F478366

General Info

Members Datasets Scaffolds Average Seq Length
737 386 736 203

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221547|2643754966
Length 238
Sequence QNLKATVRPKAGKGASRAARFSGRVPGVVYGDNQSPLLVLLDHDELKQRIYAGRFTTTLYELDVDGKKHRVIPRDFQLDAIKDLPMHVDFLRVPEGATIRVKVAVHVLNGETAPGVKRGGAVNIVTHTINLECPADRIPRSIDVDIGDLDINHSKHLSDVKLPEGVRVLAQGDITLVTVVPPSGYAEELKQQAAAAASAAAAAAAPAAAAPATGGTAAPGAAPAAGAAPAAGAAPAKK

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
95 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
96 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
203 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
204 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
207 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
244 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
247 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
291 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
292 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
293 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
301 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
327 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
352 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
356 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
357 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
373 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
374 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
375 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
376 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
377 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
378 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
379 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0
Rhizoplane 5.29
Rhizosphere 89.69
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10001065 3300002077 Bacteria 5305
2 JGI24034J26672_10011273 3300002239 Bacteria 1337
3 Ga0070658_10045516 3300005327 Bacteria 3548
4 Ga0070658_10294924 3300005327 Bacteria 1382
5 Ga0070676_10110307 3300005328 Bacteria 1712
6 Ga0070683_100071308 3300005329 Bacteria 3242
7 Ga0070683_100281939 3300005329 Bacteria 1580
8 Ga0070690_100010169 3300005330 Bacteria 5466
9 Ga0070690_100046888 3300005330 Bacteria 2748
10 Ga0070670_100003926 3300005331 Bacteria 12402
11 Ga0070677_10001233 3300005333 Bacteria 8211
12 Ga0070666_10013033 3300005335 Bacteria 5264
13 Ga0070680_100025931 3300005336 Bacteria 4687
14 Ga0070680_100075581 3300005336 Bacteria 2773
15 Ga0070680_100320522 3300005336 Bacteria 1316
16 Ga0070682_100031300 3300005337 Bacteria 3217
17 Ga0070682_100211783 3300005337 Bacteria 1374
18 Ga0068868_100043832 3300005338 Bacteria 3495
19 Ga0070660_100021115 3300005339 Bacteria 4797
20 Ga0070687_100014500 3300005343 Bacteria 3540
21 Ga0070661_100027394 3300005344 Bacteria 4103
22 Ga0070661_100135390 3300005344 Bacteria 1853
23 Ga0070692_10286820 3300005345 Bacteria 1000
24 Ga0070675_100149359 3300005354 Bacteria 2002
25 Ga0070671_100067499 3300005355 Bacteria 2982
26 Ga0070674_100058922 3300005356 Bacteria 2671
27 Ga0070673_100022646 3300005364 Bacteria 4576
28 Ga0070673_100368996 3300005364 Bacteria 1278
29 Ga0070688_100015921 3300005365 Bacteria 4288
30 Ga0070659_100065802 3300005366 Bacteria 2871
31 Ga0070659_100078059 3300005366 Bacteria 2642
32 Ga0070667_100049507 3300005367 Bacteria 3539
33 Ga0070667_100066283 3300005367 Bacteria 3067
34 Ga0070667_100143734 3300005367 Bacteria 2091
35 Ga0070709_10036741 3300005434 Bacteria 2987
36 Ga0070709_10039706 3300005434 Bacteria 2889
37 Ga0070709_10089638 3300005434 Bacteria 2025
38 Ga0070714_100038357 3300005435 Bacteria 4028
39 Ga0070714_100105676 3300005435 Bacteria 2486
40 Ga0070713_100233617 3300005436 Bacteria 1672
41 Ga0070713_100427347 3300005436 Bacteria 1241
42 Ga0070710_10127166 3300005437 Bacteria 1549
43 Ga0070710_10180439 3300005437 Bacteria 1321
44 Ga0070711_100285363 3300005439 Bacteria 1308
45 Ga0070705_100235401 3300005440 Bacteria 1276
46 Ga0070705_100409269 3300005440 Bacteria 1007
47 Ga0070700_100049650 3300005441 Bacteria 2606
48 Ga0070663_100016023 3300005455 Bacteria 4854
49 Ga0070663_100147422 3300005455 Bacteria 1801
50 Ga0070678_100041566 3300005456 Bacteria 3260
51 Ga0070681_10048764 3300005458 Bacteria 4231
52 Ga0070681_10113759 3300005458 Bacteria 2645
53 Ga0070681_10219210 3300005458 Bacteria 1818
54 Ga0070681_10221895 3300005458 Bacteria 1805
55 Ga0070681_10363512 3300005458 Bacteria 1357
56 Ga0070681_10590887 3300005458 Bacteria 1024
57 Ga0068867_100100804 3300005459 Bacteria 2205
58 Ga0068867_100119241 3300005459 Bacteria 2037
59 Ga0070685_10039316 3300005466 Bacteria 2686
60 Ga0070698_100313360 3300005471 Bacteria 1500
61 Ga0070679_100045107 3300005530 Bacteria 4392
62 Ga0070679_100074695 3300005530 Bacteria 3380
63 Ga0070679_100098270 3300005530 Bacteria 2915
64 Ga0070679_100123213 3300005530 Bacteria 2576
65 Ga0070697_100195748 3300005536 Bacteria 1717
66 Ga0070672_100107008 3300005543 Bacteria 2276
67 Ga0070686_100121230 3300005544 Bacteria 1796
68 Ga0070693_100132926 3300005547 Bacteria 1558
69 Ga0070693_100264491 3300005547 Bacteria 1145
70 Ga0070704_100543810 3300005549 Bacteria 1014
71 Ga0068855_100077098 3300005563 Bacteria 3867
72 Ga0068855_100095501 3300005563 Bacteria 3426
73 Ga0070664_100057416 3300005564 Bacteria 3309
74 Ga0070664_100158450 3300005564 Bacteria 2001
75 Ga0068857_100002095 3300005577 Bacteria 16205
76 Ga0068857_100137309 3300005577 Bacteria 2208
77 Ga0068856_100046052 3300005614 Bacteria 4296
78 Ga0068856_100046477 3300005614 Bacteria 4275
79 Ga0070702_100080387 3300005615 Bacteria 1950
80 Ga0068852_100106647 3300005616 Bacteria 2540
81 Ga0068859_100524464 3300005617 Bacteria 1279
82 Ga0068864_100001534 3300005618 Bacteria 19014
83 Ga0068864_100160002 3300005618 Bacteria 2046
84 Ga0068866_10002030 3300005718 Bacteria 8431
85 Ga0068866_10018406 3300005718 Bacteria 3159
86 Ga0068851_10089551 3300005834 Bacteria 1618
87 Ga0068870_10013282 3300005840 Bacteria 3868
88 Ga0068863_100135924 3300005841 Bacteria 2349
89 Ga0068858_100221902 3300005842 Bacteria 1790
90 Ga0068860_100348153 3300005843 Bacteria 1458
91 Ga0068860_100622998 3300005843 Bacteria 1085
92 Ga0068862_100004584 3300005844 Bacteria 11654
93 Ga0081455_10008649 3300005937 Bacteria 10552
94 Ga0081455_10024396 3300005937 Bacteria 5601
95 Ga0070717_10002945 3300006028 Bacteria 12093
96 Ga0070717_10041442 3300006028 Bacteria 3754
97 Ga0070717_10235308 3300006028 Bacteria 1614
98 Ga0075432_10004302 3300006058 Bacteria 4849
99 Ga0075432_10027156 3300006058 Bacteria 1970
100 Ga0070716_100047671 3300006173 Bacteria 2418
101 Ga0070716_100075159 3300006173 Bacteria 1999
102 Ga0070712_100320766 3300006175 Bacteria 1260
103 Ga0075362_10102872 3300006177 Bacteria 1337
104 Ga0075367_10065237 3300006178 Bacteria 2180
105 Ga0075367_10079858 3300006178 Bacteria 1977
106 Ga0075367_10206671 3300006178 Bacteria 1227
107 Ga0075369_10012816 3300006186 Bacteria 3315
108 Ga0075427_10000953 3300006194 Bacteria 3570
109 Ga0097621_100013993 3300006237 Bacteria 5993
110 Ga0097621_100015096 3300006237 Bacteria 5800
111 Ga0075370_10037259 3300006353 Bacteria 2734
112 Ga0075370_10194263 3300006353 Bacteria 1196
113 Ga0075370_10262368 3300006353 Bacteria 1025
114 Ga0068871_100018875 3300006358 Bacteria 5254
115 Ga0068871_100056437 3300006358 Bacteria 3192
116 Ga0075428_100004320 3300006844 Bacteria 15659
117 Ga0075430_100000275 3300006846 Bacteria 36030
118 Ga0075430_100000426 3300006846 Bacteria 31396
119 Ga0075431_100020560 3300006847 Bacteria 6745
120 Ga0075433_10000029 3300006852 Bacteria 55893
121 Ga0075433_10549952 3300006852 Bacteria 1015
122 Ga0075434_100000208 3300006871 Bacteria 39868
123 Ga0075434_100001333 3300006871 Bacteria 20677
124 Ga0075434_100286635 3300006871 Bacteria 1667
125 Ga0075429_100000734 3300006880 Bacteria 25672
126 Ga0068865_100099074 3300006881 Bacteria 2130
127 Ga0068865_100281288 3300006881 Bacteria 1325
128 Ga0075436_100029960 3300006914 Bacteria 3743
129 Ga0075436_100188824 3300006914 Bacteria 1458
130 Ga0075436_100315984 3300006914 Bacteria 1122
131 Ga0097620_100524507 3300006931 Bacteria 1279
132 Ga0075435_100046941 3300007076 Bacteria 3466
133 Ga0075435_100095474 3300007076 Bacteria 2459
134 Ga0105251_10005445 3300009011 Bacteria 8312
135 Ga0105240_10069867 3300009093 Bacteria 4346
136 Ga0105240_10109147 3300009093 Bacteria 3352
137 Ga0105240_10853712 3300009093 Bacteria 982
138 Ga0111539_10000345 3300009094 Bacteria 57093
139 Ga0111539_10108778 3300009094 Bacteria 3253
140 Ga0111539_10261937 3300009094 Bacteria 2013
141 Ga0105247_10029287 3300009101 Bacteria 3336
142 Ga0105247_10288663 3300009101 Bacteria 1134
143 Ga0114129_10003572 3300009147 Bacteria 21879
144 Ga0105243_10116370 3300009148 Bacteria 2246
145 Ga0105243_10156681 3300009148 Bacteria 1959
146 Ga0105243_10242456 3300009148 Bacteria 1605
147 Ga0105241_10012966 3300009174 Bacteria 6113
148 Ga0105242_10109212 3300009176 Bacteria 2355
149 Ga0105242_10181924 3300009176 Bacteria 1855
150 Ga0105242_10206864 3300009176 Bacteria 1746
151 Ga0105237_10034469 3300009545 Bacteria 5125
152 Ga0105237_10067254 3300009545 Bacteria 3577
153 Ga0105237_10100286 3300009545 Bacteria 2887
154 Ga0105238_10025119 3300009551 Bacteria 6072
155 Ga0105238_10028682 3300009551 Bacteria 5670
156 Ga0105238_10136040 3300009551 Bacteria 2435
157 Ga0105238_10475692 3300009551 Bacteria 1248
158 Ga0105249_10119394 3300009553 Bacteria 2504
159 Ga0105239_10109546 3300010375 Bacteria 3060
160 Ga0105246_10112198 3300011119 Bacteria 2005
161 Ga0157340_1001339 3300012473 Bacteria 1116
162 Ga0157339_1003319 3300012505 Bacteria 1154
163 Ga0157316_1006246 3300012510 Bacteria 971
164 Ga0157373_10164715 3300013100 Bacteria 1560
165 Ga0157371_10238339 3300013102 Bacteria 1308
166 Ga0157370_10056299 3300013104 Bacteria 3742
167 Ga0157370_10058433 3300013104 Bacteria 3666
168 Ga0157370_10202959 3300013104 Bacteria 1839
169 Ga0157369_10834923 3300013105 Bacteria 946
170 Ga0157369_11094281 3300013105 Bacteria 815
171 Ga0157374_10272671 3300013296 Bacteria 1669
172 Ga0157378_10069624 3300013297 Bacteria 3157
173 Ga0163162_11221534 3300013306 Bacteria 853
174 Ga0163163_10001710 3300014325 Bacteria 18534
175 Ga0157380_10065474 3300014326 Bacteria 2921
176 Ga0182008_10096947 3300014497 Bacteria 1455
177 Ga0157377_10003804 3300014745 Bacteria 6857
178 Ga0157379_10190381 3300014968 Bacteria 1854
179 Ga0157379_10380040 3300014968 Bacteria 1296
180 Ga0157376_10008671 3300014969 Bacteria 7351
181 Ga0157376_10037869 3300014969 Bacteria 3920
182 Ga0157376_10214471 3300014969 Bacteria 1779
183 Ga0163161_10001476 3300017792 Bacteria 17368
184 Ga0163161_10065350 3300017792 Bacteria 2655
185 Ga0213876_10047692 3300021384 Bacteria 2264
186 Ga0224572_1001585 3300024225 Bacteria 3417
187 Ga0228598_1014536 3300024227 Bacteria 1557
188 Ga0207673_1000232 3300025290 Bacteria 5664
189 Ga0207697_10002797 3300025315 Bacteria 8890
190 Ga0207653_10014160 3300025885 Bacteria 2501
191 Ga0207682_10000056 3300025893 Bacteria 48265
192 Ga0207692_10011767 3300025898 Bacteria 3737
193 Ga0207692_10032532 3300025898 Bacteria 2507
194 Ga0207692_10103770 3300025898 Bacteria 1566
195 Ga0207692_10193538 3300025898 Bacteria 1191
196 Ga0207710_10001206 3300025900 Bacteria 13122
197 Ga0207710_10062498 3300025900 Bacteria 1692
198 Ga0207680_10006395 3300025903 Bacteria 5695
199 Ga0207647_10011486 3300025904 Bacteria 6209
200 Ga0207685_10052223 3300025905 Bacteria 1583
201 Ga0207699_10016764 3300025906 Bacteria 3840
202 Ga0207699_10047203 3300025906 Bacteria 2524
203 Ga0207699_10187115 3300025906 Bacteria 1395
204 Ga0207645_10000249 3300025907 Bacteria 44921
205 Ga0207645_10076117 3300025907 Bacteria 2149
206 Ga0207643_10000187 3300025908 Bacteria 42567
207 Ga0207705_10322986 3300025909 Bacteria 1186
208 Ga0207705_10340141 3300025909 Bacteria 1155
209 Ga0207705_10468241 3300025909 Bacteria 978
210 Ga0207654_10141539 3300025911 Bacteria 1535
211 Ga0207654_10239987 3300025911 Bacteria 1211
212 Ga0207707_10035389 3300025912 Bacteria 4367
213 Ga0207707_10038851 3300025912 Bacteria 4160
214 Ga0207695_10169713 3300025913 Bacteria 2108
215 Ga0207695_10354509 3300025913 Bacteria 1354
216 Ga0207695_10571334 3300025913 Bacteria 1012
217 Ga0207671_10199873 3300025914 Bacteria 1561
218 Ga0207671_10381922 3300025914 Bacteria 1119
219 Ga0207693_10004402 3300025915 Bacteria 11913
220 Ga0207693_10027666 3300025915 Bacteria 4482
221 Ga0207693_10308346 3300025915 Bacteria 1239
222 Ga0207663_10007931 3300025916 Bacteria 5539
223 Ga0207663_10046657 3300025916 Bacteria 2670
224 Ga0207660_10007537 3300025917 Bacteria 7045
225 Ga0207660_10009967 3300025917 Bacteria 6155
226 Ga0207662_10082578 3300025918 Bacteria 1963
227 Ga0207662_10347431 3300025918 Bacteria 995
228 Ga0207657_10012303 3300025919 Bacteria 8456
229 Ga0207657_10036760 3300025919 Bacteria 4381
230 Ga0207657_10046279 3300025919 Bacteria 3812
231 Ga0207649_10000852 3300025920 Bacteria 19557
232 Ga0207649_10063353 3300025920 Bacteria 2334
233 Ga0207649_10147106 3300025920 Bacteria 1618
234 Ga0207652_10078097 3300025921 Bacteria 2889
235 Ga0207652_10100350 3300025921 Bacteria 2555
236 Ga0207652_10250411 3300025921 Bacteria 1597
237 Ga0207694_10018888 3300025924 Bacteria 5211
238 Ga0207694_10174373 3300025924 Bacteria 1742
239 Ga0207694_10284615 3300025924 Bacteria 1358
240 Ga0207659_10001325 3300025926 Bacteria 14791
241 Ga0207687_10018841 3300025927 Bacteria 4563
242 Ga0207687_10028412 3300025927 Bacteria 3757
243 Ga0207687_10168823 3300025927 Bacteria 1686
244 Ga0207700_10000623 3300025928 Bacteria 20712
245 Ga0207700_10136114 3300025928 Bacteria 2012
246 Ga0207664_10068339 3300025929 Bacteria 2854
247 Ga0207664_10550414 3300025929 Bacteria 1035
248 Ga0207644_10008645 3300025931 Bacteria 6659
249 Ga0207644_10057454 3300025931 Bacteria 2809
250 Ga0207644_10118703 3300025931 Bacteria 2010
251 Ga0207690_10001793 3300025932 Bacteria 13192
252 Ga0207706_10017303 3300025933 Bacteria 6495
253 Ga0207706_10041807 3300025933 Bacteria 4063
254 Ga0207686_10000898 3300025934 Bacteria 17933
255 Ga0207709_10003144 3300025935 Bacteria 9924
256 Ga0207709_10178383 3300025935 Bacteria 1498
257 Ga0207670_10018372 3300025936 Bacteria 4250
258 Ga0207704_10031431 3300025938 Bacteria 2991
259 Ga0207665_10001669 3300025939 Bacteria 14935
260 Ga0207665_10353646 3300025939 Bacteria 1109
261 Ga0207691_10042188 3300025940 Bacteria 4206
262 Ga0207691_10053344 3300025940 Bacteria 3691
263 Ga0207691_10352009 3300025940 Bacteria 1260
264 Ga0207711_10014151 3300025941 Bacteria 6628
265 Ga0207711_10041241 3300025941 Bacteria 3930
266 Ga0207711_10228839 3300025941 Bacteria 1702
267 Ga0207689_10007833 3300025942 Bacteria 9338
268 Ga0207661_10002538 3300025944 Bacteria 12565
269 Ga0207679_10000187 3300025945 Bacteria 49895
270 Ga0207667_10016532 3300025949 Bacteria 8334
271 Ga0207667_10082569 3300025949 Bacteria 3328
272 Ga0207651_10127001 3300025960 Bacteria 1945
273 Ga0207712_10006029 3300025961 Bacteria 7648
274 Ga0207640_10071065 3300025981 Bacteria 2343
275 Ga0207658_10057325 3300025986 Bacteria 2894
276 Ga0207658_10065697 3300025986 Bacteria 2726
277 Ga0207658_10095816 3300025986 Bacteria 2313
278 Ga0207677_10372145 3300026023 Bacteria 1203
279 Ga0207677_10714629 3300026023 Bacteria 890
280 Ga0207703_10087739 3300026035 Bacteria 2609
281 Ga0207639_10089022 3300026041 Bacteria 2465
282 Ga0207678_10007624 3300026067 Bacteria 9559
283 Ga0207678_10015613 3300026067 Bacteria 6677
284 Ga0207678_10043789 3300026067 Bacteria 3873
285 Ga0207702_10054324 3300026078 Bacteria 3394
286 Ga0207702_10830076 3300026078 Bacteria 914
287 Ga0207641_10143683 3300026088 Bacteria 2155
288 Ga0207641_10640019 3300026088 Bacteria 1044
289 Ga0207648_10001031 3300026089 Bacteria 31313
290 Ga0207648_10174077 3300026089 Bacteria 1903
291 Ga0207676_10134624 3300026095 Bacteria 2106
292 Ga0207676_10333146 3300026095 Bacteria 1397
293 Ga0207674_10000686 3300026116 Bacteria 44016
294 Ga0207674_10180152 3300026116 Bacteria 2064
295 Ga0207674_10694744 3300026116 Bacteria 982
296 Ga0207675_100048378 3300026118 Bacteria 3969
297 Ga0207683_10000727 3300026121 Bacteria 29910
298 Ga0207683_10004115 3300026121 Bacteria 12577
299 Ga0207683_10041162 3300026121 Bacteria 4033
300 Ga0207698_10672089 3300026142 Bacteria 1028
301 Ga0209970_1002946 3300027614 Bacteria 2871
302 Ga0209983_1001199 3300027665 Bacteria 5741
303 Ga0209971_1001243 3300027682 Bacteria 6384
304 Ga0209966_1000714 3300027695 Bacteria 7077
305 Ga0209998_10064008 3300027717 Bacteria 870
306 Ga0209998_10067826 3300027717 Bacteria 849
307 Ga0209813_10011774 3300027866 Bacteria 2295
308 Ga0209974_10010473 3300027876 Bacteria 3129
309 Ga0207428_10000150 3300027907 Bacteria 94699
310 Ga0207428_10000360 3300027907 Bacteria 58478
311 Ga0207428_10000556 3300027907 Bacteria 44098
312 Ga0268266_10004404 3300028379 Bacteria 13495
313 Ga0268266_10281305 3300028379 Bacteria 1547
314 Ga0268266_10666268 3300028379 Bacteria 1002
315 Ga0268265_10000526 3300028380 Bacteria 39043
316 Ga0268264_10002038 3300028381 Bacteria 18063
317 Ga0268264_10122323 3300028381 Bacteria 2295
318 Ga0268264_10557975 3300028381 Bacteria 1124
319 Ga0265337_1019818 3300028556 Bacteria 2115
320 Ga0265336_10043542 3300028666 Bacteria 1368
321 Ga0265338_10085845 3300028800 Bacteria 2622
322 Ga0265338_10115103 3300028800 Bacteria 2156
323 Ga0265330_10046345 3300031235 Bacteria 1915
324 Ga0265332_10000812 3300031238 Bacteria 18981
325 Ga0265332_10082336 3300031238 Bacteria 1365
326 Ga0265325_10000030 3300031241 Bacteria 103532
327 Ga0265325_10017849 3300031241 Bacteria 3941
328 Ga0265325_10108720 3300031241 Bacteria 1350
329 Ga0265340_10002134 3300031247 Bacteria 11343
330 Ga0265340_10005177 3300031247 Bacteria 7250
331 Ga0265340_10065466 3300031247 Bacteria 1730
332 Ga0265340_10099641 3300031247 Bacteria 1351
333 Ga0265339_10000669 3300031249 Bacteria 26471
334 Ga0265339_10008520 3300031249 Bacteria 6519
335 Ga0265339_10077030 3300031249 Bacteria 1767
336 Ga0265331_10194498 3300031250 Bacteria 914
337 Ga0307513_10143091 3300031456 Bacteria 2314
338 Ga0265313_10003681 3300031595 Bacteria 12245
339 Ga0265313_10006110 3300031595 Bacteria 8665
340 Ga0265313_10030904 3300031595 Bacteria 2751
341 Ga0265313_10082256 3300031595 Bacteria 1460
342 Ga0316579_10027180 3300031691 Bacteria 2596
343 Ga0265314_10004041 3300031711 Bacteria 13864
344 Ga0265314_10009643 3300031711 Bacteria 8132
345 Ga0265314_10030010 3300031711 Bacteria 4030
346 Ga0265314_10249456 3300031711 Bacteria 1020
347 Ga0265342_10000281 3300031712 Bacteria 57398
348 Ga0265342_10004069 3300031712 Bacteria 11662
349 Ga0265342_10110551 3300031712 Bacteria 1555
350 Ga0307415_100250089 3300032126 Bacteria 1440
351 Ga0316583_10000116 3300032133 Bacteria 18613
352 Ga0373930_0000129 3300034816 Bacteria 8362
353 Ga0373930_0003062 3300034816 Bacteria 2631
354 Ga0373948_0007773 3300034817 Bacteria 1812
355 Ga0373950_0000820 3300034818 Bacteria 3906
356 Ga0373959_0001750 3300034820 Bacteria 3469
357 Ga0373959_0001950 3300034820 Bacteria 3288
358 Ga0373938_0002546 3300034957 Bacteria 2941
359 Ga0373938_0006708 3300034957 Bacteria 2000
360 Ga0373926_0006649 3300035083 Bacteria 3838
361 Ga0373926_0023880 3300035083 Bacteria 2125
362 Ga0373926_0032415 3300035083 Bacteria 1843
363 Ga0373928_0000375 3300035084 Bacteria 8963
364 Ga0373929_0000146 3300035085 Bacteria 12154
365 Ga0373929_0001869 3300035085 Bacteria 3946
366 Ga0373940_0008049 3300035088 Bacteria 2404
367 Ga0373940_0058780 3300035088 Bacteria 1095
368 Ga0373944_0005274 3300035089 Bacteria 3400
369 Ga0373944_0006918 3300035089 Bacteria 3028
370 Ga0373944_0015430 3300035089 Bacteria 2144
371 Ga0373949_0010201 3300035090 Bacteria 2057
372 Ga0373951_0000214 3300035091 Bacteria 20411
373 Ga0373952_0001494 3300035092 Bacteria 4252
374 Ga0373923_0000187 3300035111 Bacteria 12538
375 Ga0373932_0000473 3300035112 Bacteria 12328
376 Ga0373932_0000584 3300035112 Bacteria 11134
377 Ga0373939_0000602 3300035114 Bacteria 8943
378 Ga0373939_0003756 3300035114 Bacteria 3579
379 Ga0373941_0004906 3300035115 Bacteria 3117
380 Ga0373945_0000395 3300035116 Bacteria 12509
381 Ga0373945_0003626 3300035116 Bacteria 4864
382 Ga0373945_0040494 3300035116 Bacteria 1682
383 Ga0373953_0006040 3300035117 Bacteria 3968
384 Ga0373954_0003581 3300035118 Bacteria 6602
385 Ga0373954_0006846 3300035118 Bacteria 4975
386 Ga0373954_0103932 3300035118 Bacteria 1371
387 Ga0373954_0104203 3300035118 Bacteria 1369
388 Ga0373956_0003765 3300035119 Bacteria 6107
389 Ga0373956_0040778 3300035119 Bacteria 2060
390 Ga0373957_0019755 3300035120 Bacteria 2374
391 Ga0373960_0001283 3300035121 Bacteria 5530
392 Ga0373943_0003892 3300035170 Bacteria 6797
393 Ga0373943_0005034 3300035170 Bacteria 5960
394 Ga0373943_0008480 3300035170 Bacteria 4610
395 Ga0373943_0031860 3300035170 Bacteria 2503
396 Ga0373946_0024257 3300035171 Bacteria 2375
397 Ga0373946_0074135 3300035171 Bacteria 1476
398 Ga0373955_0024147 3300035172 Bacteria 3105
399 Ga0373955_0070304 3300035172 Bacteria 1955
400 Ga0373955_0083295 3300035172 Bacteria 1811
401 Ga0373955_0101614 3300035172 Bacteria 1651
402 Ga0373942_0008104 3300035207 Bacteria 2444
403 Ga0373942_0017422 3300035207 Bacteria 1770
404 Ga0373961_0000749 3300035241 Bacteria 11204
405 Ga0373924_0022179 3300035410 Bacteria 2481
406 Ga0373931_0109680 3300035691 Bacteria 1564
407 Ga0373935_0004894 3300035692 Bacteria 7873
408 Ga0373935_0179646 3300035692 Bacteria 1452
409 Ga0373927_0006438 3300035695 Bacteria 8002
410 Ga0373927_0064286 3300035695 Bacteria 2373
411 Ga0373927_0081759 3300035695 Bacteria 2093
412 Ga0373927_0095756 3300035695 Bacteria 1929
413 Ga0373927_0283154 3300035695 Bacteria 1091
414 Ga0373933_0001082 3300035724 Bacteria 16333
415 Ga0373933_0008751 3300035724 Bacteria 5518
416 Ga0373933_0009814 3300035724 Bacteria 5238
417 Ga0373933_0035906 3300035724 Bacteria 2898
418 Ga0373933_0173498 3300035724 Bacteria 1373
419 Ga0373947_0001922 3300035725 Bacteria 12704
420 Ga0373947_0016251 3300035725 Bacteria 4277
421 Ga0373947_0040243 3300035725 Bacteria 2783
422 Ga0373947_0069790 3300035725 Bacteria 2152
423 Ga0373937_0002931 3300036401 Bacteria 14272
424 Ga0373937_0007191 3300036401 Bacteria 9629
425 Ga0373937_0124163 3300036401 Bacteria 2407
426 Ga0373925_0001686 3300037068 Bacteria 18583
427 Ga0373925_0009753 3300037068 Bacteria 6975
428 Ga0373925_0050437 3300037068 Bacteria 3103
429 Ga0395899_0006936 3300037312 Bacteria 8776
430 Ga0395899_0257309 3300037312 Bacteria 1195
431 Ga0395900_0012710 3300037418 Bacteria 8602
432 Ga0395900_0122362 3300037418 Bacteria 2669
433 Ga0395898_0012047 3300037466 Bacteria 8951
434 Ga0436364_0168099 3300037853 Bacteria 818
435 Ga0436364_1441472 3300037853 Bacteria 3831
436 Ga0395901_0007158 3300038443 Bacteria 11258
437 Ga0395901_0109021 3300038443 Bacteria 2906
438 Ga0436365_0769383 3300039437 Bacteria 9423
439 Ga0436365_0983586 3300039437 Bacteria 1050
440 Ga0436362_0869149 3300039453 Bacteria 2119
441 Ga0451791_0612931 3300041451 Bacteria 2017
442 Ga0451802_1957638 3300041460 Bacteria 1306
443 Ga0451807_2314777 3300041486 Bacteria 1759
444 Ga0451841_0706006 3300041498 Bacteria 1038
445 Ga0439463_012770 3300042016 Bacteria 2065
446 Ga0439446_0063715 3300042156 Bacteria 1118
447 Ga0439459_0015823 3300042438 Bacteria 1387
448 Ga0451577_0127376 3300042876 Bacteria 2282
449 Ga0466965_0113074 3300044683 Bacteria 1397
450 Ga0466965_0299891 3300044683 Bacteria 872
451 Ga0466963_0370252 3300044694 Bacteria 1009
452 Ga0451576_0018136 3300045051 Bacteria 7721
453 Ga0466967_0094290 3300045976 Bacteria 2725
454 Ga0495603_0001272 3300046455 Bacteria 14676
455 Ga0495603_0082254 3300046455 Bacteria 1886
456 Ga0495629_0000026 3300046459 Bacteria 134719
457 Ga0495629_0015488 3300046459 Bacteria 5474
458 Ga0495629_0036259 3300046459 Bacteria 3482
459 Ga0495638_0013371 3300046460 Bacteria 5590
460 Ga0495641_0018469 3300046461 Bacteria 3597
461 Ga0495651_0017093 3300046462 Bacteria 5621
462 Ga0495651_0220127 3300046462 Bacteria 1314
463 Ga0495651_0256863 3300046462 Bacteria 1190
464 Ga0495651_0301221 3300046462 Bacteria 1075
465 Ga0495653_0017706 3300046463 Bacteria 5793
466 Ga0495653_0227717 3300046463 Bacteria 1249
467 Ga0495653_0239184 3300046463 Bacteria 1211
468 Ga0495580_0013840 3300046472 Bacteria 6142
469 Ga0495580_0068647 3300046472 Bacteria 2478
470 Ga0495582_0014383 3300046473 Bacteria 4350
471 Ga0495639_0006240 3300046475 Bacteria 5120
472 Ga0495639_0009341 3300046475 Bacteria 4205
473 Ga0495639_0024784 3300046475 Bacteria 2642
474 Ga0495662_0002967 3300046476 Bacteria 8560
475 Ga0495662_0086545 3300046476 Bacteria 1526
476 Ga0495664_0002862 3300046477 Bacteria 9299
477 Ga0495664_0027670 3300046477 Bacteria 3307
478 Ga0495584_0040128 3300046491 Bacteria 2364
479 Ga0495585_0002078 3300046492 Bacteria 14696
480 Ga0495594_0030525 3300046499 Bacteria 2917
481 Ga0495607_0004674 3300046501 Bacteria 10022
482 Ga0495606_0169337 3300046507 Bacteria 1268
483 Ga0495608_0003087 3300046511 Bacteria 11890
484 Ga0495608_0041050 3300046511 Bacteria 3098
485 Ga0495608_0056482 3300046511 Bacteria 2592
486 Ga0495608_0105750 3300046511 Bacteria 1812
487 Ga0495616_0038691 3300046513 Bacteria 2448
488 Ga0495618_0015090 3300046514 Bacteria 4712
489 Ga0495628_0019066 3300046516 Bacteria 5673
490 Ga0495628_0073293 3300046516 Bacteria 2668
491 Ga0495628_0090285 3300046516 Bacteria 2372
492 Ga0495630_0026726 3300046517 Bacteria 4275
493 Ga0495630_0087010 3300046517 Bacteria 2360
494 Ga0495644_0000312 3300046523 Bacteria 22452
495 Ga0495666_0001337 3300046526 Bacteria 11947
496 Ga0495652_0011840 3300046529 Bacteria 7883
497 Ga0495652_0022671 3300046529 Bacteria 5571
498 Ga0495652_0026811 3300046529 Bacteria 5084
499 Ga0495652_0101928 3300046529 Bacteria 2326
500 Ga0495665_0006056 3300046531 Bacteria 6524
501 Ga0495665_0127196 3300046531 Bacteria 1334
502 Ga0495640_0006356 3300046533 Bacteria 9360
503 Ga0495586_0008435 3300046535 Bacteria 5484
504 Ga0495586_0008693 3300046535 Bacteria 5407
505 Ga0495587_0001048 3300046536 Bacteria 18208
506 Ga0495587_0021036 3300046536 Bacteria 4024
507 Ga0495587_0199300 3300046536 Bacteria 1132
508 Ga0495598_0031147 3300046537 Bacteria 1499
509 Ga0495609_0020209 3300046538 Bacteria 3078
510 Ga0495645_0002634 3300046543 Bacteria 12204
511 Ga0495645_0014085 3300046543 Bacteria 5667
512 Ga0495645_0087093 3300046543 Bacteria 2234
513 Ga0495645_0113346 3300046543 Bacteria 1917
514 Ga0495622_0016292 3300046557 Bacteria 3459
515 Ga0495622_0092083 3300046557 Bacteria 1392
516 Ga0495633_0001295 3300046558 Bacteria 19775
517 Ga0495667_0003431 3300046559 Bacteria 10630
518 Ga0495667_0011221 3300046559 Bacteria 6068
519 Ga0495667_0014036 3300046559 Bacteria 5408
520 Ga0495667_0039048 3300046559 Bacteria 3159
521 Ga0495656_0000338 3300046615 Bacteria 16110
522 Ga0495611_0102403 3300046648 Bacteria 1330
523 Ga0495611_0162183 3300046648 Bacteria 1045
524 Ga0495635_0048853 3300046663 Bacteria 2916
525 Ga0495635_0118183 3300046663 Bacteria 1809
526 Ga0495635_0144080 3300046663 Bacteria 1622
527 Ga0495661_0113218 3300046665 Bacteria 1509
528 Ga0495588_0017196 3300046674 Bacteria 3507
529 Ga0495588_0030675 3300046674 Bacteria 2703
530 Ga0495657_0023571 3300046675 Bacteria 4395
531 Ga0495657_0051023 3300046675 Bacteria 2779
532 Ga0495599_0191987 3300046678 Bacteria 1256
533 Ga0495599_0405502 3300046678 Unclassified 811
534 Ga0495623_0000394 3300046679 Bacteria 28821
535 Ga0495623_0030999 3300046679 Bacteria 3440
536 Ga0495623_0031891 3300046679 Bacteria 3387
537 Ga0495646_0002685 3300046680 Bacteria 11010
538 Ga0495646_0024348 3300046680 Bacteria 3812
539 Ga0495647_0002213 3300046681 Bacteria 6085
540 Ga0495647_0003379 3300046681 Bacteria 5113
541 Ga0495647_0005918 3300046681 Bacteria 4025
542 Ga0495658_0054247 3300046683 Bacteria 2279
543 Ga0495669_0183046 3300046684 Bacteria 999
544 Ga0495613_0040648 3300046689 Bacteria 3445
545 Ga0495613_0106636 3300046689 Bacteria 2021
546 Ga0495613_0122963 3300046689 Bacteria 1862
547 Ga0495624_0038263 3300046690 Bacteria 3082
548 Ga0495670_0000232 3300046691 Bacteria 25466
549 Ga0495600_0002491 3300046809 Bacteria 10572
550 Ga0495600_0011998 3300046809 Bacteria 5410
551 Ga0495600_0014421 3300046809 Bacteria 4981
552 Ga0495600_0019514 3300046809 Bacteria 4330
553 Ga0495581_0021531 3300047315 Bacteria 3735
554 Ga0495581_0027479 3300047315 Bacteria 3299
555 Ga0495581_0150574 3300047315 Bacteria 1359
556 Ga0495604_0009413 3300047317 Bacteria 7727
557 Ga0495604_0010035 3300047317 Bacteria 7498
558 Ga0495604_0105379 3300047317 Bacteria 2064
559 Ga0495674_0009887 3300047319 Bacteria 9054
560 Ga0495674_0015538 3300047319 Bacteria 7114
561 Ga0495674_0059871 3300047319 Bacteria 3325
562 Ga0495676_0117383 3300047321 Bacteria 1941
563 Ga0495676_0167932 3300047321 Bacteria 1546
564 Ga0495680_0008836 3300047322 Bacteria 9116
565 Ga0495680_0009493 3300047322 Bacteria 8743
566 Ga0495680_0015460 3300047322 Bacteria 6585
567 Ga0495680_0031980 3300047322 Bacteria 4276
568 Ga0495675_0001159 3300047444 Bacteria 15992
569 Ga0495675_0030865 3300047444 Bacteria 3419
570 Ga0495675_0058767 3300047444 Bacteria 2438
571 Ga0495675_0060449 3300047444 Bacteria 2402
572 Ga0495684_0018338 3300047471 Bacteria 5394
573 Ga0495684_0066340 3300047471 Bacteria 2744
574 Ga0495593_0060211 3300047673 Bacteria 1988
575 Ga0495593_0219300 3300047673 Bacteria 954
576 Ga0495602_0001877 3300048088 Bacteria 21025
577 Ga0495602_0005817 3300048088 Bacteria 12942
578 Ga0495602_0012468 3300048088 Bacteria 8734
579 Ga0495602_0025567 3300048088 Bacteria 5712
580 Ga0495602_0065563 3300048088 Bacteria 3134
581 Ga0495614_0032344 3300048089 Bacteria 2251
582 Ga0496100_0080900 3300048903 Bacteria 2193
583 Ga0496101_0003343 3300048904 Bacteria 9991
584 Ga0496101_0356708 3300048904 Bacteria 1149
585 Ga0496101_0469356 3300048904 Bacteria 993
586 Ga0496102_0056996 3300048905 Bacteria 3565
587 Ga0496102_0401554 3300048905 Bacteria 1288
588 Ga0496103_0000963 3300048906 Bacteria 20444
589 Ga0496103_0072687 3300048906 Bacteria 2154
590 Ga0496104_0000065 3300048907 Bacteria 108770
591 Ga0496104_0066037 3300048907 Bacteria 3435
592 Ga0496104_0335672 3300048907 Bacteria 1424
593 Ga0496104_0374549 3300048907 Bacteria 1336
594 Ga0496105_0000170 3300048908 Bacteria 43535
595 Ga0496105_0012481 3300048908 Bacteria 6727
596 Ga0496106_0007782 3300048909 Bacteria 7928
597 Ga0496106_0428517 3300048909 Bacteria 1063
598 Ga0496107_0077413 3300048910 Bacteria 2422
599 Ga0496107_0156602 3300048910 Bacteria 1687
600 Ga0496108_0001681 3300048911 Bacteria 17532
601 Ga0496108_0009662 3300048911 Bacteria 7818
602 Ga0496108_0012623 3300048911 Bacteria 6884
603 Ga0496108_0305784 3300048911 Bacteria 1385
604 Ga0496109_0009805 3300048912 Bacteria 8175
605 Ga0496109_0010944 3300048912 Bacteria 7771
606 Ga0496109_0042701 3300048912 Bacteria 4108
607 Ga0496111_0002766 3300048914 Bacteria 10673
608 Ga0496111_0029265 3300048914 Bacteria 3911
609 Ga0496111_0065887 3300048914 Bacteria 2629
610 Ga0496112_0021287 3300048915 Bacteria 6164
611 Ga0496112_0072154 3300048915 Bacteria 3412
612 Ga0496113_0000329 3300048916 Bacteria 22567
613 Ga0496113_0054565 3300048916 Bacteria 2991
614 Ga0496114_0005283 3300048917 Bacteria 10089
615 Ga0496115_0001117 3300048918 Bacteria 19364
616 Ga0496115_0030109 3300048918 Bacteria 4268
617 Ga0496115_0051087 3300048918 Bacteria 3314
618 Ga0496121_0062764 3300048924 Bacteria 3040
619 Ga0501032_0039459 3300049569 Bacteria 3211
620 Ga0501033_0016861 3300049570 Bacteria 5522
621 Ga0501033_0279975 3300049570 Bacteria 1177
622 Ga0501034_0009382 3300049571 Bacteria 10250
623 Ga0501034_0018508 3300049571 Bacteria 7141
624 Ga0501034_0144973 3300049571 Bacteria 2352
625 Ga0501034_0263481 3300049571 Bacteria 1666
626 Ga0501034_0295917 3300049571 Bacteria 1556
627 Ga0501036_0006023 3300049572 Bacteria 9830
628 Ga0501036_0190174 3300049572 Bacteria 1727
629 Ga0501037_0001187 3300049573 Bacteria 19240
630 Ga0501037_0035912 3300049573 Bacteria 3652
631 Ga0501038_0018527 3300049574 Bacteria 6286
632 Ga0501038_0064453 3300049574 Bacteria 3124
633 Ga0501038_0243949 3300049574 Bacteria 1425
634 Ga0501039_0177062 3300049575 Bacteria 1677
635 Ga0501039_0181280 3300049575 Bacteria 1656
636 Ga0501042_0011666 3300049578 Bacteria 5938
637 Ga0501043_0001872 3300049579 Bacteria 18031
638 Ga0501043_0005568 3300049579 Bacteria 10150
639 Ga0501043_0326338 3300049579 Bacteria 1169
640 Ga0501046_0010184 3300049580 Bacteria 8089
641 Ga0501046_0120583 3300049580 Bacteria 1995
642 Ga0501047_0007248 3300049581 Bacteria 10425
643 Ga0501047_0010049 3300049581 Bacteria 8944
644 Ga0501047_0114621 3300049581 Bacteria 2577
645 Ga0501047_0229953 3300049581 Bacteria 1708
646 Ga0501047_0587082 3300049581 Bacteria 936
647 Ga0501048_0000039 3300049582 Bacteria 63521
648 Ga0501048_0207496 3300049582 Bacteria 1389
649 Ga0501067_0006870 3300049583 Bacteria 6313
650 Ga0501067_0099590 3300049583 Bacteria 1614
651 Ga0501068_0003533 3300049584 Bacteria 8445
652 Ga0501068_0005646 3300049584 Bacteria 6853
653 Ga0501069_0015022 3300049585 Bacteria 4147
654 Ga0501069_0018212 3300049585 Bacteria 3788
655 Ga0501072_0385604 3300049588 Bacteria 1112
656 Ga0501073_0138955 3300049589 Bacteria 1683
657 Ga0501073_0197021 3300049589 Bacteria 1393
658 Ga0501074_0127621 3300049590 Bacteria 1820
659 Ga0501074_0451795 3300049590 Bacteria 911
660 Ga0501076_0196459 3300049592 Bacteria 1647
661 Ga0501079_0366796 3300049741 Bacteria 1129
662 Ga0501080_0000022 3300049742 Bacteria 90630
663 Ga0501080_0006329 3300049742 Bacteria 10625
664 Ga0501080_0254760 3300049742 Bacteria 1600
665 Ga0501080_0487711 3300049742 Bacteria 1102
666 Ga0501080_0580421 3300049742 Bacteria 996
667 Ga0501083_0015876 3300049744 Bacteria 5271
668 Ga0501083_0040545 3300049744 Bacteria 3160
669 Ga0501035_0000655 3300049822 Bacteria 38162
670 Ga0501035_0020097 3300049822 Bacteria 6133
671 Ga0501044_0000255 3300049823 Bacteria 67530
672 Ga0501044_0003019 3300049823 Bacteria 19039
673 Ga0501044_0009346 3300049823 Bacteria 10692
674 Ga0501044_0027373 3300049823 Bacteria 6026
675 Ga0501044_0028439 3300049823 Bacteria 5901
676 Ga0501044_0041488 3300049823 Bacteria 4791
677 Ga0501044_0228464 3300049823 Bacteria 1809
678 Ga0501045_0036447 3300049824 Bacteria 3571
679 Ga0501045_0060639 3300049824 Bacteria 2773
680 nmdc:mga00v17_30150_c1 3300050491 Bacteria 3190
681 nmdc:mga0yw44_251197_c1 3300050492 Bacteria 1177
682 nmdc:mga06z11_127471_c1 3300050494 Bacteria 1426
683 nmdc:mga06z11_40821_c1 3300050494 Bacteria 2318
684 nmdc:mga06z11_8072_c1 3300050494 Bacteria 4367
685 nmdc:mga04h51_43209_c1 3300050495 Bacteria 1482
686 nmdc:mga07m45_21541_c1 3300050496 Bacteria 3511
687 nmdc:mga07m45_24981_c1 3300050496 Bacteria 3275
688 nmdc:mga05p37_786_c1 3300050507 Bacteria 35281
689 nmdc:mga09592_4641_c1 3300050508 Bacteria 11128
690 nmdc:mga0qj67_4_c1 3300050509 Bacteria 176711
691 nmdc:mga0qj67_537_c1 3300050509 Bacteria 25810
692 nmdc:mga06r32_121_c1 3300050510 Bacteria 55968
693 nmdc:mga08y16_13767_c1 3300050511 Bacteria 8515
694 nmdc:mga08y16_224205_c1 3300050511 Bacteria 1945
695 nmdc:mga08y16_309_c1 3300050511 Bacteria 44098
696 nmdc:mga08y16_3336_c1 3300050511 Bacteria 16629
697 nmdc:mga08y16_33889_c1 3300050511 Bacteria 5364
698 nmdc:mga0n895_104_c1 3300050512 Bacteria 49584
699 nmdc:mga0n895_409756_c1 3300050512 Bacteria 1371
700 nmdc:mga0n895_670434_c1 3300050512 Bacteria 1034
701 nmdc:mga0rr50_2087_c1 3300050513 Bacteria 11168
702 nmdc:mga0rr50_23711_c1 3300050513 Bacteria 4238
703 nmdc:mga08x19_178012_c1 3300050514 Bacteria 1451
704 nmdc:mga0a205_121530_c1 3300050515 Bacteria 2511
705 nmdc:mga0a205_94045_c1 3300050515 Bacteria 2896
706 nmdc:mga0sz30_77639_c1 3300050516 Bacteria 1435
707 Ga0495601_0000225 3300053077 Bacteria 30328
708 Ga0495601_0011337 3300053077 Bacteria 5328
709 Ga0495601_0066002 3300053077 Bacteria 2303
710 Ga0495601_0283737 3300053077 Bacteria 1079
711 Ga0495612_0000405 3300053078 Bacteria 17265
712 Ga0495595_0000616 3300053084 Bacteria 13570
713 Ga0495595_0003158 3300053084 Bacteria 6535
714 Ga0495595_0130032 3300053084 Bacteria 1230
715 Ga0495619_0000360 3300053085 Bacteria 31637
716 Ga0495619_0001284 3300053085 Bacteria 16486
717 Ga0495619_0004668 3300053085 Bacteria 8728
718 Ga0495619_0236589 3300053085 Bacteria 1266
719 Ga0495619_0285443 3300053085 Bacteria 1143
720 Ga0500646_0103030 3300053090 Bacteria 898
721 Ga0500651_0104067 3300053093 Bacteria 1738
722 Ga0500566_0001157 3300053094 Bacteria 15353
723 Ga0500562_072749 3300053108 Bacteria 928
724 Ga0500593_002128 3300053117 Bacteria 7200
725 Ga0500595_000003 3300053119 Bacteria 419332
726 Ga0500642_0064805 3300053130 Bacteria 1650
727 Ga0500604_0081051 3300053151 Bacteria 1048
728 Ga0500616_0000002 3300053153 Bacteria 1611257
729 Ga0500616_0077288 3300053153 Bacteria 1681
730 Ga0501084_0012665 3300054114 Bacteria 6988
731 Ga0501084_0105557 3300054114 Bacteria 2366
732 Ga0501082_0022695 3300060353 Bacteria 5404
733 Ga0501082_0032432 3300060353 Bacteria 4506
734 Ga0501082_0225986 3300060353 Bacteria 1629
735 Ga0466962_0069631 3300061719 Bacteria 1680
736 Ga0466962_0115370 3300061719 Bacteria 1294

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_251197_c1 nmdc:mga0yw44_251197_c1_18_662 169
2 3300050494 nmdc:mga06z11_127471_c1 nmdc:mga06z11_127471_c1_36_713 169
3 3300050495 nmdc:mga04h51_43209_c1 nmdc:mga04h51_43209_c1_771_1448 169
4 3300050516 nmdc:mga0sz30_77639_c1 nmdc:mga0sz30_77639_c1_696_1373 169
5 3300049742 Ga0501080_0487711 Ga0501080_0487711_412_1080 186
6 3300053085 Ga0495619_0236589 Ga0495619_0236589_306_1034 192
7 3300035724 Ga0373933_0173498 Ga0373933_0173498_14_772 193
8 3300046517 Ga0495630_0026726 Ga0495630_0026726_2369_3109 193
9 3300032126 Ga0307415_100250089 Ga0307415_1002500892 194
10 3300047471 Ga0495684_0066340 Ga0495684_0066340_1989_2732 194
11 3300005439 Ga0070711_100285363 Ga0070711_1002853632 195
12 3300006178 Ga0075367_10079858 Ga0075367_100798582 195
13 3300009545 Ga0105237_10100286 Ga0105237_101002863 195
14 3300012505 Ga0157339_1003319 Ga0157339_10033191 195
15 3300031247 Ga0265340_10099641 Ga0265340_100996412 195
16 3300046477 Ga0495664_0027670 Ga0495664_0027670_706_1437 195
17 3300046511 Ga0495608_0041050 Ga0495608_0041050_1239_1970 195
18 3300046516 Ga0495628_0073293 Ga0495628_0073293_710_1441 195
19 3300046529 Ga0495652_0026811 Ga0495652_0026811_1214_1945 195
20 3300046543 Ga0495645_0113346 Ga0495645_0113346_628_1359 195
21 3300046663 Ga0495635_0118183 Ga0495635_0118183_156_887 195
22 3300046675 Ga0495657_0023571 Ga0495657_0023571_3510_4241 195
23 3300046679 Ga0495623_0031891 Ga0495623_0031891_157_888 195
24 3300046680 Ga0495646_0024348 Ga0495646_0024348_208_939 195
25 3300047317 Ga0495604_0009413 Ga0495604_0009413_1859_2590 195
26 3300047319 Ga0495674_0015538 Ga0495674_0015538_4393_5124 195
27 3300047322 Ga0495680_0031980 Ga0495680_0031980_3015_3746 195
28 3300047444 Ga0495675_0030865 Ga0495675_0030865_524_1255 195
29 3300048088 Ga0495602_0005817 Ga0495602_0005817_9274_10005 195
30 3300050494 nmdc:mga06z11_40821_c1 nmdc:mga06z11_40821_c1_585_1307 195
31 3300006177 Ga0075362_10102872 Ga0075362_101028721 196
32 3300006178 Ga0075367_10206671 Ga0075367_102066712 196
33 3300021384 Ga0213876_10047692 Ga0213876_100476923 196
34 3300028800 Ga0265338_10115103 Ga0265338_101151032 196
35 3300031235 Ga0265330_10046345 Ga0265330_100463453 196
36 3300031241 Ga0265325_10017849 Ga0265325_100178494 196
37 3300031247 Ga0265340_10065466 Ga0265340_100654662 196
38 3300031249 Ga0265339_10077030 Ga0265339_100770302 196
39 3300031711 Ga0265314_10249456 Ga0265314_102494561 196
40 3300037418 Ga0395900_0012710 Ga0395900_0012710_145_888 196
41 3300039437 Ga0436365_0769383 Ga0436365_0769383_6733_7482 196
42 3300039453 Ga0436362_0869149 Ga0436362_0869149_78_827 196
43 3300049575 Ga0501039_0181280 Ga0501039_0181280_234_959 196
44 3300049581 Ga0501047_0229953 Ga0501047_0229953_408_1133 196
45 3300049589 Ga0501073_0138955 Ga0501073_0138955_670_1395 196
46 3300049823 Ga0501044_0228464 Ga0501044_0228464_308_1033 196
47 3300053084 Ga0495595_0130032 Ga0495595_0130032_61_834 196
48 3300053153 Ga0500616_0077288 Ga0500616_0077288_573_1310 196
49 3300061719 Ga0466962_0069631 Ga0466962_0069631_910_1659 196
50 iso_pu_bacteria 2643221547 2643754966 196
51 3300005327 Ga0070658_10045516 Ga0070658_100455165 197
52 3300005327 Ga0070658_10294924 Ga0070658_102949242 197
53 3300005336 Ga0070680_100025931 Ga0070680_1000259311 197
54 3300005339 Ga0070660_100021115 Ga0070660_1000211153 197
55 3300005436 Ga0070713_100427347 Ga0070713_1004273471 197
56 3300005437 Ga0070710_10127166 Ga0070710_101271662 197
57 3300005458 Ga0070681_10048764 Ga0070681_100487643 197
58 3300005471 Ga0070698_100313360 Ga0070698_1003133602 197
59 3300005530 Ga0070679_100074695 Ga0070679_1000746954 197
60 3300005563 Ga0068855_100077098 Ga0068855_1000770984 197
61 3300006028 Ga0070717_10041442 Ga0070717_100414423 197
62 3300006353 Ga0075370_10194263 Ga0075370_101942632 197
63 3300006846 Ga0075430_100000275 Ga0075430_10000027521 197
64 3300009093 Ga0105240_10109147 Ga0105240_101091474 197
65 3300013104 Ga0157370_10056299 Ga0157370_100562993 197
66 3300025909 Ga0207705_10468241 Ga0207705_104682411 197
67 3300025912 Ga0207707_10035389 Ga0207707_100353894 197
68 3300025913 Ga0207695_10169713 Ga0207695_101697132 197
69 3300025917 Ga0207660_10009967 Ga0207660_100099676 197
70 3300025919 Ga0207657_10046279 Ga0207657_100462793 197
71 3300025921 Ga0207652_10078097 Ga0207652_100780973 197
72 3300025949 Ga0207667_10016532 Ga0207667_1001653211 197
73 3300025981 Ga0207640_10071065 Ga0207640_100710652 197
74 3300026078 Ga0207702_10054324 Ga0207702_100543243 197
75 3300028381 Ga0268264_10557975 Ga0268264_105579751 197
76 3300028666 Ga0265336_10043542 Ga0265336_100435421 197
77 3300031241 Ga0265325_10108720 Ga0265325_101087202 197
78 3300031595 Ga0265313_10030904 Ga0265313_100309043 197
79 3300037312 Ga0395899_0257309 Ga0395899_0257309_279_1016 197
80 3300037418 Ga0395900_0122362 Ga0395900_0122362_998_1735 197
81 3300037853 Ga0436364_0168099 Ga0436364_0168099_24_746 197
82 3300038443 Ga0395901_0109021 Ga0395901_0109021_1633_2370 197
83 3300039437 Ga0436365_0983586 Ga0436365_0983586_54_830 197
84 3300044694 Ga0466963_0370252 Ga0466963_0370252_45_779 197
85 3300045976 Ga0466967_0094290 Ga0466967_0094290_662_1396 197
86 3300048909 Ga0496106_0428517 Ga0496106_0428517_147_881 197
87 3300049570 Ga0501033_0279975 Ga0501033_0279975_163_894 197
88 3300049571 Ga0501034_0018508 Ga0501034_0018508_4587_5318 197
89 3300049571 Ga0501034_0263481 Ga0501034_0263481_804_1541 197
90 3300049574 Ga0501038_0064453 Ga0501038_0064453_2345_3076 197
91 3300049590 Ga0501074_0451795 Ga0501074_0451795_115_846 197
92 3300049742 Ga0501080_0580421 Ga0501080_0580421_238_969 197
93 3300049744 Ga0501083_0040545 Ga0501083_0040545_243_965 197
94 3300049823 Ga0501044_0000255 Ga0501044_0000255_47724_48455 197
95 3300049823 Ga0501044_0027373 Ga0501044_0027373_4930_5661 197
96 3300054114 Ga0501084_0105557 Ga0501084_0105557_1022_1744 197
97 3300060353 Ga0501082_0225986 Ga0501082_0225986_757_1479 197
98 3300005328 Ga0070676_10110307 Ga0070676_101103071 198
99 3300005366 Ga0070659_100065802 Ga0070659_1000658022 198
100 3300005458 Ga0070681_10363512 Ga0070681_103635121 198
101 3300005843 Ga0068860_100348153 Ga0068860_1003481531 198
102 3300009093 Ga0105240_10853712 Ga0105240_108537121 198
103 3300009094 Ga0111539_10108778 Ga0111539_101087784 198
104 3300009551 Ga0105238_10025119 Ga0105238_100251193 198
105 3300024225 Ga0224572_1001585 Ga0224572_10015852 198
106 3300024227 Ga0228598_1014536 Ga0228598_10145361 198
107 3300025909 Ga0207705_10340141 Ga0207705_103401412 198
108 3300025912 Ga0207707_10038851 Ga0207707_100388514 198
109 3300025913 Ga0207695_10571334 Ga0207695_105713341 198
110 3300025920 Ga0207649_10147106 Ga0207649_101471062 198
111 3300025921 Ga0207652_10100350 Ga0207652_101003502 198
112 3300025924 Ga0207694_10018888 Ga0207694_100188883 198
113 3300025928 Ga0207700_10136114 Ga0207700_101361142 198
114 3300025929 Ga0207664_10550414 Ga0207664_105504142 198
115 3300026116 Ga0207674_10694744 Ga0207674_106947441 198
116 3300028379 Ga0268266_10666268 Ga0268266_106662682 198
117 3300028800 Ga0265338_10085845 Ga0265338_100858454 198
118 3300031238 Ga0265332_10082336 Ga0265332_100823362 198
119 3300031247 Ga0265340_10005177 Ga0265340_100051772 198
120 3300031249 Ga0265339_10008520 Ga0265339_100085206 198
121 3300031595 Ga0265313_10003681 Ga0265313_1000368111 198
122 3300031711 Ga0265314_10004041 Ga0265314_1000404117 198
123 3300031711 Ga0265314_10009643 Ga0265314_1000964310 198
124 3300031711 Ga0265314_10030010 Ga0265314_100300103 198
125 3300031712 Ga0265342_10004069 Ga0265342_1000406915 198
126 3300031712 Ga0265342_10110551 Ga0265342_101105512 198
127 3300032133 Ga0316583_10000116 Ga0316583_1000011615 198
128 3300036401 Ga0373937_0124163 Ga0373937_0124163_500_1249 198
129 3300037312 Ga0395899_0006936 Ga0395899_0006936_7270_8013 198
130 3300037466 Ga0395898_0012047 Ga0395898_0012047_2536_3279 198
131 3300038443 Ga0395901_0007158 Ga0395901_0007158_9752_10495 198
132 3300044683 Ga0466965_0113074 Ga0466965_0113074_19_762 198
133 3300044683 Ga0466965_0299891 Ga0466965_0299891_62_811 198
134 3300046460 Ga0495638_0013371 Ga0495638_0013371_1699_2400 198
135 3300048907 Ga0496104_0066037 Ga0496104_0066037_721_1443 198
136 3300048908 Ga0496105_0012481 Ga0496105_0012481_807_1529 198
137 3300048910 Ga0496107_0156602 Ga0496107_0156602_477_1199 198
138 3300048918 Ga0496115_0030109 Ga0496115_0030109_1279_2001 198
139 3300048924 Ga0496121_0062764 Ga0496121_0062764_731_1453 198
140 3300049571 Ga0501034_0144973 Ga0501034_0144973_1535_2296 198
141 3300049571 Ga0501034_0295917 Ga0501034_0295917_524_1246 198
142 3300049573 Ga0501037_0035912 Ga0501037_0035912_177_935 198
143 3300049579 Ga0501043_0005568 Ga0501043_0005568_9382_10140 198
144 3300049580 Ga0501046_0120583 Ga0501046_0120583_172_930 198
145 3300049581 Ga0501047_0007248 Ga0501047_0007248_30_788 198
146 3300049581 Ga0501047_0587082 Ga0501047_0587082_153_896 198
147 3300049582 Ga0501048_0000039 Ga0501048_0000039_51723_52481 198
148 3300049582 Ga0501048_0207496 Ga0501048_0207496_203_1027 198
149 3300049585 Ga0501069_0018212 Ga0501069_0018212_273_1097 198
150 3300049589 Ga0501073_0197021 Ga0501073_0197021_115_894 198
151 3300049590 Ga0501074_0127621 Ga0501074_0127621_284_1027 198
152 3300049742 Ga0501080_0000022 Ga0501080_0000022_9251_10009 198
153 3300049742 Ga0501080_0254760 Ga0501080_0254760_594_1355 198
154 3300049822 Ga0501035_0000655 Ga0501035_0000655_4608_5360 198
155 3300049823 Ga0501044_0003019 Ga0501044_0003019_5039_5797 198
156 3300049823 Ga0501044_0028439 Ga0501044_0028439_718_1461 198
157 3300049824 Ga0501045_0036447 Ga0501045_0036447_1960_2718 198
158 3300050509 nmdc:mga0qj67_4_c1 nmdc:mga0qj67_4_c1_83755_84471 198
159 3300050511 nmdc:mga08y16_33889_c1 nmdc:mga08y16_33889_c1_1505_2293 198
160 3300053090 Ga0500646_0103030 Ga0500646_0103030_22_720 198
161 3300053093 Ga0500651_0104067 Ga0500651_0104067_261_992 198
162 3300053094 Ga0500566_0001157 Ga0500566_0001157_14621_15343 198
163 3300053119 Ga0500595_000003 Ga0500595_000003_234846_235577 198
164 3300053130 Ga0500642_0064805 Ga0500642_0064805_402_1103 198
165 3300053151 Ga0500604_0081051 Ga0500604_0081051_145_846 198
166 3300053153 Ga0500616_0000002 Ga0500616_0000002_1426172_1426903 198
167 3300061719 Ga0466962_0115370 Ga0466962_0115370_99_842 198
168 3300002239 JGI24034J26672_10011273 JGI24034J26672_100112732 199
169 3300005329 Ga0070683_100071308 Ga0070683_1000713084 199
170 3300005330 Ga0070690_100010169 Ga0070690_1000101696 199
171 3300005335 Ga0070666_10013033 Ga0070666_100130336 199
172 3300005336 Ga0070680_100320522 Ga0070680_1003205222 199
173 3300005337 Ga0070682_100211783 Ga0070682_1002117831 199
174 3300005338 Ga0068868_100043832 Ga0068868_1000438325 199
175 3300005344 Ga0070661_100135390 Ga0070661_1001353901 199
176 3300005354 Ga0070675_100149359 Ga0070675_1001493592 199
177 3300005355 Ga0070671_100067499 Ga0070671_1000674993 199
178 3300005356 Ga0070674_100058922 Ga0070674_1000589223 199
179 3300005364 Ga0070673_100022646 Ga0070673_1000226463 199
180 3300005365 Ga0070688_100015921 Ga0070688_1000159215 199
181 3300005366 Ga0070659_100078059 Ga0070659_1000780593 199
182 3300005367 Ga0070667_100049507 Ga0070667_1000495071 199
183 3300005434 Ga0070709_10036741 Ga0070709_100367412 199
184 3300005434 Ga0070709_10039706 Ga0070709_100397062 199
185 3300005434 Ga0070709_10089638 Ga0070709_100896382 199
186 3300005435 Ga0070714_100038357 Ga0070714_1000383573 199
187 3300005436 Ga0070713_100233617 Ga0070713_1002336172 199
188 3300005440 Ga0070705_100235401 Ga0070705_1002354011 199
189 3300005441 Ga0070700_100049650 Ga0070700_1000496502 199
190 3300005455 Ga0070663_100016023 Ga0070663_1000160233 199
191 3300005458 Ga0070681_10219210 Ga0070681_102192103 199
192 3300005459 Ga0068867_100119241 Ga0068867_1001192411 199
193 3300005530 Ga0070679_100045107 Ga0070679_1000451075 199
194 3300005543 Ga0070672_100107008 Ga0070672_1001070082 199
195 3300005544 Ga0070686_100121230 Ga0070686_1001212304 199
196 3300005547 Ga0070693_100132926 Ga0070693_1001329262 199
197 3300005577 Ga0068857_100137309 Ga0068857_1001373092 199
198 3300005614 Ga0068856_100046477 Ga0068856_1000464774 199
199 3300005615 Ga0070702_100080387 Ga0070702_1000803873 199
200 3300005616 Ga0068852_100106647 Ga0068852_1001066473 199
201 3300005618 Ga0068864_100160002 Ga0068864_1001600023 199
202 3300005718 Ga0068866_10018406 Ga0068866_100184064 199
203 3300005834 Ga0068851_10089551 Ga0068851_100895512 199
204 3300005842 Ga0068858_100221902 Ga0068858_1002219021 199
205 3300005843 Ga0068860_100622998 Ga0068860_1006229981 199
206 3300005937 Ga0081455_10024396 Ga0081455_100243965 199
207 3300006028 Ga0070717_10002945 Ga0070717_100029454 199
208 3300006058 Ga0075432_10004302 Ga0075432_100043026 199
209 3300006173 Ga0070716_100075159 Ga0070716_1000751594 199
210 3300006194 Ga0075427_10000953 Ga0075427_100009534 199
211 3300006237 Ga0097621_100015096 Ga0097621_1000150964 199
212 3300006358 Ga0068871_100056437 Ga0068871_1000564374 199
213 3300006844 Ga0075428_100004320 Ga0075428_1000043201 199
214 3300006846 Ga0075430_100000426 Ga0075430_10000042611 199
215 3300006847 Ga0075431_100020560 Ga0075431_1000205609 199
216 3300006852 Ga0075433_10000029 Ga0075433_1000002922 199
217 3300006852 Ga0075433_10549952 Ga0075433_105499522 199
218 3300006871 Ga0075434_100000208 Ga0075434_10000020823 199
219 3300006880 Ga0075429_100000734 Ga0075429_10000073428 199
220 3300006914 Ga0075436_100029960 Ga0075436_1000299602 199
221 3300006914 Ga0075436_100315984 Ga0075436_1003159842 199
222 3300007076 Ga0075435_100046941 Ga0075435_1000469412 199
223 3300009011 Ga0105251_10005445 Ga0105251_100054454 199
224 3300009094 Ga0111539_10000345 Ga0111539_1000034523 199
225 3300009094 Ga0111539_10261937 Ga0111539_102619372 199
226 3300009101 Ga0105247_10288663 Ga0105247_102886631 199
227 3300009147 Ga0114129_10003572 Ga0114129_1000357225 199
228 3300009148 Ga0105243_10156681 Ga0105243_101566814 199
229 3300009176 Ga0105242_10109212 Ga0105242_101092122 199
230 3300009545 Ga0105237_10034469 Ga0105237_100344694 199
231 3300009551 Ga0105238_10028682 Ga0105238_100286824 199
232 3300009551 Ga0105238_10475692 Ga0105238_104756922 199
233 3300011119 Ga0105246_10112198 Ga0105246_101121982 199
234 3300012510 Ga0157316_1006246 Ga0157316_10062461 199
235 3300013100 Ga0157373_10164715 Ga0157373_101647152 199
236 3300013102 Ga0157371_10238339 Ga0157371_102383391 199
237 3300013104 Ga0157370_10202959 Ga0157370_102029592 199
238 3300013105 Ga0157369_10834923 Ga0157369_108349231 199
239 3300013306 Ga0163162_11221534 Ga0163162_112215341 199
240 3300014326 Ga0157380_10065474 Ga0157380_100654742 199
241 3300014968 Ga0157379_10380040 Ga0157379_103800403 199
242 3300014969 Ga0157376_10214471 Ga0157376_102144711 199
243 3300025898 Ga0207692_10032532 Ga0207692_100325322 199
244 3300025898 Ga0207692_10193538 Ga0207692_101935382 199
245 3300025906 Ga0207699_10047203 Ga0207699_100472032 199
246 3300025906 Ga0207699_10187115 Ga0207699_101871151 199
247 3300025915 Ga0207693_10004402 Ga0207693_100044023 199
248 3300025916 Ga0207663_10007931 Ga0207663_100079313 199
249 3300025929 Ga0207664_10068339 Ga0207664_100683393 199
250 3300025939 Ga0207665_10353646 Ga0207665_103536461 199
251 3300026116 Ga0207674_10180152 Ga0207674_101801522 199
252 3300026142 Ga0207698_10672089 Ga0207698_106720892 199
253 3300028556 Ga0265337_1019818 Ga0265337_10198182 199
254 3300031241 Ga0265325_10000030 Ga0265325_1000003026 199
255 3300031595 Ga0265313_10006110 Ga0265313_1000611010 199
256 3300031595 Ga0265313_10082256 Ga0265313_100822562 199
257 3300035118 Ga0373954_0003581 Ga0373954_0003581_4708_5541 199
258 3300035118 Ga0373954_0104203 Ga0373954_0104203_190_1008 199
259 3300035119 Ga0373956_0040778 Ga0373956_0040778_428_1261 199
260 3300035172 Ga0373955_0070304 Ga0373955_0070304_691_1509 199
261 3300035410 Ga0373924_0022179 Ga0373924_0022179_1346_2164 199
262 3300035695 Ga0373927_0283154 Ga0373927_0283154_126_944 199
263 3300035724 Ga0373933_0035906 Ga0373933_0035906_1507_2325 199
264 3300035725 Ga0373947_0069790 Ga0373947_0069790_1278_2096 199
265 3300036401 Ga0373937_0002931 Ga0373937_0002931_11326_12144 199
266 3300037068 Ga0373925_0001686 Ga0373925_0001686_12067_12885 199
267 3300037853 Ga0436364_1441472 Ga0436364_1441472_2514_3239 199
268 3300042156 Ga0439446_0063715 Ga0439446_0063715_221_946 199
269 3300042438 Ga0439459_0015823 Ga0439459_0015823_105_830 199
270 3300046462 Ga0495651_0220127 Ga0495651_0220127_79_897 199
271 3300046463 Ga0495653_0239184 Ga0495653_0239184_365_1183 199
272 3300046511 Ga0495608_0105750 Ga0495608_0105750_1035_1790 199
273 3300046529 Ga0495652_0011840 Ga0495652_0011840_2215_3033 199
274 3300046536 Ga0495587_0021036 Ga0495587_0021036_820_1638 199
275 3300046543 Ga0495645_0002634 Ga0495645_0002634_9793_10611 199
276 3300046559 Ga0495667_0011221 Ga0495667_0011221_496_1314 199
277 3300046678 Ga0495599_0191987 Ga0495599_0191987_282_1100 199
278 3300046809 Ga0495600_0002491 Ga0495600_0002491_2920_3738 199
279 3300046809 Ga0495600_0019514 Ga0495600_0019514_1664_2497 199
280 3300047319 Ga0495674_0059871 Ga0495674_0059871_2125_2943 199
281 3300047322 Ga0495680_0008836 Ga0495680_0008836_6286_7104 199
282 3300048088 Ga0495602_0012468 Ga0495602_0012468_3097_3915 199
283 3300048088 Ga0495602_0025567 Ga0495602_0025567_4181_5014 199
284 3300048907 Ga0496104_0000065 Ga0496104_0000065_92829_93650 199
285 3300048908 Ga0496105_0000170 Ga0496105_0000170_35067_35888 199
286 3300049572 Ga0501036_0006023 Ga0501036_0006023_5986_6735 199
287 3300049574 Ga0501038_0018527 Ga0501038_0018527_465_1214 199
288 3300049578 Ga0501042_0011666 Ga0501042_0011666_2915_3664 199
289 3300049580 Ga0501046_0010184 Ga0501046_0010184_1737_2486 199
290 3300049583 Ga0501067_0006870 Ga0501067_0006870_718_1467 199
291 3300049584 Ga0501068_0005646 Ga0501068_0005646_352_1101 199
292 3300049588 Ga0501072_0385604 Ga0501072_0385604_105_854 199
293 3300049744 Ga0501083_0015876 Ga0501083_0015876_1453_2202 199
294 3300049824 Ga0501045_0060639 Ga0501045_0060639_1924_2673 199
295 3300050512 nmdc:mga0n895_670434_c1 nmdc:mga0n895_670434_c1_179_964 199
296 3300053077 Ga0495601_0000225 Ga0495601_0000225_27817_28635 199
297 3300053078 Ga0495612_0000405 Ga0495612_0000405_4668_5486 199
298 3300053085 Ga0495619_0001284 Ga0495619_0001284_13681_14499 199
299 3300060353 Ga0501082_0022695 Ga0501082_0022695_4453_5202 199
300 3300002077 JGI24744J21845_10001065 JGI24744J21845_100010652 200
301 3300005329 Ga0070683_100281939 Ga0070683_1002819392 200
302 3300005330 Ga0070690_100046888 Ga0070690_1000468882 200
303 3300005331 Ga0070670_100003926 Ga0070670_10000392610 200
304 3300005333 Ga0070677_10001233 Ga0070677_100012332 200
305 3300005336 Ga0070680_100075581 Ga0070680_1000755812 200
306 3300005337 Ga0070682_100031300 Ga0070682_1000313005 200
307 3300005343 Ga0070687_100014500 Ga0070687_1000145005 200
308 3300005344 Ga0070661_100027394 Ga0070661_1000273944 200
309 3300005345 Ga0070692_10286820 Ga0070692_102868201 200
310 3300005364 Ga0070673_100368996 Ga0070673_1003689962 200
311 3300005367 Ga0070667_100066283 Ga0070667_1000662833 200
312 3300005367 Ga0070667_100143734 Ga0070667_1001437342 200
313 3300005435 Ga0070714_100105676 Ga0070714_1001056762 200
314 3300005437 Ga0070710_10180439 Ga0070710_101804392 200
315 3300005440 Ga0070705_100409269 Ga0070705_1004092691 200
316 3300005455 Ga0070663_100147422 Ga0070663_1001474222 200
317 3300005456 Ga0070678_100041566 Ga0070678_1000415664 200
318 3300005458 Ga0070681_10113759 Ga0070681_101137591 200
319 3300005458 Ga0070681_10221895 Ga0070681_102218952 200
320 3300005458 Ga0070681_10590887 Ga0070681_105908871 200
321 3300005459 Ga0068867_100100804 Ga0068867_1001008041 200
322 3300005466 Ga0070685_10039316 Ga0070685_100393162 200
323 3300005530 Ga0070679_100098270 Ga0070679_1000982703 200
324 3300005530 Ga0070679_100123213 Ga0070679_1001232133 200
325 3300005536 Ga0070697_100195748 Ga0070697_1001957483 200
326 3300005547 Ga0070693_100264491 Ga0070693_1002644912 200
327 3300005549 Ga0070704_100543810 Ga0070704_1005438101 200
328 3300005563 Ga0068855_100095501 Ga0068855_1000955015 200
329 3300005564 Ga0070664_100057416 Ga0070664_1000574163 200
330 3300005564 Ga0070664_100158450 Ga0070664_1001584502 200
331 3300005577 Ga0068857_100002095 Ga0068857_1000020952 200
332 3300005614 Ga0068856_100046052 Ga0068856_1000460522 200
333 3300005617 Ga0068859_100524464 Ga0068859_1005244642 200
334 3300005618 Ga0068864_100001534 Ga0068864_1000015346 200
335 3300005718 Ga0068866_10002030 Ga0068866_1000203010 200
336 3300005840 Ga0068870_10013282 Ga0068870_100132823 200
337 3300005841 Ga0068863_100135924 Ga0068863_1001359243 200
338 3300005844 Ga0068862_100004584 Ga0068862_1000045841 200
339 3300005937 Ga0081455_10008649 Ga0081455_100086497 200
340 3300006028 Ga0070717_10235308 Ga0070717_102353082 200
341 3300006058 Ga0075432_10027156 Ga0075432_100271562 200
342 3300006173 Ga0070716_100047671 Ga0070716_1000476713 200
343 3300006175 Ga0070712_100320766 Ga0070712_1003207662 200
344 3300006178 Ga0075367_10065237 Ga0075367_100652372 200
345 3300006186 Ga0075369_10012816 Ga0075369_100128164 200
346 3300006237 Ga0097621_100013993 Ga0097621_1000139937 200
347 3300006353 Ga0075370_10037259 Ga0075370_100372593 200
348 3300006353 Ga0075370_10262368 Ga0075370_102623681 200
349 3300006358 Ga0068871_100018875 Ga0068871_1000188754 200
350 3300006871 Ga0075434_100001333 Ga0075434_10000133325 200
351 3300006871 Ga0075434_100286635 Ga0075434_1002866352 200
352 3300006881 Ga0068865_100099074 Ga0068865_1000990743 200
353 3300006881 Ga0068865_100281288 Ga0068865_1002812882 200
354 3300006914 Ga0075436_100188824 Ga0075436_1001888241 200
355 3300006931 Ga0097620_100524507 Ga0097620_1005245072 200
356 3300007076 Ga0075435_100095474 Ga0075435_1000954743 200
357 3300009093 Ga0105240_10069867 Ga0105240_100698673 200
358 3300009101 Ga0105247_10029287 Ga0105247_100292875 200
359 3300009148 Ga0105243_10116370 Ga0105243_101163702 200
360 3300009148 Ga0105243_10242456 Ga0105243_102424562 200
361 3300009174 Ga0105241_10012966 Ga0105241_100129662 200
362 3300009176 Ga0105242_10181924 Ga0105242_101819242 200
363 3300009176 Ga0105242_10206864 Ga0105242_102068642 200
364 3300009545 Ga0105237_10067254 Ga0105237_100672545 200
365 3300009551 Ga0105238_10136040 Ga0105238_101360403 200
366 3300009553 Ga0105249_10119394 Ga0105249_101193941 200
367 3300010375 Ga0105239_10109546 Ga0105239_101095462 200
368 3300012473 Ga0157340_1001339 Ga0157340_10013391 200
369 3300013104 Ga0157370_10058433 Ga0157370_100584333 200
370 3300013105 Ga0157369_11094281 Ga0157369_110942811 200
371 3300013296 Ga0157374_10272671 Ga0157374_102726712 200
372 3300013297 Ga0157378_10069624 Ga0157378_100696243 200
373 3300014325 Ga0163163_10001710 Ga0163163_1000171020 200
374 3300014497 Ga0182008_10096947 Ga0182008_100969471 200
375 3300014745 Ga0157377_10003804 Ga0157377_100038047 200
376 3300014968 Ga0157379_10190381 Ga0157379_101903813 200
377 3300014969 Ga0157376_10008671 Ga0157376_100086718 200
378 3300014969 Ga0157376_10037869 Ga0157376_100378693 200
379 3300017792 Ga0163161_10001476 Ga0163161_100014762 200
380 3300017792 Ga0163161_10065350 Ga0163161_100653504 200
381 3300025290 Ga0207673_1000232 Ga0207673_10002326 200
382 3300025315 Ga0207697_10002797 Ga0207697_100027974 200
383 3300025885 Ga0207653_10014160 Ga0207653_100141604 200
384 3300025893 Ga0207682_10000056 Ga0207682_1000005631 200
385 3300025898 Ga0207692_10011767 Ga0207692_100117672 200
386 3300025898 Ga0207692_10103770 Ga0207692_101037701 200
387 3300025900 Ga0207710_10001206 Ga0207710_100012062 200
388 3300025900 Ga0207710_10062498 Ga0207710_100624982 200
389 3300025903 Ga0207680_10006395 Ga0207680_100063951 200
390 3300025904 Ga0207647_10011486 Ga0207647_100114862 200
391 3300025905 Ga0207685_10052223 Ga0207685_100522234 200
392 3300025906 Ga0207699_10016764 Ga0207699_100167644 200
393 3300025907 Ga0207645_10000249 Ga0207645_1000024910 200
394 3300025907 Ga0207645_10076117 Ga0207645_100761172 200
395 3300025908 Ga0207643_10000187 Ga0207643_1000018725 200
396 3300025909 Ga0207705_10322986 Ga0207705_103229861 200
397 3300025911 Ga0207654_10141539 Ga0207654_101415392 200
398 3300025911 Ga0207654_10239987 Ga0207654_102399871 200
399 3300025913 Ga0207695_10354509 Ga0207695_103545092 200
400 3300025914 Ga0207671_10199873 Ga0207671_101998733 200
401 3300025914 Ga0207671_10381922 Ga0207671_103819221 200
402 3300025915 Ga0207693_10027666 Ga0207693_100276663 200
403 3300025915 Ga0207693_10308346 Ga0207693_103083462 200
404 3300025916 Ga0207663_10046657 Ga0207663_100466574 200
405 3300025917 Ga0207660_10007537 Ga0207660_100075378 200
406 3300025918 Ga0207662_10082578 Ga0207662_100825782 200
407 3300025918 Ga0207662_10347431 Ga0207662_103474311 200
408 3300025919 Ga0207657_10012303 Ga0207657_100123033 200
409 3300025919 Ga0207657_10036760 Ga0207657_100367605 200
410 3300025920 Ga0207649_10000852 Ga0207649_100008526 200
411 3300025920 Ga0207649_10063353 Ga0207649_100633533 200
412 3300025921 Ga0207652_10250411 Ga0207652_102504111 200
413 3300025924 Ga0207694_10174373 Ga0207694_101743733 200
414 3300025924 Ga0207694_10284615 Ga0207694_102846151 200
415 3300025926 Ga0207659_10001325 Ga0207659_1000132520 200
416 3300025927 Ga0207687_10018841 Ga0207687_100188416 200
417 3300025927 Ga0207687_10028412 Ga0207687_100284124 200
418 3300025927 Ga0207687_10168823 Ga0207687_101688233 200
419 3300025928 Ga0207700_10000623 Ga0207700_100006233 200
420 3300025931 Ga0207644_10008645 Ga0207644_100086459 200
421 3300025931 Ga0207644_10057454 Ga0207644_100574544 200
422 3300025931 Ga0207644_10118703 Ga0207644_101187032 200
423 3300025932 Ga0207690_10001793 Ga0207690_1000179320 200
424 3300025933 Ga0207706_10017303 Ga0207706_100173032 200
425 3300025933 Ga0207706_10041807 Ga0207706_100418074 200
426 3300025934 Ga0207686_10000898 Ga0207686_100008985 200
427 3300025935 Ga0207709_10003144 Ga0207709_100031446 200
428 3300025935 Ga0207709_10178383 Ga0207709_101783833 200
429 3300025936 Ga0207670_10018372 Ga0207670_100183725 200
430 3300025938 Ga0207704_10031431 Ga0207704_100314312 200
431 3300025939 Ga0207665_10001669 Ga0207665_1000166918 200
432 3300025940 Ga0207691_10042188 Ga0207691_100421883 200
433 3300025940 Ga0207691_10053344 Ga0207691_100533445 200
434 3300025940 Ga0207691_10352009 Ga0207691_103520091 200
435 3300025941 Ga0207711_10014151 Ga0207711_100141518 200
436 3300025941 Ga0207711_10041241 Ga0207711_100412412 200
437 3300025941 Ga0207711_10228839 Ga0207711_102288393 200
438 3300025942 Ga0207689_10007833 Ga0207689_100078337 200
439 3300025944 Ga0207661_10002538 Ga0207661_100025386 200
440 3300025945 Ga0207679_10000187 Ga0207679_1000018725 200
441 3300025949 Ga0207667_10082569 Ga0207667_100825692 200
442 3300025960 Ga0207651_10127001 Ga0207651_101270013 200
443 3300025961 Ga0207712_10006029 Ga0207712_100060298 200
444 3300025986 Ga0207658_10057325 Ga0207658_100573253 200
445 3300025986 Ga0207658_10065697 Ga0207658_100656974 200
446 3300025986 Ga0207658_10095816 Ga0207658_100958163 200
447 3300026023 Ga0207677_10372145 Ga0207677_103721452 200
448 3300026023 Ga0207677_10714629 Ga0207677_107146291 200
449 3300026035 Ga0207703_10087739 Ga0207703_100877394 200
450 3300026041 Ga0207639_10089022 Ga0207639_100890223 200
451 3300026067 Ga0207678_10007624 Ga0207678_1000762411 200
452 3300026067 Ga0207678_10015613 Ga0207678_1001561310 200
453 3300026067 Ga0207678_10043789 Ga0207678_100437894 200
454 3300026078 Ga0207702_10830076 Ga0207702_108300761 200
455 3300026088 Ga0207641_10143683 Ga0207641_101436832 200
456 3300026088 Ga0207641_10640019 Ga0207641_106400192 200
457 3300026089 Ga0207648_10001031 Ga0207648_1000103111 200
458 3300026089 Ga0207648_10174077 Ga0207648_101740771 200
459 3300026095 Ga0207676_10134624 Ga0207676_101346242 200
460 3300026095 Ga0207676_10333146 Ga0207676_103331462 200
461 3300026116 Ga0207674_10000686 Ga0207674_1000068645 200
462 3300026118 Ga0207675_100048378 Ga0207675_1000483784 200
463 3300026121 Ga0207683_10000727 Ga0207683_100007273 200
464 3300026121 Ga0207683_10004115 Ga0207683_1000411518 200
465 3300026121 Ga0207683_10041162 Ga0207683_100411624 200
466 3300027614 Ga0209970_1002946 Ga0209970_10029463 200
467 3300027665 Ga0209983_1001199 Ga0209983_10011994 200
468 3300027682 Ga0209971_1001243 Ga0209971_10012436 200
469 3300027695 Ga0209966_1000714 Ga0209966_10007143 200
470 3300027717 Ga0209998_10064008 Ga0209998_100640081 200
471 3300027717 Ga0209998_10067826 Ga0209998_100678261 200
472 3300027866 Ga0209813_10011774 Ga0209813_100117743 200
473 3300027876 Ga0209974_10010473 Ga0209974_100104732 200
474 3300027907 Ga0207428_10000150 Ga0207428_1000015099 200
475 3300027907 Ga0207428_10000360 Ga0207428_1000036024 200
476 3300027907 Ga0207428_10000556 Ga0207428_100005568 200
477 3300028379 Ga0268266_10004404 Ga0268266_1000440415 200
478 3300028379 Ga0268266_10281305 Ga0268266_102813052 200
479 3300028380 Ga0268265_10000526 Ga0268265_100005266 200
480 3300028381 Ga0268264_10002038 Ga0268264_100020386 200
481 3300028381 Ga0268264_10122323 Ga0268264_101223233 200
482 3300031238 Ga0265332_10000812 Ga0265332_100008124 200
483 3300031247 Ga0265340_10002134 Ga0265340_100021347 200
484 3300031249 Ga0265339_10000669 Ga0265339_1000066930 200
485 3300031250 Ga0265331_10194498 Ga0265331_101944981 200
486 3300031456 Ga0307513_10143091 Ga0307513_101430913 200
487 3300031691 Ga0316579_10027180 Ga0316579_100271803 200
488 3300031712 Ga0265342_10000281 Ga0265342_1000028112 200
489 3300034816 Ga0373930_0000129 Ga0373930_0000129_1305_2132 200
490 3300034816 Ga0373930_0003062 Ga0373930_0003062_306_1067 200
491 3300034817 Ga0373948_0007773 Ga0373948_0007773_585_1412 200
492 3300034818 Ga0373950_0000820 Ga0373950_0000820_187_1014 200
493 3300034820 Ga0373959_0001750 Ga0373959_0001750_922_1749 200
494 3300034820 Ga0373959_0001950 Ga0373959_0001950_2227_2988 200
495 3300034957 Ga0373938_0002546 Ga0373938_0002546_1681_2505 200
496 3300034957 Ga0373938_0006708 Ga0373938_0006708_965_1726 200
497 3300035083 Ga0373926_0006649 Ga0373926_0006649_2481_3242 200
498 3300035083 Ga0373926_0023880 Ga0373926_0023880_163_924 200
499 3300035083 Ga0373926_0032415 Ga0373926_0032415_349_1173 200
500 3300035084 Ga0373928_0000375 Ga0373928_0000375_2762_3589 200
501 3300035085 Ga0373929_0000146 Ga0373929_0000146_5818_6645 200
502 3300035085 Ga0373929_0001869 Ga0373929_0001869_434_1195 200
503 3300035088 Ga0373940_0008049 Ga0373940_0008049_423_1250 200
504 3300035088 Ga0373940_0058780 Ga0373940_0058780_89_850 200
505 3300035089 Ga0373944_0005274 Ga0373944_0005274_1225_1986 200
506 3300035089 Ga0373944_0006918 Ga0373944_0006918_1260_2084 200
507 3300035089 Ga0373944_0015430 Ga0373944_0015430_29_790 200
508 3300035090 Ga0373949_0010201 Ga0373949_0010201_270_1031 200
509 3300035091 Ga0373951_0000214 Ga0373951_0000214_5438_6265 200
510 3300035092 Ga0373952_0001494 Ga0373952_0001494_1326_2087 200
511 3300035111 Ga0373923_0000187 Ga0373923_0000187_1550_2311 200
512 3300035112 Ga0373932_0000473 Ga0373932_0000473_146_973 200
513 3300035112 Ga0373932_0000584 Ga0373932_0000584_7638_8399 200
514 3300035114 Ga0373939_0000602 Ga0373939_0000602_2601_3428 200
515 3300035114 Ga0373939_0003756 Ga0373939_0003756_1821_2579 200
516 3300035115 Ga0373941_0004906 Ga0373941_0004906_1633_2394 200
517 3300035116 Ga0373945_0000395 Ga0373945_0000395_1410_2171 200
518 3300035116 Ga0373945_0003626 Ga0373945_0003626_909_1733 200
519 3300035116 Ga0373945_0040494 Ga0373945_0040494_230_991 200
520 3300035117 Ga0373953_0006040 Ga0373953_0006040_985_1818 200
521 3300035118 Ga0373954_0006846 Ga0373954_0006846_2330_3154 200
522 3300035118 Ga0373954_0103932 Ga0373954_0103932_18_779 200
523 3300035119 Ga0373956_0003765 Ga0373956_0003765_32_856 200
524 3300035120 Ga0373957_0019755 Ga0373957_0019755_777_1601 200
525 3300035121 Ga0373960_0001283 Ga0373960_0001283_998_1759 200
526 3300035170 Ga0373943_0003892 Ga0373943_0003892_4959_5720 200
527 3300035170 Ga0373943_0005034 Ga0373943_0005034_4410_5234 200
528 3300035170 Ga0373943_0008480 Ga0373943_0008480_224_985 200
529 3300035170 Ga0373943_0031860 Ga0373943_0031860_572_1309 200
530 3300035171 Ga0373946_0024257 Ga0373946_0024257_1236_1973 200
531 3300035171 Ga0373946_0074135 Ga0373946_0074135_209_1033 200
532 3300035172 Ga0373955_0024147 Ga0373955_0024147_1821_2645 200
533 3300035172 Ga0373955_0083295 Ga0373955_0083295_364_1197 200
534 3300035172 Ga0373955_0101614 Ga0373955_0101614_711_1472 200
535 3300035207 Ga0373942_0008104 Ga0373942_0008104_134_895 200
536 3300035207 Ga0373942_0017422 Ga0373942_0017422_612_1439 200
537 3300035241 Ga0373961_0000749 Ga0373961_0000749_3187_4014 200
538 3300035691 Ga0373931_0109680 Ga0373931_0109680_44_868 200
539 3300035692 Ga0373935_0004894 Ga0373935_0004894_2298_3059 200
540 3300035692 Ga0373935_0179646 Ga0373935_0179646_224_985 200
541 3300035695 Ga0373927_0006438 Ga0373927_0006438_5833_6594 200
542 3300035695 Ga0373927_0064286 Ga0373927_0064286_806_1543 200
543 3300035695 Ga0373927_0081759 Ga0373927_0081759_224_985 200
544 3300035695 Ga0373927_0095756 Ga0373927_0095756_201_1025 200
545 3300035724 Ga0373933_0001082 Ga0373933_0001082_14061_14894 200
546 3300035724 Ga0373933_0008751 Ga0373933_0008751_354_1178 200
547 3300035724 Ga0373933_0009814 Ga0373933_0009814_1051_1812 200
548 3300035725 Ga0373947_0001922 Ga0373947_0001922_5134_5895 200
549 3300035725 Ga0373947_0016251 Ga0373947_0016251_2993_3730 200
550 3300035725 Ga0373947_0040243 Ga0373947_0040243_1931_2755 200
551 3300036401 Ga0373937_0007191 Ga0373937_0007191_4709_5542 200
552 3300037068 Ga0373925_0009753 Ga0373925_0009753_1694_2431 200
553 3300037068 Ga0373925_0050437 Ga0373925_0050437_224_985 200
554 3300041451 Ga0451791_0612931 Ga0451791_0612931_753_1472 200
555 3300041460 Ga0451802_1957638 Ga0451802_1957638_378_1097 200
556 3300041486 Ga0451807_2314777 Ga0451807_2314777_48_863 200
557 3300041498 Ga0451841_0706006 Ga0451841_0706006_287_1006 200
558 3300042016 Ga0439463_012770 Ga0439463_012770_939_1700 200
559 3300042876 Ga0451577_0127376 Ga0451577_0127376_145_972 200
560 3300045051 Ga0451576_0018136 Ga0451576_0018136_2418_3245 200
561 3300046455 Ga0495603_0001272 Ga0495603_0001272_11792_12553 200
562 3300046455 Ga0495603_0082254 Ga0495603_0082254_80_841 200
563 3300046459 Ga0495629_0000026 Ga0495629_0000026_118915_119676 200
564 3300046459 Ga0495629_0015488 Ga0495629_0015488_3365_4126 200
565 3300046459 Ga0495629_0036259 Ga0495629_0036259_604_1428 200
566 3300046461 Ga0495641_0018469 Ga0495641_0018469_1546_2307 200
567 3300046462 Ga0495651_0017093 Ga0495651_0017093_3227_3988 200
568 3300046462 Ga0495651_0256863 Ga0495651_0256863_262_1086 200
569 3300046462 Ga0495651_0301221 Ga0495651_0301221_112_879 200
570 3300046463 Ga0495653_0017706 Ga0495653_0017706_4838_5662 200
571 3300046463 Ga0495653_0227717 Ga0495653_0227717_134_895 200
572 3300046472 Ga0495580_0013840 Ga0495580_0013840_2119_2880 200
573 3300046472 Ga0495580_0068647 Ga0495580_0068647_753_1577 200
574 3300046473 Ga0495582_0014383 Ga0495582_0014383_2000_2761 200
575 3300046475 Ga0495639_0006240 Ga0495639_0006240_3104_3865 200
576 3300046475 Ga0495639_0009341 Ga0495639_0009341_1100_1924 200
577 3300046475 Ga0495639_0024784 Ga0495639_0024784_127_888 200
578 3300046476 Ga0495662_0002967 Ga0495662_0002967_61_822 200
579 3300046476 Ga0495662_0086545 Ga0495662_0086545_245_982 200
580 3300046477 Ga0495664_0002862 Ga0495664_0002862_5274_6035 200
581 3300046491 Ga0495584_0040128 Ga0495584_0040128_721_1545 200
582 3300046492 Ga0495585_0002078 Ga0495585_0002078_11556_12317 200
583 3300046499 Ga0495594_0030525 Ga0495594_0030525_1676_2500 200
584 3300046501 Ga0495607_0004674 Ga0495607_0004674_1587_2348 200
585 3300046507 Ga0495606_0169337 Ga0495606_0169337_103_822 200
586 3300046511 Ga0495608_0003087 Ga0495608_0003087_172_996 200
587 3300046511 Ga0495608_0056482 Ga0495608_0056482_1701_2462 200
588 3300046513 Ga0495616_0038691 Ga0495616_0038691_1467_2180 200
589 3300046514 Ga0495618_0015090 Ga0495618_0015090_2394_3155 200
590 3300046516 Ga0495628_0019066 Ga0495628_0019066_528_1352 200
591 3300046516 Ga0495628_0090285 Ga0495628_0090285_1488_2249 200
592 3300046517 Ga0495630_0087010 Ga0495630_0087010_1363_2100 200
593 3300046523 Ga0495644_0000312 Ga0495644_0000312_19623_20381 200
594 3300046526 Ga0495666_0001337 Ga0495666_0001337_7564_8325 200
595 3300046529 Ga0495652_0022671 Ga0495652_0022671_2546_3307 200
596 3300046529 Ga0495652_0101928 Ga0495652_0101928_1123_1947 200
597 3300046531 Ga0495665_0006056 Ga0495665_0006056_1295_2056 200
598 3300046531 Ga0495665_0127196 Ga0495665_0127196_77_901 200
599 3300046533 Ga0495640_0006356 Ga0495640_0006356_4189_4926 200
600 3300046535 Ga0495586_0008435 Ga0495586_0008435_3189_3950 200
601 3300046535 Ga0495586_0008693 Ga0495586_0008693_4442_5266 200
602 3300046536 Ga0495587_0001048 Ga0495587_0001048_10079_10903 200
603 3300046536 Ga0495587_0199300 Ga0495587_0199300_108_941 200
604 3300046537 Ga0495598_0031147 Ga0495598_0031147_135_896 200
605 3300046538 Ga0495609_0020209 Ga0495609_0020209_1708_2469 200
606 3300046543 Ga0495645_0014085 Ga0495645_0014085_3415_4239 200
607 3300046543 Ga0495645_0087093 Ga0495645_0087093_266_1027 200
608 3300046557 Ga0495622_0016292 Ga0495622_0016292_666_1427 200
609 3300046557 Ga0495622_0092083 Ga0495622_0092083_412_1236 200
610 3300046558 Ga0495633_0001295 Ga0495633_0001295_351_1112 200
611 3300046559 Ga0495667_0003431 Ga0495667_0003431_7466_8227 200
612 3300046559 Ga0495667_0014036 Ga0495667_0014036_4322_5146 200
613 3300046559 Ga0495667_0039048 Ga0495667_0039048_25_795 200
614 3300046615 Ga0495656_0000338 Ga0495656_0000338_1749_2510 200
615 3300046648 Ga0495611_0102403 Ga0495611_0102403_472_1233 200
616 3300046648 Ga0495611_0162183 Ga0495611_0162183_254_955 200
617 3300046663 Ga0495635_0048853 Ga0495635_0048853_124_885 200
618 3300046663 Ga0495635_0144080 Ga0495635_0144080_28_852 200
619 3300046665 Ga0495661_0113218 Ga0495661_0113218_384_1145 200
620 3300046674 Ga0495588_0017196 Ga0495588_0017196_139_900 200
621 3300046674 Ga0495588_0030675 Ga0495588_0030675_389_1213 200
622 3300046675 Ga0495657_0051023 Ga0495657_0051023_657_1490 200
623 3300046678 Ga0495599_0405502 Ga0495599_0405502_33_794 200
624 3300046679 Ga0495623_0000394 Ga0495623_0000394_23036_23860 200
625 3300046679 Ga0495623_0030999 Ga0495623_0030999_1381_2214 200
626 3300046680 Ga0495646_0002685 Ga0495646_0002685_7705_8466 200
627 3300046681 Ga0495647_0002213 Ga0495647_0002213_1823_2584 200
628 3300046681 Ga0495647_0003379 Ga0495647_0003379_1098_1922 200
629 3300046681 Ga0495647_0005918 Ga0495647_0005918_2978_3739 200
630 3300046683 Ga0495658_0054247 Ga0495658_0054247_535_1359 200
631 3300046684 Ga0495669_0183046 Ga0495669_0183046_31_855 200
632 3300046689 Ga0495613_0040648 Ga0495613_0040648_2611_3372 200
633 3300046689 Ga0495613_0106636 Ga0495613_0106636_1124_1948 200
634 3300046689 Ga0495613_0122963 Ga0495613_0122963_1052_1813 200
635 3300046690 Ga0495624_0038263 Ga0495624_0038263_1437_2198 200
636 3300046691 Ga0495670_0000232 Ga0495670_0000232_13431_14192 200
637 3300046809 Ga0495600_0011998 Ga0495600_0011998_55_879 200
638 3300046809 Ga0495600_0014421 Ga0495600_0014421_1969_2730 200
639 3300047315 Ga0495581_0021531 Ga0495581_0021531_1013_1774 200
640 3300047315 Ga0495581_0027479 Ga0495581_0027479_675_1499 200
641 3300047315 Ga0495581_0150574 Ga0495581_0150574_137_904 200
642 3300047317 Ga0495604_0010035 Ga0495604_0010035_1554_2315 200
643 3300047317 Ga0495604_0105379 Ga0495604_0105379_529_1362 200
644 3300047319 Ga0495674_0009887 Ga0495674_0009887_4772_5509 200
645 3300047321 Ga0495676_0117383 Ga0495676_0117383_819_1643 200
646 3300047321 Ga0495676_0167932 Ga0495676_0167932_101_862 200
647 3300047322 Ga0495680_0009493 Ga0495680_0009493_3244_4005 200
648 3300047322 Ga0495680_0015460 Ga0495680_0015460_3303_4127 200
649 3300047444 Ga0495675_0001159 Ga0495675_0001159_6245_7069 200
650 3300047444 Ga0495675_0058767 Ga0495675_0058767_1323_2084 200
651 3300047444 Ga0495675_0060449 Ga0495675_0060449_86_919 200
652 3300047471 Ga0495684_0018338 Ga0495684_0018338_584_1345 200
653 3300047673 Ga0495593_0060211 Ga0495593_0060211_967_1728 200
654 3300047673 Ga0495593_0219300 Ga0495593_0219300_121_882 200
655 3300048088 Ga0495602_0001877 Ga0495602_0001877_16615_17439 200
656 3300048088 Ga0495602_0065563 Ga0495602_0065563_809_1570 200
657 3300048089 Ga0495614_0032344 Ga0495614_0032344_38_799 200
658 3300048903 Ga0496100_0080900 Ga0496100_0080900_957_1781 200
659 3300048904 Ga0496101_0003343 Ga0496101_0003343_8913_9674 200
660 3300048904 Ga0496101_0356708 Ga0496101_0356708_63_887 200
661 3300048904 Ga0496101_0469356 Ga0496101_0469356_67_891 200
662 3300048905 Ga0496102_0056996 Ga0496102_0056996_36_797 200
663 3300048905 Ga0496102_0401554 Ga0496102_0401554_358_1182 200
664 3300048906 Ga0496103_0000963 Ga0496103_0000963_18987_19748 200
665 3300048906 Ga0496103_0072687 Ga0496103_0072687_558_1382 200
666 3300048907 Ga0496104_0335672 Ga0496104_0335672_263_1087 200
667 3300048907 Ga0496104_0374549 Ga0496104_0374549_559_1320 200
668 3300048909 Ga0496106_0007782 Ga0496106_0007782_4904_5728 200
669 3300048910 Ga0496107_0077413 Ga0496107_0077413_316_1077 200
670 3300048911 Ga0496108_0001681 Ga0496108_0001681_13318_14142 200
671 3300048911 Ga0496108_0009662 Ga0496108_0009662_1979_2743 200
672 3300048911 Ga0496108_0012623 Ga0496108_0012623_2476_3300 200
673 3300048911 Ga0496108_0305784 Ga0496108_0305784_329_1048 200
674 3300048912 Ga0496109_0009805 Ga0496109_0009805_4917_5741 200
675 3300048912 Ga0496109_0010944 Ga0496109_0010944_6982_7746 200
676 3300048912 Ga0496109_0042701 Ga0496109_0042701_1527_2288 200
677 3300048914 Ga0496111_0002766 Ga0496111_0002766_4929_5753 200
678 3300048914 Ga0496111_0029265 Ga0496111_0029265_793_1617 200
679 3300048914 Ga0496111_0065887 Ga0496111_0065887_1084_1845 200
680 3300048915 Ga0496112_0021287 Ga0496112_0021287_3749_4573 200
681 3300048915 Ga0496112_0072154 Ga0496112_0072154_466_1227 200
682 3300048916 Ga0496113_0000329 Ga0496113_0000329_3398_4222 200
683 3300048916 Ga0496113_0054565 Ga0496113_0054565_1821_2582 200
684 3300048917 Ga0496114_0005283 Ga0496114_0005283_486_1247 200
685 3300048918 Ga0496115_0001117 Ga0496115_0001117_1026_1787 200
686 3300048918 Ga0496115_0051087 Ga0496115_0051087_1578_2339 200
687 3300049569 Ga0501032_0039459 Ga0501032_0039459_251_961 200
688 3300049570 Ga0501033_0016861 Ga0501033_0016861_1446_2156 200
689 3300049571 Ga0501034_0009382 Ga0501034_0009382_5578_6336 200
690 3300049572 Ga0501036_0190174 Ga0501036_0190174_1006_1716 200
691 3300049573 Ga0501037_0001187 Ga0501037_0001187_12716_13474 200
692 3300049574 Ga0501038_0243949 Ga0501038_0243949_91_801 200
693 3300049575 Ga0501039_0177062 Ga0501039_0177062_51_761 200
694 3300049579 Ga0501043_0001872 Ga0501043_0001872_10633_11391 200
695 3300049579 Ga0501043_0326338 Ga0501043_0326338_147_857 200
696 3300049581 Ga0501047_0010049 Ga0501047_0010049_14_772 200
697 3300049581 Ga0501047_0114621 Ga0501047_0114621_131_841 200
698 3300049583 Ga0501067_0099590 Ga0501067_0099590_437_1264 200
699 3300049584 Ga0501068_0003533 Ga0501068_0003533_6986_7744 200
700 3300049585 Ga0501069_0015022 Ga0501069_0015022_22_765 200
701 3300049592 Ga0501076_0196459 Ga0501076_0196459_478_1302 200
702 3300049741 Ga0501079_0366796 Ga0501079_0366796_155_958 200
703 3300049742 Ga0501080_0006329 Ga0501080_0006329_6029_6787 200
704 3300049822 Ga0501035_0020097 Ga0501035_0020097_515_1225 200
705 3300049823 Ga0501044_0009346 Ga0501044_0009346_6684_7442 200
706 3300049823 Ga0501044_0041488 Ga0501044_0041488_1374_2084 200
707 3300050491 nmdc:mga00v17_30150_c1 nmdc:mga00v17_30150_c1_575_1345 200
708 3300050494 nmdc:mga06z11_8072_c1 nmdc:mga06z11_8072_c1_612_1373 200
709 3300050496 nmdc:mga07m45_21541_c1 nmdc:mga07m45_21541_c1_1671_2441 200
710 3300050496 nmdc:mga07m45_24981_c1 nmdc:mga07m45_24981_c1_1698_2522 200
711 3300050507 nmdc:mga05p37_786_c1 nmdc:mga05p37_786_c1_19953_20717 200
712 3300050508 nmdc:mga09592_4641_c1 nmdc:mga09592_4641_c1_7094_7858 200
713 3300050509 nmdc:mga0qj67_537_c1 nmdc:mga0qj67_537_c1_14565_15329 200
714 3300050510 nmdc:mga06r32_121_c1 nmdc:mga06r32_121_c1_14912_15676 200
715 3300050511 nmdc:mga08y16_13767_c1 nmdc:mga08y16_13767_c1_4652_5416 200
716 3300050511 nmdc:mga08y16_224205_c1 nmdc:mga08y16_224205_c1_51_812 200
717 3300050511 nmdc:mga08y16_309_c1 nmdc:mga08y16_309_c1_37893_38654 200
718 3300050511 nmdc:mga08y16_3336_c1 nmdc:mga08y16_3336_c1_10418_11245 200
719 3300050512 nmdc:mga0n895_104_c1 nmdc:mga0n895_104_c1_1964_2725 200
720 3300050512 nmdc:mga0n895_409756_c1 nmdc:mga0n895_409756_c1_267_1091 200
721 3300050513 nmdc:mga0rr50_2087_c1 nmdc:mga0rr50_2087_c1_1630_2394 200
722 3300050513 nmdc:mga0rr50_23711_c1 nmdc:mga0rr50_23711_c1_3103_3864 200
723 3300050514 nmdc:mga08x19_178012_c1 nmdc:mga08x19_178012_c1_289_1116 200
724 3300050515 nmdc:mga0a205_121530_c1 nmdc:mga0a205_121530_c1_41_868 200
725 3300050515 nmdc:mga0a205_94045_c1 nmdc:mga0a205_94045_c1_899_1663 200
726 3300053077 Ga0495601_0011337 Ga0495601_0011337_955_1779 200
727 3300053077 Ga0495601_0066002 Ga0495601_0066002_676_1509 200
728 3300053077 Ga0495601_0283737 Ga0495601_0283737_165_926 200
729 3300053084 Ga0495595_0000616 Ga0495595_0000616_4571_5395 200
730 3300053084 Ga0495595_0003158 Ga0495595_0003158_1952_2785 200
731 3300053085 Ga0495619_0000360 Ga0495619_0000360_25781_26542 200
732 3300053085 Ga0495619_0004668 Ga0495619_0004668_5002_5763 200
733 3300053085 Ga0495619_0285443 Ga0495619_0285443_146_970 200
734 3300053108 Ga0500562_072749 Ga0500562_072749_127_897 200
735 3300053117 Ga0500593_002128 Ga0500593_002128_2645_3334 200
736 3300054114 Ga0501084_0012665 Ga0501084_0012665_4360_5184 200
737 3300060353 Ga0501082_0032432 Ga0501082_0032432_3107_3865 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14693

Ribosomal_TL5_C

Ribosomal protein TL5, C-terminal domain

98

183

0.98

PF01386

Ribosomal_L25p

Ribosomal L25p family

3

90

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ysi-assembly1.cif.gz_R acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9498 5 97
6dnc-assembly1.cif.gz_Z e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon 0.9429 6 97
7m4v-assembly1.cif.gz_U a. baumannii ribosome-eravacycline complex: 50s 0.9406 5 97
6ogg-assembly1.cif.gz_v 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). 0.9377 4 97
7unw-assembly1.cif.gz_X pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9356 6 187
ID Description Score Start End Superfamily
af_K7MM89_88_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9371 100 186 2.170.120.20
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9333 98 180 2.170.120.20
af_P9WHB5_5_98_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9286 3 97 2.40.240.10
af_F4JPA3_178_267_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9239 103 187 2.170.120.20
af_A0A0P0W059_2_141_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9228 4 100 2.40.240.10
ID Description Score Start End GO Terms
AF-A0A529L0H0-F1-model_v4 50S ribosomal protein L25 0.9768 1 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7W8EQU1-F1-model_v4 50S ribosomal protein L25 0.9749 1 98 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A4Q2XX94-F1-model_v4 50S ribosomal protein L25 0.9679 1 110 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A5J5I0L3-F1-model_v4 Large ribosomal subunit protein bL25 (General stress protein CTC) 0.9657 1 194 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7W8EQU1-F1-model_v4 50S ribosomal protein L25 0.9653 1 98 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
91.17 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map