_0006708 | Ga0373938_0006708_965_1726 | 200 |
| 497 | 3300035083 | Ga0373926_0006649 | Ga0373926_0006649_2481_3242 | 200 |
| 498 | 3300035083 | Ga0373926_0023880 | Ga0373926_0023880_163_924 | 200 |
| 499 | 3300035083 | Ga0373926_0032415 | Ga0373926_0032415_349_1173 | 200 |
| 500 | 3300035084 | Ga0373928_0000375 | Ga0373928_0000375_2762_3589 | 200 |
| 501 | 3300035085 | Ga0373929_0000146 | Ga0373929_0000146_5818_6645 | 200 |
| 502 | 3300035085 | Ga0373929_0001869 | Ga0373929_0001869_434_1195 | 200 |
| 503 | 3300035088 | Ga0373940_0008049 | Ga0373940_0008049_423_1250 | 200 |
| 504 | 3300035088 | Ga0373940_0058780 | Ga0373940_0058780_89_850 | 200 |
| 505 | 3300035089 | Ga0373944_0005274 | Ga0373944_0005274_1225_1986 | 200 |
| 506 | 3300035089 | Ga0373944_0006918 | Ga0373944_0006918_1260_2084 | 200 |
| 507 | 3300035089 | Ga0373944_0015430 | Ga0373944_0015430_29_790 | 200 |
| 508 | 3300035090 | Ga0373949_0010201 | Ga0373949_0010201_270_1031 | 200 |
| 509 | 3300035091 | Ga0373951_0000214 | Ga0373951_0000214_5438_6265 | 200 |
| 510 | 3300035092 | Ga0373952_0001494 | Ga0373952_0001494_1326_2087 | 200 |
| 511 | 3300035111 | Ga0373923_0000187 | Ga0373923_0000187_1550_2311 | 200 |
| 512 | 3300035112 | Ga0373932_0000473 | Ga0373932_0000473_146_973 | 200 |
| 513 | 3300035112 | Ga0373932_0000584 | Ga0373932_0000584_7638_8399 | 200 |
| 514 | 3300035114 | Ga0373939_0000602 | Ga0373939_0000602_2601_3428 | 200 |
| 515 | 3300035114 | Ga0373939_0003756 | Ga0373939_0003756_1821_2579 | 200 |
| 516 | 3300035115 | Ga0373941_0004906 | Ga0373941_0004906_1633_2394 | 200 |
| 517 | 3300035116 | Ga0373945_0000395 | Ga0373945_0000395_1410_2171 | 200 |
| 518 | 3300035116 | Ga0373945_0003626 | Ga0373945_0003626_909_1733 | 200 |
| 519 | 3300035116 | Ga0373945_0040494 | Ga0373945_0040494_230_991 | 200 |
| 520 | 3300035117 | Ga0373953_0006040 | Ga0373953_0006040_985_1818 | 200 |
| 521 | 3300035118 | Ga0373954_0006846 | Ga0373954_0006846_2330_3154 | 200 |
| 522 | 3300035118 | Ga0373954_0103932 | Ga0373954_0103932_18_779 | 200 |
| 523 | 3300035119 | Ga0373956_0003765 | Ga0373956_0003765_32_856 | 200 |
| 524 | 3300035120 | Ga0373957_0019755 | Ga0373957_0019755_777_1601 | 200 |
| 525 | 3300035121 | Ga0373960_0001283 | Ga0373960_0001283_998_1759 | 200 |
| 526 | 3300035170 | Ga0373943_0003892 | Ga0373943_0003892_4959_5720 | 200 |
| 527 | 3300035170 | Ga0373943_0005034 | Ga0373943_0005034_4410_5234 | 200 |
| 528 | 3300035170 | Ga0373943_0008480 | Ga0373943_0008480_224_985 | 200 |
| 529 | 3300035170 | Ga0373943_0031860 | Ga0373943_0031860_572_1309 | 200 |
| 530 | 3300035171 | Ga0373946_0024257 | Ga0373946_0024257_1236_1973 | 200 |
| 531 | 3300035171 | Ga0373946_0074135 | Ga0373946_0074135_209_1033 | 200 |
| 532 | 3300035172 | Ga0373955_0024147 | Ga0373955_0024147_1821_2645 | 200 |
| 533 | 3300035172 | Ga0373955_0083295 | Ga0373955_0083295_364_1197 | 200 |
| 534 | 3300035172 | Ga0373955_0101614 | Ga0373955_0101614_711_1472 | 200 |
| 535 | 3300035207 | Ga0373942_0008104 | Ga0373942_0008104_134_895 | 200 |
| 536 | 3300035207 | Ga0373942_0017422 | Ga0373942_0017422_612_1439 | 200 |
| 537 | 3300035241 | Ga0373961_0000749 | Ga0373961_0000749_3187_4014 | 200 |
| 538 | 3300035691 | Ga0373931_0109680 | Ga0373931_0109680_44_868 | 200 |
| 539 | 3300035692 | Ga0373935_0004894 | Ga0373935_0004894_2298_3059 | 200 |
| 540 | 3300035692 | Ga0373935_0179646 | Ga0373935_0179646_224_985 | 200 |
| 541 | 3300035695 | Ga0373927_0006438 | Ga0373927_0006438_5833_6594 | 200 |
| 542 | 3300035695 | Ga0373927_0064286 | Ga0373927_0064286_806_1543 | 200 |
| 543 | 3300035695 | Ga0373927_0081759 | Ga0373927_0081759_224_985 | 200 |
| 544 | 3300035695 | Ga0373927_0095756 | Ga0373927_0095756_201_1025 | 200 |
| 545 | 3300035724 | Ga0373933_0001082 | Ga0373933_0001082_14061_14894 | 200 |
| 546 | 3300035724 | Ga0373933_0008751 | Ga0373933_0008751_354_1178 | 200 |
| 547 | 3300035724 | Ga0373933_0009814 | Ga0373933_0009814_1051_1812 | 200 |
| 548 | 3300035725 | Ga0373947_0001922 | Ga0373947_0001922_5134_5895 | 200 |
| 549 | 3300035725 | Ga0373947_0016251 | Ga0373947_0016251_2993_3730 | 200 |
| 550 | 3300035725 | Ga0373947_0040243 | Ga0373947_0040243_1931_2755 | 200 |
| 551 | 3300036401 | Ga0373937_0007191 | Ga0373937_0007191_4709_5542 | 200 |
| 552 | 3300037068 | Ga0373925_0009753 | Ga0373925_0009753_1694_2431 | 200 |
| 553 | 3300037068 | Ga0373925_0050437 | Ga0373925_0050437_224_985 | 200 |
| 554 | 3300041451 | Ga0451791_0612931 | Ga0451791_0612931_753_1472 | 200 |
| 555 | 3300041460 | Ga0451802_1957638 | Ga0451802_1957638_378_1097 | 200 |
| 556 | 3300041486 | Ga0451807_2314777 | Ga0451807_2314777_48_863 | 200 |
| 557 | 3300041498 | Ga0451841_0706006 | Ga0451841_0706006_287_1006 | 200 |
| 558 | 3300042016 | Ga0439463_012770 | Ga0439463_012770_939_1700 | 200 |
| 559 | 3300042876 | Ga0451577_0127376 | Ga0451577_0127376_145_972 | 200 |
| 560 | 3300045051 | Ga0451576_0018136 | Ga0451576_0018136_2418_3245 | 200 |
| 561 | 3300046455 | Ga0495603_0001272 | Ga0495603_0001272_11792_12553 | 200 |
| 562 | 3300046455 | Ga0495603_0082254 | Ga0495603_0082254_80_841 | 200 |
| 563 | 3300046459 | Ga0495629_0000026 | Ga0495629_0000026_118915_119676 | 200 |
| 564 | 3300046459 | Ga0495629_0015488 | Ga0495629_0015488_3365_4126 | 200 |
| 565 | 3300046459 | Ga0495629_0036259 | Ga0495629_0036259_604_1428 | 200 |
| 566 | 3300046461 | Ga0495641_0018469 | Ga0495641_0018469_1546_2307 | 200 |
| 567 | 3300046462 | Ga0495651_0017093 | Ga0495651_0017093_3227_3988 | 200 |
| 568 | 3300046462 | Ga0495651_0256863 | Ga0495651_0256863_262_1086 | 200 |
| 569 | 3300046462 | Ga0495651_0301221 | Ga0495651_0301221_112_879 | 200 |
| 570 | 3300046463 | Ga0495653_0017706 | Ga0495653_0017706_4838_5662 | 200 |
| 571 | 3300046463 | Ga0495653_0227717 | Ga0495653_0227717_134_895 | 200 |
| 572 | 3300046472 | Ga0495580_0013840 | Ga0495580_0013840_2119_2880 | 200 |
| 573 | 3300046472 | Ga0495580_0068647 | Ga0495580_0068647_753_1577 | 200 |
| 574 | 3300046473 | Ga0495582_0014383 | Ga0495582_0014383_2000_2761 | 200 |
| 575 | 3300046475 | Ga0495639_0006240 | Ga0495639_0006240_3104_3865 | 200 |
| 576 | 3300046475 | Ga0495639_0009341 | Ga0495639_0009341_1100_1924 | 200 |
| 577 | 3300046475 | Ga0495639_0024784 | Ga0495639_0024784_127_888 | 200 |
| 578 | 3300046476 | Ga0495662_0002967 | Ga0495662_0002967_61_822 | 200 |
| 579 | 3300046476 | Ga0495662_0086545 | Ga0495662_0086545_245_982 | 200 |
| 580 | 3300046477 | Ga0495664_0002862 | Ga0495664_0002862_5274_6035 | 200 |
| 581 | 3300046491 | Ga0495584_0040128 | Ga0495584_0040128_721_1545 | 200 |
| 582 | 3300046492 | Ga0495585_0002078 | Ga0495585_0002078_11556_12317 | 200 |
| 583 | 3300046499 | Ga0495594_0030525 | Ga0495594_0030525_1676_2500 | 200 |
| 584 | 3300046501 | Ga0495607_0004674 | Ga0495607_0004674_1587_2348 | 200 |
| 585 | 3300046507 | Ga0495606_0169337 | Ga0495606_0169337_103_822 | 200 |
| 586 | 3300046511 | Ga0495608_0003087 | Ga0495608_0003087_172_996 | 200 |
| 587 | 3300046511 | Ga0495608_0056482 | Ga0495608_0056482_1701_2462 | 200 |
| 588 | 3300046513 | Ga0495616_0038691 | Ga0495616_0038691_1467_2180 | 200 |
| 589 | 3300046514 | Ga0495618_0015090 | Ga0495618_0015090_2394_3155 | 200 |
| 590 | 3300046516 | Ga0495628_0019066 | Ga0495628_0019066_528_1352 | 200 |
| 591 | 3300046516 | Ga0495628_0090285 | Ga0495628_0090285_1488_2249 | 200 |
| 592 | 3300046517 | Ga0495630_0087010 | Ga0495630_0087010_1363_2100 | 200 |
| 593 | 3300046523 | Ga0495644_0000312 | Ga0495644_0000312_19623_20381 | 200 |
| 594 | 3300046526 | Ga0495666_0001337 | Ga0495666_0001337_7564_8325 | 200 |
| 595 | 3300046529 | Ga0495652_0022671 | Ga0495652_0022671_2546_3307 | 200 |
| 596 | 3300046529 | Ga0495652_0101928 | Ga0495652_0101928_1123_1947 | 200 |
| 597 | 3300046531 | Ga0495665_0006056 | Ga0495665_0006056_1295_2056 | 200 |
| 598 | 3300046531 | Ga0495665_0127196 | Ga0495665_0127196_77_901 | 200 |
| 599 | 3300046533 | Ga0495640_0006356 | Ga0495640_0006356_4189_4926 | 200 |
| 600 | 3300046535 | Ga0495586_0008435 | Ga0495586_0008435_3189_3950 | 200 |
| 601 | 3300046535 | Ga0495586_0008693 | Ga0495586_0008693_4442_5266 | 200 |
| 602 | 3300046536 | Ga0495587_0001048 | Ga0495587_0001048_10079_10903 | 200 |
| 603 | 3300046536 | Ga0495587_0199300 | Ga0495587_0199300_108_941 | 200 |
| 604 | 3300046537 | Ga0495598_0031147 | Ga0495598_0031147_135_896 | 200 |
| 605 | 3300046538 | Ga0495609_0020209 | Ga0495609_0020209_1708_2469 | 200 |
| 606 | 3300046543 | Ga0495645_0014085 | Ga0495645_0014085_3415_4239 | 200 |
| 607 | 3300046543 | Ga0495645_0087093 | Ga0495645_0087093_266_1027 | 200 |
| 608 | 3300046557 | Ga0495622_0016292 | Ga0495622_0016292_666_1427 | 200 |
| 609 | 3300046557 | Ga0495622_0092083 | Ga0495622_0092083_412_1236 | 200 |
| 610 | 3300046558 | Ga0495633_0001295 | Ga0495633_0001295_351_1112 | 200 |
| 611 | 3300046559 | Ga0495667_0003431 | Ga0495667_0003431_7466_8227 | 200 |
| 612 | 3300046559 | Ga0495667_0014036 | Ga0495667_0014036_4322_5146 | 200 |
| 613 | 3300046559 | Ga0495667_0039048 | Ga0495667_0039048_25_795 | 200 |
| 614 | 3300046615 | Ga0495656_0000338 | Ga0495656_0000338_1749_2510 | 200 |
| 615 | 3300046648 | Ga0495611_0102403 | Ga0495611_0102403_472_1233 | 200 |
| 616 | 3300046648 | Ga0495611_0162183 | Ga0495611_0162183_254_955 | 200 |
| 617 | 3300046663 | Ga0495635_0048853 | Ga0495635_0048853_124_885 | 200 |
| 618 | 3300046663 | Ga0495635_0144080 | Ga0495635_0144080_28_852 | 200 |
| 619 | 3300046665 | Ga0495661_0113218 | Ga0495661_0113218_384_1145 | 200 |
| 620 | 3300046674 | Ga0495588_0017196 | Ga0495588_0017196_139_900 | 200 |
| 621 | 3300046674 | Ga0495588_0030675 | Ga0495588_0030675_389_1213 | 200 |
| 622 | 3300046675 | Ga0495657_0051023 | Ga0495657_0051023_657_1490 | 200 |
| 623 | 3300046678 | Ga0495599_0405502 | Ga0495599_0405502_33_794 | 200 |
| 624 | 3300046679 | Ga0495623_0000394 | Ga0495623_0000394_23036_23860 | 200 |
| 625 | 3300046679 | Ga0495623_0030999 | Ga0495623_0030999_1381_2214 | 200 |
| 626 | 3300046680 | Ga0495646_0002685 | Ga0495646_0002685_7705_8466 | 200 |
| 627 | 3300046681 | Ga0495647_0002213 | Ga0495647_0002213_1823_2584 | 200 |
| 628 | 3300046681 | Ga0495647_0003379 | Ga0495647_0003379_1098_1922 | 200 |
| 629 | 3300046681 | Ga0495647_0005918 | Ga0495647_0005918_2978_3739 | 200 |
| 630 | 3300046683 | Ga0495658_0054247 | Ga0495658_0054247_535_1359 | 200 |
| 631 | 3300046684 | Ga0495669_0183046 | Ga0495669_0183046_31_855 | 200 |
| 632 | 3300046689 | Ga0495613_0040648 | Ga0495613_0040648_2611_3372 | 200 |
| 633 | 3300046689 | Ga0495613_0106636 | Ga0495613_0106636_1124_1948 | 200 |
| 634 | 3300046689 | Ga0495613_0122963 | Ga0495613_0122963_1052_1813 | 200 |
| 635 | 3300046690 | Ga0495624_0038263 | Ga0495624_0038263_1437_2198 | 200 |
| 636 | 3300046691 | Ga0495670_0000232 | Ga0495670_0000232_13431_14192 | 200 |
| 637 | 3300046809 | Ga0495600_0011998 | Ga0495600_0011998_55_879 | 200 |
| 638 | 3300046809 | Ga0495600_0014421 | Ga0495600_0014421_1969_2730 | 200 |
| 639 | 3300047315 | Ga0495581_0021531 | Ga0495581_0021531_1013_1774 | 200 |
| 640 | 3300047315 | Ga0495581_0027479 | Ga0495581_0027479_675_1499 | 200 |
| 641 | 3300047315 | Ga0495581_0150574 | Ga0495581_0150574_137_904 | 200 |
| 642 | 3300047317 | Ga0495604_0010035 | Ga0495604_0010035_1554_2315 | 200 |
| 643 | 3300047317 | Ga0495604_0105379 | Ga0495604_0105379_529_1362 | 200 |
| 644 | 3300047319 | Ga0495674_0009887 | Ga0495674_0009887_4772_5509 | 200 |
| 645 | 3300047321 | Ga0495676_0117383 | Ga0495676_0117383_819_1643 | 200 |
| 646 | 3300047321 | Ga0495676_0167932 | Ga0495676_0167932_101_862 | 200 |
| 647 | 3300047322 | Ga0495680_0009493 | Ga0495680_0009493_3244_4005 | 200 |
| 648 | 3300047322 | Ga0495680_0015460 | Ga0495680_0015460_3303_4127 | 200 |
| 649 | 3300047444 | Ga0495675_0001159 | Ga0495675_0001159_6245_7069 | 200 |
| 650 | 3300047444 | Ga0495675_0058767 | Ga0495675_0058767_1323_2084 | 200 |
| 651 | 3300047444 | Ga0495675_0060449 | Ga0495675_0060449_86_919 | 200 |
| 652 | 3300047471 | Ga0495684_0018338 | Ga0495684_0018338_584_1345 | 200 |
| 653 | 3300047673 | Ga0495593_0060211 | Ga0495593_0060211_967_1728 | 200 |
| 654 | 3300047673 | Ga0495593_0219300 | Ga0495593_0219300_121_882 | 200 |
| 655 | 3300048088 | Ga0495602_0001877 | Ga0495602_0001877_16615_17439 | 200 |
| 656 | 3300048088 | Ga0495602_0065563 | Ga0495602_0065563_809_1570 | 200 |
| 657 | 3300048089 | Ga0495614_0032344 | Ga0495614_0032344_38_799 | 200 |
| 658 | 3300048903 | Ga0496100_0080900 | Ga0496100_0080900_957_1781 | 200 |
| 659 | 3300048904 | Ga0496101_0003343 | Ga0496101_0003343_8913_9674 | 200 |
| 660 | 3300048904 | Ga0496101_0356708 | Ga0496101_0356708_63_887 | 200 |
| 661 | 3300048904 | Ga0496101_0469356 | Ga0496101_0469356_67_891 | 200 |
| 662 | 3300048905 | Ga0496102_0056996 | Ga0496102_0056996_36_797 | 200 |
| 663 | 3300048905 | Ga0496102_0401554 | Ga0496102_0401554_358_1182 | 200 |
| 664 | 3300048906 | Ga0496103_0000963 | Ga0496103_0000963_18987_19748 | 200 |
| 665 | 3300048906 | Ga0496103_0072687 | Ga0496103_0072687_558_1382 | 200 |
| 666 | 3300048907 | Ga0496104_0335672 | Ga0496104_0335672_263_1087 | 200 |
| 667 | 3300048907 | Ga0496104_0374549 | Ga0496104_0374549_559_1320 | 200 |
| 668 | 3300048909 | Ga0496106_0007782 | Ga0496106_0007782_4904_5728 | 200 |
| 669 | 3300048910 | Ga0496107_0077413 | Ga0496107_0077413_316_1077 | 200 |
| 670 | 3300048911 | Ga0496108_0001681 | Ga0496108_0001681_13318_14142 | 200 |
| 671 | 3300048911 | Ga0496108_0009662 | Ga0496108_0009662_1979_2743 | 200 |
| 672 | 3300048911 | Ga0496108_0012623 | Ga0496108_0012623_2476_3300 | 200 |
| 673 | 3300048911 | Ga0496108_0305784 | Ga0496108_0305784_329_1048 | 200 |
| 674 | 3300048912 | Ga0496109_0009805 | Ga0496109_0009805_4917_5741 | 200 |
| 675 | 3300048912 | Ga0496109_0010944 | Ga0496109_0010944_6982_7746 | 200 |
| 676 | 3300048912 | Ga0496109_0042701 | Ga0496109_0042701_1527_2288 | 200 |
| 677 | 3300048914 | Ga0496111_0002766 | Ga0496111_0002766_4929_5753 | 200 |
| 678 | 3300048914 | Ga0496111_0029265 | Ga0496111_0029265_793_1617 | 200 |
| 679 | 3300048914 | Ga0496111_0065887 | Ga0496111_0065887_1084_1845 | 200 |
| 680 | 3300048915 | Ga0496112_0021287 | Ga0496112_0021287_3749_4573 | 200 |
| 681 | 3300048915 | Ga0496112_0072154 | Ga0496112_0072154_466_1227 | 200 |
| 682 | 3300048916 | Ga0496113_0000329 | Ga0496113_0000329_3398_4222 | 200 |
| 683 | 3300048916 | Ga0496113_0054565 | Ga0496113_0054565_1821_2582 | 200 |
| 684 | 3300048917 | Ga0496114_0005283 | Ga0496114_0005283_486_1247 | 200 |
| 685 | 3300048918 | Ga0496115_0001117 | Ga0496115_0001117_1026_1787 | 200 |
| 686 | 3300048918 | Ga0496115_0051087 | Ga0496115_0051087_1578_2339 | 200 |
| 687 | 3300049569 | Ga0501032_0039459 | Ga0501032_0039459_251_961 | 200 |
| 688 | 3300049570 | Ga0501033_0016861 | Ga0501033_0016861_1446_2156 | 200 |
| 689 | 3300049571 | Ga0501034_0009382 | Ga0501034_0009382_5578_6336 | 200 |
| 690 | 3300049572 | Ga0501036_0190174 | Ga0501036_0190174_1006_1716 | 200 |
| 691 | 3300049573 | Ga0501037_0001187 | Ga0501037_0001187_12716_13474 | 200 |
| 692 | 3300049574 | Ga0501038_0243949 | Ga0501038_0243949_91_801 | 200 |
| 693 | 3300049575 | Ga0501039_0177062 | Ga0501039_0177062_51_761 | 200 |
| 694 | 3300049579 | Ga0501043_0001872 | Ga0501043_0001872_10633_11391 | 200 |
| 695 | 3300049579 | Ga0501043_0326338 | Ga0501043_0326338_147_857 | 200 |
| 696 | 3300049581 | Ga0501047_0010049 | Ga0501047_0010049_14_772 | 200 |
| 697 | 3300049581 | Ga0501047_0114621 | Ga0501047_0114621_131_841 | 200 |
| 698 | 3300049583 | Ga0501067_0099590 | Ga0501067_0099590_437_1264 | 200 |
| 699 | 3300049584 | Ga0501068_0003533 | Ga0501068_0003533_6986_7744 | 200 |
| 700 | 3300049585 | Ga0501069_0015022 | Ga0501069_0015022_22_765 | 200 |
| 701 | 3300049592 | Ga0501076_0196459 | Ga0501076_0196459_478_1302 | 200 |
| 702 | 3300049741 | Ga0501079_0366796 | Ga0501079_0366796_155_958 | 200 |
| 703 | 3300049742 | Ga0501080_0006329 | Ga0501080_0006329_6029_6787 | 200 |
| 704 | 3300049822 | Ga0501035_0020097 | Ga0501035_0020097_515_1225 | 200 |
| 705 | 3300049823 | Ga0501044_0009346 | Ga0501044_0009346_6684_7442 | 200 |
| 706 | 3300049823 | Ga0501044_0041488 | Ga0501044_0041488_1374_2084 | 200 |
| 707 | 3300050491 | nmdc:mga00v17_30150_c1 | nmdc:mga00v17_30150_c1_575_1345 | 200 |
| 708 | 3300050494 | nmdc:mga06z11_8072_c1 | nmdc:mga06z11_8072_c1_612_1373 | 200 |
| 709 | 3300050496 | nmdc:mga07m45_21541_c1 | nmdc:mga07m45_21541_c1_1671_2441 | 200 |
| 710 | 3300050496 | nmdc:mga07m45_24981_c1 | nmdc:mga07m45_24981_c1_1698_2522 | 200 |
| 711 | 3300050507 | nmdc:mga05p37_786_c1 | nmdc:mga05p37_786_c1_19953_20717 | 200 |
| 712 | 3300050508 | nmdc:mga09592_4641_c1 | nmdc:mga09592_4641_c1_7094_7858 | 200 |
| 713 | 3300050509 | nmdc:mga0qj67_537_c1 | nmdc:mga0qj67_537_c1_14565_15329 | 200 |
| 714 | 3300050510 | nmdc:mga06r32_121_c1 | nmdc:mga06r32_121_c1_14912_15676 | 200 |
| 715 | 3300050511 | nmdc:mga08y16_13767_c1 | nmdc:mga08y16_13767_c1_4652_5416 | 200 |
| 716 | 3300050511 | nmdc:mga08y16_224205_c1 | nmdc:mga08y16_224205_c1_51_812 | 200 |
| 717 | 3300050511 | nmdc:mga08y16_309_c1 | nmdc:mga08y16_309_c1_37893_38654 | 200 |
| 718 | 3300050511 | nmdc:mga08y16_3336_c1 | nmdc:mga08y16_3336_c1_10418_11245 | 200 |
| 719 | 3300050512 | nmdc:mga0n895_104_c1 | nmdc:mga0n895_104_c1_1964_2725 | 200 |
| 720 | 3300050512 | nmdc:mga0n895_409756_c1 | nmdc:mga0n895_409756_c1_267_1091 | 200 |
| 721 | 3300050513 | nmdc:mga0rr50_2087_c1 | nmdc:mga0rr50_2087_c1_1630_2394 | 200 |
| 722 | 3300050513 | nmdc:mga0rr50_23711_c1 | nmdc:mga0rr50_23711_c1_3103_3864 | 200 |
| 723 | 3300050514 | nmdc:mga08x19_178012_c1 | nmdc:mga08x19_178012_c1_289_1116 | 200 |
| 724 | 3300050515 | nmdc:mga0a205_121530_c1 | nmdc:mga0a205_121530_c1_41_868 | 200 |
| 725 | 3300050515 | nmdc:mga0a205_94045_c1 | nmdc:mga0a205_94045_c1_899_1663 | 200 |
| 726 | 3300053077 | Ga0495601_0011337 | Ga0495601_0011337_955_1779 | 200 |
| 727 | 3300053077 | Ga0495601_0066002 | Ga0495601_0066002_676_1509 | 200 |
| 728 | 3300053077 | Ga0495601_0283737 | Ga0495601_0283737_165_926 | 200 |
| 729 | 3300053084 | Ga0495595_0000616 | Ga0495595_0000616_4571_5395 | 200 |
| 730 | 3300053084 | Ga0495595_0003158 | Ga0495595_0003158_1952_2785 | 200 |
| 731 | 3300053085 | Ga0495619_0000360 | Ga0495619_0000360_25781_26542 | 200 |
| 732 | 3300053085 | Ga0495619_0004668 | Ga0495619_0004668_5002_5763 | 200 |
| 733 | 3300053085 | Ga0495619_0285443 | Ga0495619_0285443_146_970 | 200 |
| 734 | 3300053108 | Ga0500562_072749 | Ga0500562_072749_127_897 | 200 |
| 735 | 3300053117 | Ga0500593_002128 | Ga0500593_002128_2645_3334 | 200 |
| 736 | 3300054114 | Ga0501084_0012665 | Ga0501084_0012665_4360_5184 | 200 |
| 737 | 3300060353 | Ga0501082_0032432 | Ga0501082_0032432_3107_3865 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ysi-assembly1.cif.gz_R | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9498 | 5 | 97 |
| 6dnc-assembly1.cif.gz_Z | e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon | 0.9429 | 6 | 97 |
| 7m4v-assembly1.cif.gz_U | a. baumannii ribosome-eravacycline complex: 50s | 0.9406 | 5 | 97 |
| 6ogg-assembly1.cif.gz_v | 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). | 0.9377 | 4 | 97 |
| 7unw-assembly1.cif.gz_X | pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) | 0.9356 | 6 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MM89_88_176_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9371 | 100 | 186 | 2.170.120.20 |
| af_Q2G0S0_95_176_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9333 | 98 | 180 | 2.170.120.20 |
| af_P9WHB5_5_98_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.9286 | 3 | 97 | 2.40.240.10 |
| af_F4JPA3_178_267_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9239 | 103 | 187 | 2.170.120.20 |
| af_A0A0P0W059_2_141_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.9228 | 4 | 100 | 2.40.240.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529L0H0-F1-model_v4 | 50S ribosomal protein L25 | 0.9768 | 1 | 116 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A7W8EQU1-F1-model_v4 | 50S ribosomal protein L25 | 0.9749 | 1 | 98 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A4Q2XX94-F1-model_v4 | 50S ribosomal protein L25 | 0.9679 | 1 | 110 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A5J5I0L3-F1-model_v4 | Large ribosomal subunit protein bL25 (General stress protein CTC) | 0.9657 | 1 | 194 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A7W8EQU1-F1-model_v4 | 50S ribosomal protein L25 | 0.9653 | 1 | 98 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar