F478339

General Info

Members Datasets Scaffolds Average Seq Length
737 373 736 174

Family's Representative Sequence

Representative Sequence 3300042435|Ga0439434_0033002|Ga0439434_0033002_494_1048
Length 171
Sequence MDRLWGGPAGSLMNLSDTDFQLFAVPATFAQDRAALDARWKELQREAHPDRFAAQGAAAQRVAMQWSVRINEAYQRLKDPIRRASYLCELNGAPLNAEHNTAMPPDFLMQQMEWREEQAEVEAGRARALSSLDWLIDEKGDYPAAAQQVRALMFIERFGQDVEAKFDQLGQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
97 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
103 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
155 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
168 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
169 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
170 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
171 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
172 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
173 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
174 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
175 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
176 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
186 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
209 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
210 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
211 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
215 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
216 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
217 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
218 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
219 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
220 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
227 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
230 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
231 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
232 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
233 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
234 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
241 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
242 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
272 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
282 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
283 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
284 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
314 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
315 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
316 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
333 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
334 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
335 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
336 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
337 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
338 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
339 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
340 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
341 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
342 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
343 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
344 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
345 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
346 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
347 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
350 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
351 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
354 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
358 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
359 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
360 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
361 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
364 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
365 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
366 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
367 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
370 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
371 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
372 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
373 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.41
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 37.31
Nodule 0.95
Rhizoplane 4.61
Rhizosphere 46.54
Stem 0
Stem Tuber 0
Unclassified 10.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1676596 2162886007 Bacteria 909
2 JGI25155J39150_1000008 3300002704 Bacteria 236146
3 JGI25156J39149_1000002 3300002705 Bacteria 343501
4 JGI25154J39366_1000010 3300002738 Bacteria 297985
5 JGI25158J39367_1004693 3300002739 Bacteria 2042
6 JGI25157J39369_1000001 3300002741 Bacteria 363277
7 JGI25150J39212_1005831 3300002774 Bacteria 2595
8 JGI25159J45721_1001779 3300002987 Bacteria 8640
9 JGI25159J45721_1016712 3300002987 Bacteria 1551
10 JGI25151J46595_10042847 3300003187 Bacteria 1626
11 JGI25151J46595_10098200 3300003187 Bacteria 796
12 JGI25153J46596_10033839 3300003215 Bacteria 1680
13 rootH1_10045872 3300003316 Bacteria 1343
14 JGI25160J50197_1001319 3300003354 Bacteria 12526
15 JGI25160J50197_1027407 3300003354 Bacteria 1551
16 JGI26145J50221_1004583 3300003371 Bacteria 1122
17 JGI25161J50226_1000043 3300003374 Bacteria 120741
18 JGI25161J50226_1007981 3300003374 Bacteria 1683
19 JGI25161J50226_1007993 3300003374 Bacteria 1680
20 Ga0006562J51391_1171694 3300003578 Bacteria 2630
21 Ga0006562J51391_1171695 3300003578 Bacteria 2710
22 Ga0055535_1001571 3300003761 Bacteria 11046
23 Ga0055542_1000027 3300003762 Bacteria 254819
24 Ga0055526_1004321 3300003771 Bacteria 8580
25 Ga0055526_1012797 3300003771 Bacteria 3620
26 Ga0055526_1028607 3300003771 Bacteria 1680
27 Ga0055537_1000193 3300003773 Bacteria 45640
28 Ga0055537_1001140 3300003773 Bacteria 11403
29 Ga0055537_1007153 3300003773 Bacteria 2732
30 Ga0055537_1012283 3300003773 Bacteria 1680
31 Ga0055524_1000166 3300003775 Bacteria 75509
32 Ga0055524_1000845 3300003775 Bacteria 20102
33 Ga0055524_1028316 3300003775 Bacteria 1680
34 Ga0055524_1042588 3300003775 Bacteria 1127
35 Ga0055536_1000085 3300003781 Bacteria 80741
36 Ga0055536_1003097 3300003781 Bacteria 9048
37 Ga0055536_1007352 3300003781 Bacteria 4949
38 Ga0055536_1041184 3300003781 Bacteria 1092
39 Ga0055534_1000186 3300003784 Bacteria 45640
40 Ga0055534_1000984 3300003784 Bacteria 12593
41 Ga0055534_1001126 3300003784 Bacteria 11334
42 Ga0055528_1000682 3300003790 Bacteria 24399
43 Ga0055528_1013451 3300003790 Bacteria 3096
44 Ga0055528_1028234 3300003790 Bacteria 1554
45 Ga0055530_10000754 3300003791 Bacteria 26927
46 Ga0055530_10000859 3300003791 Bacteria 25048
47 Ga0055530_10002231 3300003791 Bacteria 12758
48 Ga0055530_10022468 3300003791 Bacteria 1835
49 Ga0055530_10040536 3300003791 Bacteria 1142
50 Ga0055540_1000002 3300003792 Bacteria 436954
51 Ga0055540_1000079 3300003792 Bacteria 112817
52 Ga0055540_1002266 3300003792 Bacteria 10370
53 Ga0055540_1002894 3300003792 Bacteria 8695
54 Ga0055540_1012872 3300003792 Bacteria 2595
55 Ga0055540_1058076 3300003792 Bacteria 780
56 Ga0055531_10000665 3300003794 Bacteria 29356
57 Ga0055531_10000985 3300003794 Bacteria 22675
58 Ga0055531_10002479 3300003794 Bacteria 12312
59 Ga0055531_10002823 3300003794 Bacteria 11383
60 Ga0055531_10019455 3300003794 Bacteria 2745
61 Ga0055531_10032003 3300003794 Bacteria 1728
62 Ga0055543_1000127 3300004625 Bacteria 63245
63 Ga0055543_1004852 3300004625 Bacteria 3562
64 Ga0055543_1011122 3300004625 Bacteria 1856
65 Ga0065165_1012751 3300005262 Bacteria 3398
66 Ga0065704_10071806 3300005289 Bacteria 9886
67 Ga0065704_10112761 3300005289 Bacteria 1927
68 Ga0070658_10067797 3300005327 Bacteria 2916
69 Ga0070658_10303884 3300005327 Bacteria 1361
70 Ga0070658_10984002 3300005327 Bacteria 734
71 Ga0070676_10307847 3300005328 Bacteria 1076
72 Ga0070676_10561964 3300005328 Bacteria 818
73 Ga0070677_10089595 3300005333 Bacteria 1335
74 Ga0068869_100165975 3300005334 Bacteria 1722
75 Ga0070666_10120249 3300005335 Bacteria 1821
76 Ga0070666_10776527 3300005335 Bacteria 705
77 Ga0068868_100149139 3300005338 Bacteria 1925
78 Ga0068868_100672155 3300005338 Bacteria 924
79 Ga0070660_100214833 3300005339 Bacteria 1562
80 Ga0070660_100311999 3300005339 Bacteria 1291
81 Ga0070661_100019416 3300005344 Bacteria 4844
82 Ga0070661_100636144 3300005344 Bacteria 865
83 Ga0070668_100348582 3300005347 Bacteria 1253
84 Ga0070674_100742364 3300005356 Bacteria 843
85 Ga0070673_100267728 3300005364 Bacteria 1495
86 Ga0070659_100001486 3300005366 Bacteria 16875
87 Ga0070659_100318852 3300005366 Bacteria 1299
88 Ga0070659_100877082 3300005366 Bacteria 783
89 Ga0070667_100038506 3300005367 Bacteria 4008
90 Ga0070667_100244267 3300005367 Bacteria 1604
91 Ga0070663_100000131 3300005455 Bacteria 35664
92 Ga0070678_100532811 3300005456 Bacteria 1040
93 Ga0070678_101348568 3300005456 Bacteria 665
94 Ga0070662_100051143 3300005457 Bacteria 2983
95 Ga0068867_100178534 3300005459 Bacteria 1687
96 Ga0070706_100674838 3300005467 Bacteria 959
97 Ga0068853_100012228 3300005539 Bacteria 6980
98 Ga0068853_100285993 3300005539 Bacteria 1521
99 Ga0070672_100123177 3300005543 Bacteria 2124
100 Ga0070672_100410223 3300005543 Bacteria 1162
101 Ga0070665_100067849 3300005548 Bacteria 3576
102 Ga0070665_100988504 3300005548 Bacteria 854
103 Ga0068855_100145733 3300005563 Bacteria 2696
104 Ga0070664_100019476 3300005564 Bacteria 5583
105 Ga0070664_100029444 3300005564 Bacteria 4578
106 Ga0068854_100578350 3300005578 Bacteria 956
107 Ga0068852_100183871 3300005616 Bacteria 1967
108 Ga0068852_100561429 3300005616 Bacteria 1143
109 Ga0068859_100653250 3300005617 Bacteria 1144
110 Ga0068864_100089681 3300005618 Bacteria 2709
111 Ga0068851_10023486 3300005834 Bacteria 3015
112 Ga0068863_100310819 3300005841 Bacteria 1530
113 Ga0068860_100610639 3300005843 Bacteria 1097
114 Ga0068862_100216656 3300005844 Bacteria 1732
115 Ga0075365_10353607 3300006038 Bacteria 1036
116 Ga0075365_10476870 3300006038 Bacteria 881
117 Ga0075365_10532293 3300006038 Bacteria 831
118 Ga0075368_10070241 3300006042 Bacteria 1413
119 Ga0075363_100001372 3300006048 Bacteria 9171
120 Ga0075363_100003657 3300006048 Bacteria 6603
121 Ga0075363_100044593 3300006048 Bacteria 2350
122 Ga0075364_10053787 3300006051 Bacteria 2632
123 Ga0075364_10078271 3300006051 Bacteria 2183
124 Ga0075362_10016056 3300006177 Bacteria 3059
125 Ga0075362_10044435 3300006177 Bacteria 1970
126 Ga0075367_10012600 3300006178 Bacteria 4517
127 Ga0075367_10038176 3300006178 Bacteria 2794
128 Ga0075367_10047708 3300006178 Bacteria 2520
129 Ga0075367_10109050 3300006178 Bacteria 1698
130 Ga0075366_10001124 3300006195 Bacteria 13182
131 Ga0075366_10035701 3300006195 Bacteria 2931
132 Ga0075366_10037137 3300006195 Bacteria 2874
133 Ga0075366_10139790 3300006195 Bacteria 1464
134 Ga0075366_10200592 3300006195 Bacteria 1213
135 Ga0075366_10213890 3300006195 Bacteria 1174
136 Ga0075366_10238446 3300006195 Bacteria 1109
137 Ga0075366_10244350 3300006195 Bacteria 1094
138 Ga0097621_100086862 3300006237 Bacteria 2611
139 Ga0097621_100368613 3300006237 Bacteria 1281
140 Ga0075370_10008279 3300006353 Bacteria 5343
141 Ga0075370_10011875 3300006353 Bacteria 4586
142 Ga0075370_10045060 3300006353 Bacteria 2494
143 Ga0075370_10066640 3300006353 Bacteria 2054
144 Ga0075370_10106028 3300006353 Bacteria 1629
145 Ga0075370_10125392 3300006353 Bacteria 1497
146 Ga0075370_10138122 3300006353 Bacteria 1424
147 Ga0075370_10265843 3300006353 Bacteria 1018
148 Ga0068871_100064039 3300006358 Bacteria 3009
149 Ga0068871_100781857 3300006358 Bacteria 879
150 Ga0075429_100001431 3300006880 Bacteria 19585
151 Ga0097620_100653218 3300006931 Bacteria 1144
152 Ga0079104_1000017 3300006946 Bacteria 313784
153 Ga0079104_1013999 3300006946 Bacteria 2442
154 Ga0079104_1016037 3300006946 Bacteria 2201
155 Ga0099826_10029080 3300006948 Bacteria 4032
156 Ga0105240_10371230 3300009093 Bacteria 1617
157 Ga0105245_10088009 3300009098 Bacteria 2852
158 Ga0105245_10579257 3300009098 Bacteria 1147
159 Ga0114129_10051750 3300009147 Bacteria 5765
160 Ga0105243_10000486 3300009148 Bacteria 40508
161 Ga0105243_10003068 3300009148 Bacteria 13759
162 Ga0105243_10003231 3300009148 Bacteria 13312
163 Ga0105243_10012628 3300009148 Bacteria 6379
164 Ga0105242_11676668 3300009176 Bacteria 671
165 Ga0105248_10480134 3300009177 Bacteria 1401
166 Ga0105248_10772524 3300009177 Bacteria 1084
167 Ga0157347_1001460 3300012502 Bacteria 1858
168 Ga0157373_10126088 3300013100 Bacteria 1800
169 Ga0157370_10014128 3300013104 Bacteria 8189
170 Ga0157370_10614824 3300013104 Bacteria 994
171 Ga0163162_10256232 3300013306 Bacteria 1881
172 Ga0163162_10274397 3300013306 Bacteria 1818
173 Ga0163162_10475418 3300013306 Bacteria 1381
174 Ga0157372_10280863 3300013307 Bacteria 1936
175 Ga0157375_10121684 3300013308 Bacteria 2720
176 Ga0157375_10177301 3300013308 Bacteria 2281
177 Ga0157375_10205853 3300013308 Bacteria 2124
178 Ga0157380_10618780 3300014326 Bacteria 1075
179 Ga0182008_10000093 3300014497 Bacteria 67966
180 Ga0182008_10001960 3300014497 Bacteria 13217
181 Ga0182008_10009359 3300014497 Bacteria 5292
182 Ga0182008_10018987 3300014497 Bacteria 3553
183 Ga0182008_10094641 3300014497 Bacteria 1474
184 Ga0157377_10000035 3300014745 Bacteria 116860
185 Ga0157379_10361175 3300014968 Bacteria 1331
186 Ga0157376_10163245 3300014969 Bacteria 2021
187 Ga0157376_10578051 3300014969 Bacteria 1115
188 Ga0182006_1001354 3300015261 Bacteria 14997
189 Ga0163161_10001250 3300017792 Bacteria 19010
190 Ga0163161_10110174 3300017792 Bacteria 2058
191 Ga0163161_10126217 3300017792 Bacteria 1927
192 Ga0213872_10009993 3300021361 Bacteria 4530
193 Ga0209435_100001 3300025206 Bacteria 1424171
194 Ga0209436_101446 3300025208 Bacteria 8293
195 Ga0209672_100222 3300025228 Bacteria 44005
196 Ga0209147_100435 3300025229 Bacteria 26860
197 Ga0209258_100048 3300025242 Bacteria 365881
198 Ga0207425_1000786 3300025245 Bacteria 16194
199 Ga0207425_1001555 3300025245 Bacteria 9355
200 Ga0207425_1010433 3300025245 Bacteria 2260
201 Ga0207425_1034381 3300025245 Bacteria 994
202 Ga0209646_1000001 3300025246 Bacteria 3092932
203 Ga0209026_1000001 3300025250 Bacteria 1228671
204 Ga0209148_1000040 3300025254 Bacteria 473531
205 Ga0209759_1000001 3300025256 Bacteria 2799452
206 Ga0209129_1000007 3300025258 Bacteria 771325
207 Ga0209129_1001205 3300025258 Bacteria 14869
208 Ga0209129_1006871 3300025258 Bacteria 3544
209 Ga0209129_1019697 3300025258 Bacteria 1269
210 Ga0209565_1000153 3300025263 Bacteria 92909
211 Ga0209565_1001390 3300025263 Bacteria 10816
212 Ga0209565_1003425 3300025263 Bacteria 5136
213 Ga0209565_1005018 3300025263 Bacteria 3919
214 Ga0209565_1009673 3300025263 Bacteria 2429
215 Ga0209565_1023257 3300025263 Bacteria 1274
216 Ga0209673_1000423 3300025273 Bacteria 73682
217 Ga0209673_1000566 3300025273 Bacteria 59095
218 Ga0209673_1000801 3300025273 Bacteria 41669
219 Ga0209673_1024378 3300025273 Bacteria 2034
220 Ga0209673_1050910 3300025273 Bacteria 1097
221 Ga0209130_1000041 3300025284 Bacteria 261078
222 Ga0209130_1000953 3300025284 Bacteria 22898
223 Ga0209130_1001018 3300025284 Bacteria 21612
224 Ga0209130_1001734 3300025284 Bacteria 13039
225 Ga0209675_1000150 3300025291 Bacteria 92909
226 Ga0209675_1001481 3300025291 Bacteria 13497
227 Ga0209675_1002237 3300025291 Bacteria 10110
228 Ga0209675_1002661 3300025291 Bacteria 9017
229 Ga0209675_1002884 3300025291 Bacteria 8522
230 Ga0209675_1015968 3300025291 Bacteria 2206
231 Ga0209675_1021121 3300025291 Bacteria 1743
232 Ga0209675_1028625 3300025291 Bacteria 1352
233 Ga0209675_1035537 3300025291 Bacteria 1135
234 Ga0209676_1000004 3300025292 Bacteria 1138360
235 Ga0209676_1000054 3300025292 Bacteria 365890
236 Ga0209676_1000735 3300025292 Bacteria 44818
237 Ga0209676_1001743 3300025292 Bacteria 18592
238 Ga0209676_1002326 3300025292 Bacteria 13761
239 Ga0209676_1002586 3300025292 Bacteria 12456
240 Ga0209676_1004231 3300025292 Bacteria 8115
241 Ga0209676_1015972 3300025292 Bacteria 2735
242 Ga0209025_1000217 3300025294 Bacteria 137909
243 Ga0209025_1000278 3300025294 Bacteria 117718
244 Ga0209025_1001179 3300025294 Bacteria 36980
245 Ga0209025_1003927 3300025294 Bacteria 13378
246 Ga0209025_1006669 3300025294 Bacteria 8871
247 Ga0209025_1029535 3300025294 Bacteria 2649
248 Ga0209025_1031916 3300025294 Bacteria 2476
249 Ga0209025_1064423 3300025294 Bacteria 1346
250 Ga0209564_1000915 3300025295 Bacteria 38566
251 Ga0209564_1002066 3300025295 Bacteria 17268
252 Ga0209564_1007036 3300025295 Bacteria 5896
253 Ga0209758_1000025 3300025297 Bacteria 586687
254 Ga0209758_1002316 3300025297 Bacteria 19694
255 Ga0209758_1047685 3300025297 Bacteria 1530
256 Ga0209050_1000002 3300025298 Bacteria 1792849
257 Ga0209050_1000066 3300025298 Bacteria 305458
258 Ga0209050_1000651 3300025298 Bacteria 53742
259 Ga0209050_1000861 3300025298 Bacteria 41048
260 Ga0209050_1002866 3300025298 Bacteria 13651
261 Ga0209050_1012119 3300025298 Bacteria 3995
262 Ga0209050_1026025 3300025298 Bacteria 1970
263 Ga0209256_1000003 3300025299 Bacteria 1661127
264 Ga0209256_1000011 3300025299 Bacteria 865309
265 Ga0209256_1000067 3300025299 Bacteria 246812
266 Ga0209256_1000366 3300025299 Bacteria 72685
267 Ga0207426_1000001 3300025302 Bacteria 1341301
268 Ga0207426_1000028 3300025302 Bacteria 483955
269 Ga0207426_1000061 3300025302 Bacteria 362507
270 Ga0209051_1000002 3300025303 Bacteria 1631846
271 Ga0209051_1000024 3300025303 Bacteria 437007
272 Ga0209051_1000044 3300025303 Bacteria 305458
273 Ga0209051_1000049 3300025303 Bacteria 287483
274 Ga0209051_1000096 3300025303 Bacteria 167399
275 Ga0209051_1000430 3300025303 Bacteria 57225
276 Ga0209051_1000532 3300025303 Bacteria 47250
277 Ga0209051_1000913 3300025303 Bacteria 29387
278 Ga0209051_1004959 3300025303 Bacteria 7955
279 Ga0209051_1013466 3300025303 Bacteria 3892
280 Ga0209257_1000002 3300025304 Bacteria 1767052
281 Ga0209257_1000012 3300025304 Bacteria 1111138
282 Ga0209257_1000072 3300025304 Bacteria 332791
283 Ga0209257_1000082 3300025304 Bacteria 305458
284 Ga0209257_1001131 3300025304 Bacteria 34256
285 Ga0209257_1005948 3300025304 Bacteria 8192
286 Ga0209257_1013234 3300025304 Bacteria 3698
287 Ga0209257_1017381 3300025304 Bacteria 2837
288 Ga0207656_10079144 3300025321 Bacteria 1474
289 Ga0207682_10132721 3300025893 Bacteria 1112
290 Ga0207680_10172384 3300025903 Bacteria 1458
291 Ga0207645_10356221 3300025907 Bacteria 980
292 Ga0207643_10353005 3300025908 Bacteria 923
293 Ga0207705_10267575 3300025909 Bacteria 1306
294 Ga0207705_10371042 3300025909 Bacteria 1105
295 Ga0207654_10597833 3300025911 Bacteria 787
296 Ga0207695_10612545 3300025913 Bacteria 970
297 Ga0207657_10150341 3300025919 Bacteria 1897
298 Ga0207649_10016746 3300025920 Bacteria 4142
299 Ga0207649_10152945 3300025920 Bacteria 1591
300 Ga0207687_11072644 3300025927 Bacteria 691
301 Ga0207644_10197781 3300025931 Bacteria 1584
302 Ga0207644_10622715 3300025931 Bacteria 897
303 Ga0207690_10001103 3300025932 Bacteria 17214
304 Ga0207706_10023334 3300025933 Bacteria 5557
305 Ga0207706_10764444 3300025933 Bacteria 823
306 Ga0207709_10000193 3300025935 Bacteria 81025
307 Ga0207709_10000348 3300025935 Bacteria 47582
308 Ga0207709_10001710 3300025935 Bacteria 14779
309 Ga0207709_10006258 3300025935 Bacteria 6689
310 Ga0207709_10007492 3300025935 Bacteria 6075
311 Ga0207669_10088010 3300025937 Bacteria 2013
312 Ga0207691_10098794 3300025940 Bacteria 2607
313 Ga0207691_10329808 3300025940 Bacteria 1308
314 Ga0207711_10948082 3300025941 Bacteria 799
315 Ga0207689_10337837 3300025942 Bacteria 1251
316 Ga0207679_10000368 3300025945 Bacteria 32625
317 Ga0207679_10122288 3300025945 Bacteria 2074
318 Ga0207667_10119720 3300025949 Bacteria 2713
319 Ga0207651_10240124 3300025960 Bacteria 1476
320 Ga0207651_10557872 3300025960 Bacteria 997
321 Ga0207668_10162279 3300025972 Bacteria 1743
322 Ga0207640_10159836 3300025981 Bacteria 1666
323 Ga0207658_10036451 3300025986 Bacteria 3526
324 Ga0207658_11106100 3300025986 Bacteria 724
325 Ga0207677_10217484 3300026023 Bacteria 1530
326 Ga0207703_10510039 3300026035 Bacteria 1130
327 Ga0207703_11152408 3300026035 Bacteria 745
328 Ga0207639_10013989 3300026041 Bacteria 5630
329 Ga0207639_10247606 3300026041 Bacteria 1553
330 Ga0207639_10288915 3300026041 Bacteria 1445
331 Ga0207678_10000500 3300026067 Bacteria 35694
332 Ga0207678_10422184 3300026067 Bacteria 1156
333 Ga0207648_10000040 3300026089 Bacteria 116539
334 Ga0207648_10466209 3300026089 Bacteria 1152
335 Ga0207676_10604803 3300026095 Bacteria 1053
336 Ga0207674_10091491 3300026116 Bacteria 3032
337 Ga0207674_10185677 3300026116 Bacteria 2030
338 Ga0207683_10162903 3300026121 Bacteria 2017
339 Ga0207683_10406234 3300026121 Bacteria 1253
340 Ga0207683_10433370 3300026121 Bacteria 1211
341 Ga0207683_10986136 3300026121 Bacteria 782
342 Ga0207683_11020196 3300026121 Bacteria 768
343 Ga0207698_10087558 3300026142 Bacteria 2537
344 Ga0209281_1000020 3300027111 Bacteria 575972
345 Ga0209281_1000042 3300027111 Bacteria 344748
346 Ga0209973_1010653 3300027252 Bacteria 1091
347 Ga0209970_1001115 3300027614 Bacteria 4743
348 Ga0209983_1119185 3300027665 Bacteria 602
349 Ga0209282_1010228 3300027666 Bacteria 5933
350 Ga0209974_10001570 3300027876 Bacteria 8281
351 Ga0209974_10040175 3300027876 Bacteria 1556
352 Ga0209974_10075366 3300027876 Bacteria 1155
353 Ga0207428_10365639 3300027907 Bacteria 1060
354 Ga0268266_10014410 3300028379 Bacteria 6796
355 Ga0268266_10815724 3300028379 Bacteria 901
356 Ga0268265_10172957 3300028380 Bacteria 1848
357 Ga0268264_10233395 3300028381 Bacteria 1700
358 Ga0307517_10000805 3300028786 Bacteria 53822
359 Ga0307517_10479431 3300028786 Bacteria 638
360 Ga0307515_10000053 3300028794 Bacteria 266512
361 Ga0307515_10001032 3300028794 Bacteria 63662
362 Ga0307515_10001342 3300028794 Bacteria 55698
363 Ga0307515_10002612 3300028794 Bacteria 38796
364 Ga0307515_10013171 3300028794 Bacteria 15473
365 Ga0307515_10019472 3300028794 Bacteria 12203
366 Ga0307515_10084485 3300028794 Bacteria 4076
367 Ga0307515_10314414 3300028794 Bacteria 1238
368 Ga0307515_10570329 3300028794 Bacteria 742
369 Ga0307512_10019179 3300030522 Bacteria 6233
370 Ga0307512_10044313 3300030522 Bacteria 3659
371 Ga0307512_10115617 3300030522 Bacteria 1746
372 Ga0316177_1181706 3300030731 Bacteria 1071
373 Ga0316176_1208777 3300030732 Bacteria 5275
374 Ga0314311_1026962 3300030733 Bacteria 2714
375 Ga0316179_1036211 3300030734 Bacteria 1491
376 Ga0316178_1055728 3300030735 Bacteria 1904
377 Ga0316180_1157758 3300030736 Bacteria 2175
378 Ga0316183_1008427 3300030742 Bacteria 808
379 Ga0316183_1017320 3300030742 Bacteria 4162
380 Ga0316181_1160208 3300030744 Bacteria 1743
381 Ga0316182_1388978 3300030745 Bacteria 2505
382 Ga0265330_10000675 3300031235 Bacteria 21898
383 Ga0265332_10000002 3300031238 Bacteria 709510
384 Ga0265332_10000003 3300031238 Bacteria 482849
385 Ga0265328_10214773 3300031239 Bacteria 732
386 Ga0265325_10035119 3300031241 Bacteria 2664
387 Ga0265340_10009932 3300031247 Bacteria 5101
388 Ga0265327_10000640 3300031251 Bacteria 56812
389 Ga0265327_10023188 3300031251 Bacteria 3682
390 Ga0307513_10000285 3300031456 Bacteria 73356
391 Ga0307513_10084111 3300031456 Bacteria 3269
392 Ga0307513_10279241 3300031456 Bacteria 1449
393 Ga0307513_10818655 3300031456 Bacteria 637
394 Ga0307509_10001946 3300031507 Bacteria 34096
395 Ga0307509_10045814 3300031507 Bacteria 4712
396 Ga0307509_10078909 3300031507 Bacteria 3409
397 Ga0307509_10251580 3300031507 Bacteria 1550
398 Ga0307509_10310849 3300031507 Bacteria 1318
399 Ga0307408_100008062 3300031548 Bacteria 6962
400 Ga0307408_100008200 3300031548 Bacteria 6899
401 Ga0307408_100076543 3300031548 Bacteria 2489
402 Ga0307408_100096423 3300031548 Bacteria 2244
403 Ga0307408_100352697 3300031548 Bacteria 1249
404 Ga0307408_100362532 3300031548 Bacteria 1233
405 Ga0307508_10000004 3300031616 Bacteria 287547
406 Ga0307508_10000078 3300031616 Bacteria 113416
407 Ga0307508_10002611 3300031616 Bacteria 18949
408 Ga0307514_10023123 3300031649 Bacteria 5047
409 Ga0307514_10032879 3300031649 Bacteria 4144
410 Ga0265314_10000012 3300031711 Bacteria 415184
411 Ga0307516_10009495 3300031730 Bacteria 10837
412 Ga0307516_10046323 3300031730 Bacteria 4291
413 Ga0307516_10285418 3300031730 Bacteria 1331
414 Ga0307516_10286274 3300031730 Bacteria 1328
415 Ga0307516_10433175 3300031730 Bacteria 972
416 Ga0307516_10455297 3300031730 Bacteria 935
417 Ga0307405_10093525 3300031731 Bacteria 1997
418 Ga0307405_10110081 3300031731 Bacteria 1864
419 Ga0307405_10310694 3300031731 Bacteria 1200
420 Ga0307405_10427985 3300031731 Bacteria 1043
421 Ga0307405_10444466 3300031731 Bacteria 1026
422 Ga0307405_10521100 3300031731 Bacteria 956
423 Ga0307405_10548974 3300031731 Bacteria 935
424 Ga0307410_10176786 3300031852 Bacteria 1613
425 Ga0307406_10084134 3300031901 Bacteria 2123
426 Ga0307406_10084329 3300031901 Bacteria 2121
427 Ga0307406_10237368 3300031901 Bacteria 1365
428 Ga0307406_10482323 3300031901 Bacteria 1001
429 Ga0307407_10265419 3300031903 Bacteria 1183
430 Ga0307412_10021895 3300031911 Bacteria 3910
431 Ga0307412_10031954 3300031911 Bacteria 3329
432 Ga0307412_10105019 3300031911 Bacteria 2005
433 Ga0307412_10373355 3300031911 Bacteria 1152
434 Ga0307412_10674874 3300031911 Bacteria 884
435 Ga0307416_100258600 3300032002 Bacteria 1700
436 Ga0307416_101057913 3300032002 Bacteria 915
437 Ga0307411_10043221 3300032005 Bacteria 2882
438 Ga0307411_10154442 3300032005 Bacteria 1710
439 Ga0307411_11167906 3300032005 Bacteria 697
440 Ga0307415_101110832 3300032126 Bacteria 741
441 Ga0307507_10164168 3300033179 Bacteria 1632
442 Ga0307510_10017087 3300033180 Bacteria 8559
443 Ga0307510_10041763 3300033180 Bacteria 5008
444 Ga0373928_0015290 3300035084 Bacteria 1561
445 Ga0373932_0057300 3300035112 Bacteria 1174
446 Ga0373937_0498956 3300036401 Bacteria 1156
447 Ga0373925_0596284 3300037068 Bacteria 910
448 Ga0395900_0050252 3300037418 Bacteria 4295
449 Ga0395900_0414718 3300037418 Bacteria 1308
450 Ga0395898_0010705 3300037466 Bacteria 9584
451 Ga0395905_0036288 3300037471 Bacteria 4629
452 Ga0395905_0037264 3300037471 Bacteria 4566
453 Ga0395905_0088118 3300037471 Bacteria 2909
454 Ga0395901_0084441 3300038443 Bacteria 3318
455 Ga0436361_0474781 3300039447 Bacteria 20263
456 Ga0439436_0019407 3300041404 Bacteria 2030
457 Ga0439439_0000304 3300041406 Bacteria 7878
458 Ga0439461_0003861 3300041410 Bacteria 2480
459 Ga0439461_0022695 3300041410 Bacteria 1259
460 Ga0439466_0002298 3300041411 Bacteria 7498
461 Ga0439466_0032790 3300041411 Bacteria 1768
462 Ga0439465_0001722 3300041413 Bacteria 7149
463 Ga0451791_1504222 3300041451 Bacteria 860
464 Ga0451791_1831968 3300041451 Bacteria 945
465 Ga0451793_0420993 3300041452 Bacteria 779
466 Ga0451793_0790542 3300041452 Bacteria 1176
467 Ga0451795_0269663 3300041456 Bacteria 2125
468 Ga0451798_0014371 3300041458 Bacteria 2270
469 Ga0451800_0719183 3300041459 Bacteria 1524
470 Ga0451802_0064298 3300041460 Bacteria 2019
471 Ga0451802_1637868 3300041460 Bacteria 913
472 Ga0451839_0261286 3300041496 Bacteria 1195
473 Ga0451839_0744399 3300041496 Bacteria 824
474 Ga0451847_0695134 3300041503 Bacteria 835
475 Ga0451851_0477554 3300041507 Bacteria 1037
476 Ga0451851_0721193 3300041507 Bacteria 1690
477 Ga0439431_0002206 3300041997 Bacteria 4291
478 Ga0439431_0011466 3300041997 Bacteria 2025
479 Ga0439445_0000315 3300042004 Bacteria 9392
480 Ga0439432_002851 3300042006 Bacteria 6444
481 Ga0439432_018080 3300042006 Bacteria 2359
482 Ga0439449_0002911 3300042007 Bacteria 6658
483 Ga0439449_0004348 3300042007 Bacteria 5469
484 Ga0439449_0009187 3300042007 Bacteria 3746
485 Ga0439452_001163 3300042010 Bacteria 11413
486 Ga0439452_023585 3300042010 Bacteria 1582
487 Ga0439457_006138 3300042014 Bacteria 2965
488 Ga0439457_043301 3300042014 Bacteria 1005
489 Ga0439462_0003203 3300042015 Bacteria 3903
490 Ga0439462_0003593 3300042015 Bacteria 3733
491 Ga0450912_001147 3300042116 Bacteria 1548
492 Ga0450897_002784 3300042128 Bacteria 1347
493 Ga0450896_014578 3300042133 Bacteria 1123
494 Ga0450905_027826 3300042142 Bacteria 861
495 Ga0450906_042330 3300042145 Bacteria 804
496 Ga0439446_0006142 3300042156 Bacteria 3120
497 Ga0439446_0046454 3300042156 Bacteria 1290
498 Ga0439458_0083748 3300042157 Bacteria 816
499 Ga0450909_003341 3300042185 Bacteria 2285
500 Ga0439434_0002020 3300042435 Bacteria 5865
501 Ga0439434_0026783 3300042435 Bacteria 1741
502 Ga0439434_0033002 3300042435 Bacteria 1576
503 Ga0439459_0049516 3300042438 Bacteria 918
504 Ga0439459_0067137 3300042438 Bacteria 822
505 Ga0439464_0004567 3300042439 Bacteria 3548
506 Ga0439460_0237228 3300042461 Bacteria 628
507 Ga0450893_0000990 3300042532 Bacteria 4265
508 Ga0451577_0924304 3300042876 Bacteria 785
509 Ga0451577_1183741 3300042876 Bacteria 682
510 Ga0453684_0440397 3300044712 Bacteria 1452
511 Ga0451576_0123662 3300045051 Bacteria 2695
512 Ga0466967_0850764 3300045976 Bacteria 906
513 Ga0495592_0008709 3300046454 Bacteria 7615
514 Ga0495603_0312211 3300046455 Bacteria 903
515 Ga0495629_0285901 3300046459 Bacteria 1131
516 Ga0495638_0117704 3300046460 Bacteria 1572
517 Ga0495582_0102426 3300046473 Bacteria 1604
518 Ga0495639_0028807 3300046475 Bacteria 2461
519 Ga0495610_0023385 3300046512 Bacteria 3362
520 Ga0495610_0025850 3300046512 Bacteria 3143
521 Ga0495610_0167991 3300046512 Bacteria 922
522 Ga0495616_0020913 3300046513 Bacteria 3553
523 Ga0495620_0010437 3300046515 Bacteria 4901
524 Ga0495620_0091302 3300046515 Bacteria 1222
525 Ga0495628_0280774 3300046516 Bacteria 1237
526 Ga0495630_0318281 3300046517 Bacteria 1189
527 Ga0495631_0002748 3300046518 Bacteria 9757
528 Ga0495632_0009715 3300046519 Bacteria 5772
529 Ga0495632_0056661 3300046519 Bacteria 1915
530 Ga0495637_0029215 3300046520 Bacteria 2455
531 Ga0495637_0072987 3300046520 Bacteria 1381
532 Ga0495637_0174877 3300046520 Bacteria 799
533 Ga0495663_0087722 3300046525 Bacteria 1010
534 Ga0495642_0156357 3300046528 Bacteria 987
535 Ga0495642_0353304 3300046528 Bacteria 646
536 Ga0495654_0216249 3300046530 Bacteria 813
537 Ga0495654_0363409 3300046530 Bacteria 580
538 Ga0495586_0085991 3300046535 Bacteria 1733
539 Ga0495609_0118628 3300046538 Bacteria 1139
540 Ga0495621_0006967 3300046539 Bacteria 3327
541 Ga0495621_0081071 3300046539 Bacteria 1210
542 Ga0495621_0099636 3300046539 Bacteria 1104
543 Ga0495621_0153126 3300046539 Bacteria 908
544 Ga0495597_0000153 3300046542 Bacteria 61233
545 Ga0495645_0305402 3300046543 Bacteria 1038
546 Ga0495622_0092513 3300046557 Bacteria 1389
547 Ga0495633_0000827 3300046558 Bacteria 27307
548 Ga0495633_0117411 3300046558 Bacteria 1233
549 Ga0495656_0000929 3300046615 Bacteria 9473
550 Ga0495656_0145278 3300046615 Bacteria 1141
551 Ga0495656_0342951 3300046615 Bacteria 773
552 Ga0495668_0389801 3300046616 Bacteria 765
553 Ga0495634_0633094 3300046642 Bacteria 619
554 Ga0495625_0015771 3300046660 Bacteria 5966
555 Ga0495625_0051251 3300046660 Bacteria 2959
556 Ga0495659_0174097 3300046664 Bacteria 874
557 Ga0495588_0063669 3300046674 Bacteria 1912
558 Ga0495588_0101704 3300046674 Bacteria 1510
559 Ga0495588_0204802 3300046674 Bacteria 1042
560 Ga0495588_0316590 3300046674 Bacteria 821
561 Ga0495658_0039537 3300046683 Bacteria 2617
562 Ga0495658_0079416 3300046683 Bacteria 1922
563 Ga0495669_0272242 3300046684 Bacteria 814
564 Ga0495670_0029469 3300046691 Bacteria 2724
565 Ga0495670_0130388 3300046691 Bacteria 1310
566 Ga0495671_0019317 3300046692 Bacteria 3605
567 Ga0495676_0007147 3300047321 Bacteria 10247
568 Ga0495676_0133099 3300047321 Bacteria 1792
569 Ga0495677_0019590 3300047445 Bacteria 2453
570 Ga0495677_0053846 3300047445 Bacteria 1484
571 Ga0495685_030533 3300047447 Bacteria 1853
572 Ga0495681_0221901 3300047470 Bacteria 758
573 Ga0495686_0047420 3300047472 Bacteria 2713
574 Ga0495593_0006672 3300047673 Bacteria 6755
575 Ga0495602_0158368 3300048088 Bacteria 1771
576 Ga0496100_0348704 3300048903 Bacteria 1117
577 Ga0496101_0021483 3300048904 Bacteria 4435
578 Ga0496102_0059818 3300048905 Bacteria 3484
579 Ga0496102_0109713 3300048905 Bacteria 2571
580 Ga0496103_0015478 3300048906 Bacteria 4540
581 Ga0496104_0102630 3300048907 Bacteria 2739
582 Ga0496104_0193783 3300048907 Bacteria 1944
583 Ga0496105_0005071 3300048908 Bacteria 9977
584 Ga0496105_0031820 3300048908 Bacteria 4327
585 Ga0496106_0081178 3300048909 Bacteria 2491
586 Ga0496107_0083157 3300048910 Bacteria 2334
587 Ga0496107_0156616 3300048910 Bacteria 1687
588 Ga0496108_0093704 3300048911 Bacteria 2555
589 Ga0496110_0027229 3300048913 Bacteria 4899
590 Ga0496110_0117537 3300048913 Bacteria 2394
591 Ga0496110_0956566 3300048913 Bacteria 763
592 Ga0496110_1586368 3300048913 Bacteria 564
593 Ga0496111_0030572 3300048914 Bacteria 3830
594 Ga0496111_0373726 3300048914 Bacteria 1054
595 Ga0496113_0270259 3300048916 Bacteria 1359
596 Ga0496114_0004085 3300048917 Bacteria 11279
597 Ga0496114_0091093 3300048917 Bacteria 2589
598 Ga0496114_0821022 3300048917 Bacteria 809
599 Ga0496114_0855851 3300048917 Bacteria 789
600 Ga0496115_0385765 3300048918 Bacteria 1139
601 Ga0496116_0080697 3300048919 Bacteria 2019
602 Ga0496117_0038912 3300048920 Bacteria 3517
603 Ga0496117_0071291 3300048920 Bacteria 2329
604 Ga0496117_0302614 3300048920 Bacteria 846
605 Ga0496118_0032460 3300048921 Bacteria 4300
606 Ga0496118_0180480 3300048921 Bacteria 1276
607 Ga0496119_0190562 3300048922 Bacteria 1069
608 Ga0496121_0050847 3300048924 Bacteria 3496
609 Ga0496121_0132622 3300048924 Bacteria 1861
610 Ga0496122_0000103 3300048925 Bacteria 196819
611 Ga0496122_0056621 3300048925 Bacteria 2921
612 Ga0496122_0118048 3300048925 Bacteria 1720
613 Ga0496123_0000261 3300048926 Bacteria 106547
614 Ga0496123_0020532 3300048926 Bacteria 5164
615 Ga0496123_0245793 3300048926 Bacteria 886
616 Ga0496124_0051070 3300048927 Bacteria 3520
617 Ga0496124_0082070 3300048927 Bacteria 2647
618 Ga0496124_0102304 3300048927 Bacteria 2319
619 Ga0496124_0123885 3300048927 Bacteria 2062
620 Ga0496125_0007765 3300048928 Bacteria 11355
621 Ga0496125_0031217 3300048928 Bacteria 4751
622 Ga0496125_0037783 3300048928 Bacteria 4193
623 Ga0496125_0134457 3300048928 Bacteria 1733
624 Ga0496125_0140009 3300048928 Bacteria 1684
625 Ga0496125_0336233 3300048928 Bacteria 908
626 Ga0501034_0381306 3300049571 Bacteria 1335
627 Ga0501046_0119725 3300049580 Bacteria 2004
628 Ga0501047_0092095 3300049581 Bacteria 2910
629 Ga0501238_001607 3300049671 Bacteria 2619
630 Ga0501249_011971 3300049679 Bacteria 1829
631 Ga0501257_048914 3300049686 Bacteria 1051
632 Ga0501225_0008398 3300049705 Bacteria 2964
633 Ga0501035_0151722 3300049822 Bacteria 2010
634 Ga0501044_0144395 3300049823 Bacteria 2366
635 nmdc:mga03683_103702_c1 3300050489 Bacteria 1252
636 nmdc:mga03683_229640_c1 3300050489 Bacteria 858
637 nmdc:mga03683_36449_c1 3300050489 Bacteria 2001
638 nmdc:mga03683_71279_c1 3300050489 Bacteria 1486
639 nmdc:mga03683_77769_c1 3300050489 Bacteria 1428
640 nmdc:mga03n38_126332_c1 3300050490 Bacteria 1262
641 nmdc:mga03n38_19647_c1 3300050490 Bacteria 2688
642 nmdc:mga03n38_238081_c1 3300050490 Bacteria 957
643 nmdc:mga03n38_445120_c1 3300050490 Bacteria 720
644 nmdc:mga00v17_25049_c1 3300050491 Bacteria 3465
645 nmdc:mga00v17_36752_c1 3300050491 Bacteria 2921
646 nmdc:mga00v17_484765_c1 3300050491 Bacteria 802
647 nmdc:mga0yw44_2117_c1 3300050492 Bacteria 8316
648 nmdc:mga0yw44_302968_c1 3300050492 Bacteria 1071
649 nmdc:mga0yw44_404770_c1 3300050492 Bacteria 923
650 nmdc:mga0k408_110780_c1 3300050493 Bacteria 1623
651 nmdc:mga0k408_13250_c1 3300050493 Bacteria 4519
652 nmdc:mga0k408_167179_c1 3300050493 Bacteria 1311
653 nmdc:mga0k408_181128_c1 3300050493 Bacteria 1257
654 nmdc:mga0k408_189872_c1 3300050493 Bacteria 1226
655 nmdc:mga0k408_22221_c1 3300050493 Bacteria 3571
656 nmdc:mga0k408_224887_c1 3300050493 Bacteria 1120
657 nmdc:mga0k408_78454_c1 3300050493 Bacteria 1932
658 nmdc:mga06z11_140247_c1 3300050494 Bacteria 1366
659 nmdc:mga06z11_225563_c1 3300050494 Bacteria 1096
660 nmdc:mga06z11_578311_c1 3300050494 Bacteria 683
661 nmdc:mga07m45_102670_c1 3300050496 Bacteria 1643
662 nmdc:mga07m45_104831_c1 3300050496 Bacteria 1104
663 nmdc:mga07m45_10794_c1 3300050496 Bacteria 4784
664 nmdc:mga07m45_14093_c1 3300050496 Bacteria 4253
665 nmdc:mga07m45_178190_c1 3300050496 Bacteria 1236
666 nmdc:mga07m45_23747_c1 3300050496 Bacteria 3354
667 nmdc:mga07m45_614236_c1 3300050496 Bacteria 628
668 nmdc:mga07m45_8991_c1 3300050496 Bacteria 5159
669 nmdc:mga09592_18661_c1 3300050508 Bacteria 5689
670 nmdc:mga0qj67_74358_c1 3300050509 Bacteria 2715
671 nmdc:mga0sz30_33160_c2 3300050516 Bacteria 1834
672 nmdc:mga0sz30_59406_c1 3300050516 Bacteria 1631
673 Ga0500610_0013258 3300053079 Bacteria 3829
674 Ga0500610_0087266 3300053079 Bacteria 1622
675 Ga0495619_0224718 3300053085 Bacteria 1301
676 Ga0500643_013594 3300053087 Bacteria 2868
677 Ga0500643_054543 3300053087 Bacteria 1134
678 Ga0500644_0003921 3300053088 Bacteria 3703
679 Ga0500644_0148631 3300053088 Bacteria 937
680 Ga0500646_0019967 3300053090 Bacteria 1776
681 Ga0500583_0238538 3300053092 Bacteria 899
682 Ga0500651_0000430 3300053093 Bacteria 22553
683 Ga0500651_0042063 3300053093 Bacteria 2879
684 Ga0500651_0347233 3300053093 Bacteria 842
685 Ga0500650_0101407 3300053098 Bacteria 1346
686 Ga0500562_028292 3300053108 Bacteria 1473
687 Ga0500569_082281 3300053109 Bacteria 1031
688 Ga0500571_000252 3300053110 Bacteria 20356
689 Ga0500592_047966 3300053116 Bacteria 693
690 Ga0500593_000652 3300053117 Bacteria 13240
691 Ga0500593_002060 3300053117 Bacteria 7295
692 Ga0500593_002533 3300053117 Bacteria 6725
693 Ga0500594_0000441 3300053118 Bacteria 9179
694 Ga0500607_001874 3300053121 Bacteria 18035
695 Ga0500608_003111 3300053122 Bacteria 6160
696 Ga0500614_053718 3300053123 Bacteria 1065
697 Ga0500618_038162 3300053125 Bacteria 1109
698 Ga0500626_028311 3300053128 Bacteria 2528
699 Ga0500642_0003789 3300053130 Bacteria 4632
700 Ga0500652_000307 3300053131 Bacteria 17714
701 Ga0500655_001160 3300053133 Bacteria 5025
702 Ga0500658_0000352 3300053134 Bacteria 20402
703 Ga0500658_0003377 3300053134 Bacteria 6041
704 Ga0500658_0283932 3300053134 Bacteria 761
705 Ga0500559_0000191 3300053136 Bacteria 49243
706 Ga0500559_0001027 3300053136 Bacteria 17107
707 Ga0500559_0011898 3300053136 Bacteria 3709
708 Ga0500559_0024763 3300053136 Bacteria 2554
709 Ga0500561_0148396 3300053137 Bacteria 729
710 Ga0500564_047935 3300053138 Bacteria 1959
711 Ga0500568_0013994 3300053139 Bacteria 3636
712 Ga0500573_0111477 3300053140 Bacteria 1530
713 Ga0500574_002382 3300053141 Bacteria 3084
714 Ga0500577_0014789 3300053142 Bacteria 2422
715 Ga0500590_055132 3300053148 Bacteria 2011
716 Ga0500604_0130019 3300053151 Bacteria 846
717 Ga0500619_001373 3300053154 Bacteria 4281
718 Ga0500619_060043 3300053154 Bacteria 1249
719 Ga0500622_0000160 3300053156 Bacteria 70774
720 Ga0500622_0001454 3300053156 Bacteria 18928
721 Ga0500622_0084018 3300053156 Bacteria 1590
722 Ga0500624_004796 3300053157 Bacteria 1788
723 Ga0500634_0016453 3300053161 Bacteria 3945
724 Ga0500634_0028221 3300053161 Bacteria 3056
725 Ga0500638_003518 3300053162 Bacteria 5815
726 Ga0500636_0336229 3300053177 Bacteria 727
727 Ga0500636_0353385 3300053177 Bacteria 700
728 Ga0500570_060968 3300053724 Bacteria 1826
729 Ga0500645_003389 3300053730 Bacteria 6508
730 Ga0500645_036265 3300053730 Bacteria 1467
731 Ga0500596_005608 3300053735 Bacteria 2190
732 Ga0500587_000344 3300053739 Bacteria 5279
733 Ga0500587_002693 3300053739 Bacteria 2518
734 Ga0500661_036114 3300055283 Bacteria 874
735 Ga0590075_006111 3300059424 Bacteria 2852
736 Ga0587111_0088833 3300060346 Bacteria 751

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042145 Ga0450906_042330 Ga0450906_042330_143_697 159
2 3300042435 Ga0439434_0033002 Ga0439434_0033002_494_1048 159
3 3300006358 Ga0068871_100781857 Ga0068871_1007818571 161
4 3300013306 Ga0163162_10475418 Ga0163162_104754182 161
5 3300005333 Ga0070677_10089595 Ga0070677_100895952 169
6 3300005335 Ga0070666_10120249 Ga0070666_101202491 169
7 3300005338 Ga0068868_100672155 Ga0068868_1006721552 169
8 3300005364 Ga0070673_100267728 Ga0070673_1002677282 169
9 3300005367 Ga0070667_100038506 Ga0070667_1000385062 169
10 3300005456 Ga0070678_100532811 Ga0070678_1005328111 169
11 3300005548 Ga0070665_100988504 Ga0070665_1009885042 169
12 3300009176 Ga0105242_11676668 Ga0105242_116766682 169
13 3300013306 Ga0163162_10274397 Ga0163162_102743973 169
14 3300013308 Ga0157375_10177301 Ga0157375_101773012 169
15 3300014497 Ga0182008_10018987 Ga0182008_100189872 169
16 3300014969 Ga0157376_10163245 Ga0157376_101632452 169
17 3300025893 Ga0207682_10132721 Ga0207682_101327212 169
18 3300025903 Ga0207680_10172384 Ga0207680_101723842 169
19 3300025960 Ga0207651_10557872 Ga0207651_105578722 169
20 3300025986 Ga0207658_10036451 Ga0207658_100364512 169
21 3300026089 Ga0207648_10466209 Ga0207648_104662092 169
22 3300026121 Ga0207683_10162903 Ga0207683_101629032 169
23 3300026121 Ga0207683_10986136 Ga0207683_109861362 169
24 3300028379 Ga0268266_10815724 Ga0268266_108157242 169
25 3300028794 Ga0307515_10001032 Ga0307515_1000103240 169
26 3300031251 Ga0265327_10000640 Ga0265327_1000064051 169
27 3300031251 Ga0265327_10023188 Ga0265327_100231883 169
28 3300046455 Ga0495603_0312211 Ga0495603_0312211_198_707 169
29 3300046459 Ga0495629_0285901 Ga0495629_0285901_150_659 169
30 3300046475 Ga0495639_0028807 Ga0495639_0028807_1188_1697 169
31 3300046528 Ga0495642_0156357 Ga0495642_0156357_309_818 169
32 3300046528 Ga0495642_0353304 Ga0495642_0353304_127_636 169
33 3300046535 Ga0495586_0085991 Ga0495586_0085991_1056_1565 169
34 3300046539 Ga0495621_0081071 Ga0495621_0081071_522_1031 169
35 3300046543 Ga0495645_0305402 Ga0495645_0305402_332_841 169
36 3300046615 Ga0495656_0145278 Ga0495656_0145278_37_546 169
37 3300046642 Ga0495634_0633094 Ga0495634_0633094_64_573 169
38 3300046674 Ga0495588_0204802 Ga0495588_0204802_241_750 169
39 3300046674 Ga0495588_0316590 Ga0495588_0316590_73_582 169
40 3300047321 Ga0495676_0133099 Ga0495676_0133099_283_792 169
41 3300048903 Ga0496100_0348704 Ga0496100_0348704_443_952 169
42 3300048904 Ga0496101_0021483 Ga0496101_0021483_947_1456 169
43 3300048905 Ga0496102_0059818 Ga0496102_0059818_1892_2401 169
44 3300048906 Ga0496103_0015478 Ga0496103_0015478_2646_3155 169
45 3300048907 Ga0496104_0102630 Ga0496104_0102630_1288_1797 169
46 3300048908 Ga0496105_0005071 Ga0496105_0005071_8701_9210 169
47 3300048909 Ga0496106_0081178 Ga0496106_0081178_46_555 169
48 3300048910 Ga0496107_0083157 Ga0496107_0083157_1403_1912 169
49 3300048911 Ga0496108_0093704 Ga0496108_0093704_1144_1653 169
50 3300048913 Ga0496110_0117537 Ga0496110_0117537_43_552 169
51 3300048913 Ga0496110_1586368 Ga0496110_1586368_14_523 169
52 3300048914 Ga0496111_0030572 Ga0496111_0030572_2008_2517 169
53 3300048914 Ga0496111_0373726 Ga0496111_0373726_208_717 169
54 3300048917 Ga0496114_0091093 Ga0496114_0091093_785_1294 169
55 3300048917 Ga0496114_0855851 Ga0496114_0855851_260_769 169
56 3300053085 Ga0495619_0224718 Ga0495619_0224718_595_1104 169
57 3300060346 Ga0587111_0088833 Ga0587111_0088833_95_604 169
58 3300005563 Ga0068855_100145733 Ga0068855_1001457334 170
59 3300005616 Ga0068852_100183871 Ga0068852_1001838712 170
60 3300006195 Ga0075366_10238446 Ga0075366_102384463 170
61 3300025949 Ga0207667_10119720 Ga0207667_101197204 170
62 3300026142 Ga0207698_10087558 Ga0207698_100875583 170
63 3300028794 Ga0307515_10000053 Ga0307515_10000053135 170
64 3300031238 Ga0265332_10000003 Ga0265332_10000003285 170
65 3300031239 Ga0265328_10214773 Ga0265328_102147731 170
66 3300031456 Ga0307513_10084111 Ga0307513_100841115 170
67 3300042876 Ga0451577_1183741 Ga0451577_1183741_36_566 170
68 3300050493 nmdc:mga0k408_189872_c1 nmdc:mga0k408_189872_c1_576_1088 170
69 3300005456 Ga0070678_101348568 Ga0070678_1013485681 171
70 3300009147 Ga0114129_10051750 Ga0114129_100517506 171
71 3300009177 Ga0105248_10480134 Ga0105248_104801342 171
72 3300013308 Ga0157375_10205853 Ga0157375_102058532 171
73 3300014969 Ga0157376_10578051 Ga0157376_105780512 171
74 3300025931 Ga0207644_10622715 Ga0207644_106227152 171
75 3300025960 Ga0207651_10240124 Ga0207651_102401242 171
76 3300042015 Ga0439462_0003203 Ga0439462_0003203_170_691 171
77 3300048907 Ga0496104_0193783 Ga0496104_0193783_1205_1723 171
78 3300048908 Ga0496105_0031820 Ga0496105_0031820_2100_2618 171
79 2162886007 SwRhRL2b_contig_1676596 SwRhRL2b_0708.00006920 172
80 3300002704 JGI25155J39150_1000008 JGI25155J39150_100000811 172
81 3300002705 JGI25156J39149_1000002 JGI25156J39149_1000002245 172
82 3300002738 JGI25154J39366_1000010 JGI25154J39366_100001073 172
83 3300002739 JGI25158J39367_1004693 JGI25158J39367_10046932 172
84 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001266 172
85 3300002774 JGI25150J39212_1005831 JGI25150J39212_10058311 172
86 3300002987 JGI25159J45721_1001779 JGI25159J45721_10017795 172
87 3300002987 JGI25159J45721_1016712 JGI25159J45721_10167123 172
88 3300003187 JGI25151J46595_10042847 JGI25151J46595_100428472 172
89 3300003187 JGI25151J46595_10098200 JGI25151J46595_100982001 172
90 3300003215 JGI25153J46596_10033839 JGI25153J46596_100338392 172
91 3300003316 rootH1_10045872 rootH1_100458722 172
92 3300003354 JGI25160J50197_1001319 JGI25160J50197_10013197 172
93 3300003354 JGI25160J50197_1027407 JGI25160J50197_10274073 172
94 3300003371 JGI26145J50221_1004583 JGI26145J50221_10045832 172
95 3300003374 JGI25161J50226_1000043 JGI25161J50226_100004319 172
96 3300003374 JGI25161J50226_1007981 JGI25161J50226_10079812 172
97 3300003374 JGI25161J50226_1007993 JGI25161J50226_10079932 172
98 3300003578 Ga0006562J51391_1171694 Ga0006562J51391_11716942 172
99 3300003578 Ga0006562J51391_1171695 Ga0006562J51391_11716953 172
100 3300003761 Ga0055535_1001571 Ga0055535_10015719 172
101 3300003762 Ga0055542_1000027 Ga0055542_1000027128 172
102 3300003771 Ga0055526_1004321 Ga0055526_10043217 172
103 3300003771 Ga0055526_1012797 Ga0055526_10127972 172
104 3300003771 Ga0055526_1028607 Ga0055526_10286072 172
105 3300003773 Ga0055537_1000193 Ga0055537_100019319 172
106 3300003773 Ga0055537_1001140 Ga0055537_10011406 172
107 3300003773 Ga0055537_1007153 Ga0055537_10071532 172
108 3300003773 Ga0055537_1012283 Ga0055537_10122832 172
109 3300003775 Ga0055524_1000166 Ga0055524_100016610 172
110 3300003775 Ga0055524_1000845 Ga0055524_10008451 172
111 3300003775 Ga0055524_1028316 Ga0055524_10283162 172
112 3300003775 Ga0055524_1042588 Ga0055524_10425882 172
113 3300003781 Ga0055536_1000085 Ga0055536_100008570 172
114 3300003781 Ga0055536_1003097 Ga0055536_100309711 172
115 3300003781 Ga0055536_1007352 Ga0055536_10073526 172
116 3300003781 Ga0055536_1041184 Ga0055536_10411842 172
117 3300003784 Ga0055534_1000186 Ga0055534_100018619 172
118 3300003784 Ga0055534_1000984 Ga0055534_100098414 172
119 3300003784 Ga0055534_1001126 Ga0055534_10011262 172
120 3300003790 Ga0055528_1000682 Ga0055528_100068219 172
121 3300003790 Ga0055528_1013451 Ga0055528_10134513 172
122 3300003790 Ga0055528_1028234 Ga0055528_10282343 172
123 3300003791 Ga0055530_10000754 Ga0055530_1000075415 172
124 3300003791 Ga0055530_10000859 Ga0055530_1000085919 172
125 3300003791 Ga0055530_10002231 Ga0055530_1000223112 172
126 3300003791 Ga0055530_10022468 Ga0055530_100224682 172
127 3300003791 Ga0055530_10040536 Ga0055530_100405362 172
128 3300003792 Ga0055540_1000002 Ga0055540_1000002319 172
129 3300003792 Ga0055540_1000079 Ga0055540_100007998 172
130 3300003792 Ga0055540_1002266 Ga0055540_100226613 172
131 3300003792 Ga0055540_1002894 Ga0055540_10028949 172
132 3300003792 Ga0055540_1012872 Ga0055540_10128721 172
133 3300003792 Ga0055540_1058076 Ga0055540_10580761 172
134 3300003794 Ga0055531_10000665 Ga0055531_100006654 172
135 3300003794 Ga0055531_10000985 Ga0055531_1000098515 172
136 3300003794 Ga0055531_10002479 Ga0055531_100024796 172
137 3300003794 Ga0055531_10002823 Ga0055531_100028236 172
138 3300003794 Ga0055531_10019455 Ga0055531_100194553 172
139 3300003794 Ga0055531_10032003 Ga0055531_100320031 172
140 3300004625 Ga0055543_1000127 Ga0055543_100012766 172
141 3300004625 Ga0055543_1004852 Ga0055543_10048523 172
142 3300004625 Ga0055543_1011122 Ga0055543_10111222 172
143 3300005262 Ga0065165_1012751 Ga0065165_10127513 172
144 3300005289 Ga0065704_10071806 Ga0065704_100718062 172
145 3300005289 Ga0065704_10112761 Ga0065704_101127614 172
146 3300005327 Ga0070658_10067797 Ga0070658_100677972 172
147 3300005327 Ga0070658_10303884 Ga0070658_103038843 172
148 3300005327 Ga0070658_10984002 Ga0070658_109840021 172
149 3300005328 Ga0070676_10307847 Ga0070676_103078472 172
150 3300005328 Ga0070676_10561964 Ga0070676_105619642 172
151 3300005334 Ga0068869_100165975 Ga0068869_1001659752 172
152 3300005335 Ga0070666_10776527 Ga0070666_107765271 172
153 3300005338 Ga0068868_100149139 Ga0068868_1001491392 172
154 3300005339 Ga0070660_100214833 Ga0070660_1002148331 172
155 3300005339 Ga0070660_100311999 Ga0070660_1003119991 172
156 3300005344 Ga0070661_100019416 Ga0070661_1000194162 172
157 3300005344 Ga0070661_100636144 Ga0070661_1006361441 172
158 3300005347 Ga0070668_100348582 Ga0070668_1003485822 172
159 3300005356 Ga0070674_100742364 Ga0070674_1007423641 172
160 3300005366 Ga0070659_100001486 Ga0070659_10000148616 172
161 3300005366 Ga0070659_100318852 Ga0070659_1003188521 172
162 3300005366 Ga0070659_100877082 Ga0070659_1008770821 172
163 3300005367 Ga0070667_100244267 Ga0070667_1002442673 172
164 3300005455 Ga0070663_100000131 Ga0070663_10000013123 172
165 3300005457 Ga0070662_100051143 Ga0070662_1000511433 172
166 3300005459 Ga0068867_100178534 Ga0068867_1001785342 172
167 3300005467 Ga0070706_100674838 Ga0070706_1006748381 172
168 3300005539 Ga0068853_100012228 Ga0068853_1000122282 172
169 3300005539 Ga0068853_100285993 Ga0068853_1002859932 172
170 3300005543 Ga0070672_100123177 Ga0070672_1001231773 172
171 3300005543 Ga0070672_100410223 Ga0070672_1004102232 172
172 3300005548 Ga0070665_100067849 Ga0070665_1000678493 172
173 3300005564 Ga0070664_100019476 Ga0070664_1000194765 172
174 3300005564 Ga0070664_100029444 Ga0070664_1000294442 172
175 3300005578 Ga0068854_100578350 Ga0068854_1005783502 172
176 3300005616 Ga0068852_100561429 Ga0068852_1005614291 172
177 3300005617 Ga0068859_100653250 Ga0068859_1006532502 172
178 3300005618 Ga0068864_100089681 Ga0068864_1000896812 172
179 3300005834 Ga0068851_10023486 Ga0068851_100234864 172
180 3300005841 Ga0068863_100310819 Ga0068863_1003108192 172
181 3300005843 Ga0068860_100610639 Ga0068860_1006106393 172
182 3300005844 Ga0068862_100216656 Ga0068862_1002166562 172
183 3300006038 Ga0075365_10353607 Ga0075365_103536072 172
184 3300006038 Ga0075365_10476870 Ga0075365_104768702 172
185 3300006038 Ga0075365_10532293 Ga0075365_105322932 172
186 3300006042 Ga0075368_10070241 Ga0075368_100702412 172
187 3300006048 Ga0075363_100001372 Ga0075363_1000013727 172
188 3300006048 Ga0075363_100003657 Ga0075363_1000036573 172
189 3300006048 Ga0075363_100044593 Ga0075363_1000445932 172
190 3300006051 Ga0075364_10053787 Ga0075364_100537873 172
191 3300006051 Ga0075364_10078271 Ga0075364_100782712 172
192 3300006177 Ga0075362_10016056 Ga0075362_100160562 172
193 3300006177 Ga0075362_10044435 Ga0075362_100444352 172
194 3300006178 Ga0075367_10012600 Ga0075367_100126004 172
195 3300006178 Ga0075367_10038176 Ga0075367_100381762 172
196 3300006178 Ga0075367_10047708 Ga0075367_100477084 172
197 3300006178 Ga0075367_10109050 Ga0075367_101090503 172
198 3300006195 Ga0075366_10001124 Ga0075366_100011245 172
199 3300006195 Ga0075366_10035701 Ga0075366_100357013 172
200 3300006195 Ga0075366_10037137 Ga0075366_100371372 172
201 3300006195 Ga0075366_10139790 Ga0075366_101397902 172
202 3300006195 Ga0075366_10200592 Ga0075366_102005921 172
203 3300006195 Ga0075366_10213890 Ga0075366_102138901 172
204 3300006195 Ga0075366_10244350 Ga0075366_102443502 172
205 3300006237 Ga0097621_100086862 Ga0097621_1000868622 172
206 3300006237 Ga0097621_100368613 Ga0097621_1003686133 172
207 3300006353 Ga0075370_10008279 Ga0075370_100082792 172
208 3300006353 Ga0075370_10011875 Ga0075370_100118754 172
209 3300006353 Ga0075370_10045060 Ga0075370_100450603 172
210 3300006353 Ga0075370_10066640 Ga0075370_100666404 172
211 3300006353 Ga0075370_10106028 Ga0075370_101060282 172
212 3300006353 Ga0075370_10125392 Ga0075370_101253921 172
213 3300006353 Ga0075370_10138122 Ga0075370_101381221 172
214 3300006353 Ga0075370_10265843 Ga0075370_102658432 172
215 3300006358 Ga0068871_100064039 Ga0068871_1000640392 172
216 3300006880 Ga0075429_100001431 Ga0075429_10000143115 172
217 3300006931 Ga0097620_100653218 Ga0097620_1006532182 172
218 3300006946 Ga0079104_1000017 Ga0079104_1000017127 172
219 3300006946 Ga0079104_1013999 Ga0079104_10139992 172
220 3300006946 Ga0079104_1016037 Ga0079104_10160372 172
221 3300006948 Ga0099826_10029080 Ga0099826_100290804 172
222 3300009093 Ga0105240_10371230 Ga0105240_103712303 172
223 3300009098 Ga0105245_10088009 Ga0105245_100880092 172
224 3300009098 Ga0105245_10579257 Ga0105245_105792572 172
225 3300009148 Ga0105243_10000486 Ga0105243_1000048629 172
226 3300009148 Ga0105243_10003068 Ga0105243_1000306815 172
227 3300009148 Ga0105243_10003231 Ga0105243_1000323115 172
228 3300009148 Ga0105243_10012628 Ga0105243_100126285 172
229 3300009177 Ga0105248_10772524 Ga0105248_107725242 172
230 3300012502 Ga0157347_1001460 Ga0157347_10014603 172
231 3300013100 Ga0157373_10126088 Ga0157373_101260882 172
232 3300013104 Ga0157370_10014128 Ga0157370_100141284 172
233 3300013104 Ga0157370_10614824 Ga0157370_106148242 172
234 3300013306 Ga0163162_10256232 Ga0163162_102562322 172
235 3300013307 Ga0157372_10280863 Ga0157372_102808632 172
236 3300013308 Ga0157375_10121684 Ga0157375_101216843 172
237 3300014326 Ga0157380_10618780 Ga0157380_106187802 172
238 3300014497 Ga0182008_10000093 Ga0182008_1000009391 172
239 3300014497 Ga0182008_10001960 Ga0182008_100019603 172
240 3300014497 Ga0182008_10009359 Ga0182008_100093592 172
241 3300014497 Ga0182008_10094641 Ga0182008_100946412 172
242 3300014745 Ga0157377_10000035 Ga0157377_10000035112 172
243 3300014968 Ga0157379_10361175 Ga0157379_103611752 172
244 3300015261 Ga0182006_1001354 Ga0182006_100135416 172
245 3300017792 Ga0163161_10001250 Ga0163161_100012507 172
246 3300017792 Ga0163161_10110174 Ga0163161_101101743 172
247 3300017792 Ga0163161_10126217 Ga0163161_101262174 172
248 3300021361 Ga0213872_10009993 Ga0213872_100099932 172
249 3300025206 Ga0209435_100001 Ga0209435_1000011053 172
250 3300025208 Ga0209436_101446 Ga0209436_1014464 172
251 3300025228 Ga0209672_100222 Ga0209672_10022212 172
252 3300025229 Ga0209147_100435 Ga0209147_10043522 172
253 3300025242 Ga0209258_100048 Ga0209258_100048247 172
254 3300025245 Ga0207425_1000786 Ga0207425_100078616 172
255 3300025245 Ga0207425_1001555 Ga0207425_10015559 172
256 3300025245 Ga0207425_1010433 Ga0207425_10104333 172
257 3300025245 Ga0207425_1034381 Ga0207425_10343812 172
258 3300025246 Ga0209646_1000001 Ga0209646_10000011422 172
259 3300025250 Ga0209026_1000001 Ga0209026_100000174 172
260 3300025254 Ga0209148_1000040 Ga0209148_1000040247 172
261 3300025256 Ga0209759_1000001 Ga0209759_10000011053 172
262 3300025258 Ga0209129_1000007 Ga0209129_1000007137 172
263 3300025258 Ga0209129_1001205 Ga0209129_100120517 172
264 3300025258 Ga0209129_1006871 Ga0209129_10068714 172
265 3300025258 Ga0209129_1019697 Ga0209129_10196973 172
266 3300025263 Ga0209565_1000153 Ga0209565_100015364 172
267 3300025263 Ga0209565_1001390 Ga0209565_10013904 172
268 3300025263 Ga0209565_1003425 Ga0209565_10034254 172
269 3300025263 Ga0209565_1005018 Ga0209565_10050184 172
270 3300025263 Ga0209565_1009673 Ga0209565_10096732 172
271 3300025263 Ga0209565_1023257 Ga0209565_10232571 172
272 3300025273 Ga0209673_1000423 Ga0209673_100042343 172
273 3300025273 Ga0209673_1000566 Ga0209673_100056642 172
274 3300025273 Ga0209673_1000801 Ga0209673_100080118 172
275 3300025273 Ga0209673_1024378 Ga0209673_10243784 172
276 3300025273 Ga0209673_1050910 Ga0209673_10509102 172
277 3300025284 Ga0209130_1000041 Ga0209130_100004190 172
278 3300025284 Ga0209130_1000953 Ga0209130_100095312 172
279 3300025284 Ga0209130_1001018 Ga0209130_100101811 172
280 3300025284 Ga0209130_1001734 Ga0209130_100173415 172
281 3300025291 Ga0209675_1000150 Ga0209675_100015064 172
282 3300025291 Ga0209675_1001481 Ga0209675_100148115 172
283 3300025291 Ga0209675_1002237 Ga0209675_100223714 172
284 3300025291 Ga0209675_1002661 Ga0209675_10026616 172
285 3300025291 Ga0209675_1002884 Ga0209675_10028846 172
286 3300025291 Ga0209675_1015968 Ga0209675_10159682 172
287 3300025291 Ga0209675_1021121 Ga0209675_10211214 172
288 3300025291 Ga0209675_1028625 Ga0209675_10286252 172
289 3300025291 Ga0209675_1035537 Ga0209675_10355372 172
290 3300025292 Ga0209676_1000004 Ga0209676_1000004887 172
291 3300025292 Ga0209676_1000054 Ga0209676_1000054278 172
292 3300025292 Ga0209676_1000735 Ga0209676_100073533 172
293 3300025292 Ga0209676_1001743 Ga0209676_100174318 172
294 3300025292 Ga0209676_1002326 Ga0209676_100232616 172
295 3300025292 Ga0209676_1002586 Ga0209676_100258613 172
296 3300025292 Ga0209676_1004231 Ga0209676_10042318 172
297 3300025292 Ga0209676_1015972 Ga0209676_10159723 172
298 3300025294 Ga0209025_1000217 Ga0209025_100021782 172
299 3300025294 Ga0209025_1000278 Ga0209025_100027828 172
300 3300025294 Ga0209025_1001179 Ga0209025_100117919 172
301 3300025294 Ga0209025_1003927 Ga0209025_100392711 172
302 3300025294 Ga0209025_1006669 Ga0209025_10066696 172
303 3300025294 Ga0209025_1029535 Ga0209025_10295352 172
304 3300025294 Ga0209025_1031916 Ga0209025_10319162 172
305 3300025294 Ga0209025_1064423 Ga0209025_10644232 172
306 3300025295 Ga0209564_1000915 Ga0209564_10009156 172
307 3300025295 Ga0209564_1002066 Ga0209564_100206614 172
308 3300025295 Ga0209564_1007036 Ga0209564_10070366 172
309 3300025297 Ga0209758_1000025 Ga0209758_1000025389 172
310 3300025297 Ga0209758_1002316 Ga0209758_100231618 172
311 3300025297 Ga0209758_1047685 Ga0209758_10476852 172
312 3300025298 Ga0209050_1000002 Ga0209050_10000021397 172
313 3300025298 Ga0209050_1000066 Ga0209050_1000066278 172
314 3300025298 Ga0209050_1000651 Ga0209050_100065135 172
315 3300025298 Ga0209050_1000861 Ga0209050_100086113 172
316 3300025298 Ga0209050_1002866 Ga0209050_100286612 172
317 3300025298 Ga0209050_1012119 Ga0209050_10121192 172
318 3300025298 Ga0209050_1026025 Ga0209050_10260252 172
319 3300025299 Ga0209256_1000003 Ga0209256_10000031550 172
320 3300025299 Ga0209256_1000011 Ga0209256_1000011566 172
321 3300025299 Ga0209256_1000067 Ga0209256_1000067204 172
322 3300025299 Ga0209256_1000366 Ga0209256_100036628 172
323 3300025302 Ga0207426_1000001 Ga0207426_1000001189 172
324 3300025302 Ga0207426_1000028 Ga0207426_100002879 172
325 3300025302 Ga0207426_1000061 Ga0207426_1000061151 172
326 3300025303 Ga0209051_1000002 Ga0209051_10000021167 172
327 3300025303 Ga0209051_1000024 Ga0209051_1000024321 172
328 3300025303 Ga0209051_1000044 Ga0209051_1000044278 172
329 3300025303 Ga0209051_1000049 Ga0209051_1000049257 172
330 3300025303 Ga0209051_1000096 Ga0209051_100009618 172
331 3300025303 Ga0209051_1000430 Ga0209051_100043013 172
332 3300025303 Ga0209051_1000532 Ga0209051_100053216 172
333 3300025303 Ga0209051_1000913 Ga0209051_100091313 172
334 3300025303 Ga0209051_1004959 Ga0209051_10049593 172
335 3300025303 Ga0209051_1013466 Ga0209051_10134664 172
336 3300025304 Ga0209257_1000002 Ga0209257_10000021308 172
337 3300025304 Ga0209257_1000012 Ga0209257_1000012164 172
338 3300025304 Ga0209257_1000072 Ga0209257_1000072310 172
339 3300025304 Ga0209257_1000082 Ga0209257_1000082278 172
340 3300025304 Ga0209257_1001131 Ga0209257_10011319 172
341 3300025304 Ga0209257_1005948 Ga0209257_10059483 172
342 3300025304 Ga0209257_1013234 Ga0209257_10132344 172
343 3300025304 Ga0209257_1017381 Ga0209257_10173812 172
344 3300025321 Ga0207656_10079144 Ga0207656_100791442 172
345 3300025907 Ga0207645_10356221 Ga0207645_103562212 172
346 3300025908 Ga0207643_10353005 Ga0207643_103530052 172
347 3300025909 Ga0207705_10267575 Ga0207705_102675752 172
348 3300025909 Ga0207705_10371042 Ga0207705_103710422 172
349 3300025911 Ga0207654_10597833 Ga0207654_105978332 172
350 3300025913 Ga0207695_10612545 Ga0207695_106125452 172
351 3300025919 Ga0207657_10150341 Ga0207657_101503412 172
352 3300025920 Ga0207649_10016746 Ga0207649_100167462 172
353 3300025920 Ga0207649_10152945 Ga0207649_101529453 172
354 3300025927 Ga0207687_11072644 Ga0207687_110726441 172
355 3300025931 Ga0207644_10197781 Ga0207644_101977813 172
356 3300025932 Ga0207690_10001103 Ga0207690_1000110316 172
357 3300025933 Ga0207706_10023334 Ga0207706_100233344 172
358 3300025933 Ga0207706_10764444 Ga0207706_107644441 172
359 3300025935 Ga0207709_10000193 Ga0207709_100001935 172
360 3300025935 Ga0207709_10000348 Ga0207709_1000034836 172
361 3300025935 Ga0207709_10001710 Ga0207709_1000171017 172
362 3300025935 Ga0207709_10006258 Ga0207709_100062584 172
363 3300025935 Ga0207709_10007492 Ga0207709_100074926 172
364 3300025937 Ga0207669_10088010 Ga0207669_100880103 172
365 3300025940 Ga0207691_10098794 Ga0207691_100987944 172
366 3300025940 Ga0207691_10329808 Ga0207691_103298082 172
367 3300025941 Ga0207711_10948082 Ga0207711_109480821 172
368 3300025942 Ga0207689_10337837 Ga0207689_103378372 172
369 3300025945 Ga0207679_10000368 Ga0207679_1000036834 172
370 3300025945 Ga0207679_10122288 Ga0207679_101222882 172
371 3300025972 Ga0207668_10162279 Ga0207668_101622792 172
372 3300025981 Ga0207640_10159836 Ga0207640_101598364 172
373 3300025986 Ga0207658_11106100 Ga0207658_111061001 172
374 3300026023 Ga0207677_10217484 Ga0207677_102174843 172
375 3300026035 Ga0207703_10510039 Ga0207703_105100392 172
376 3300026035 Ga0207703_11152408 Ga0207703_111524082 172
377 3300026041 Ga0207639_10013989 Ga0207639_100139892 172
378 3300026041 Ga0207639_10247606 Ga0207639_102476062 172
379 3300026041 Ga0207639_10288915 Ga0207639_102889152 172
380 3300026067 Ga0207678_10000500 Ga0207678_1000050022 172
381 3300026067 Ga0207678_10422184 Ga0207678_104221842 172
382 3300026089 Ga0207648_10000040 Ga0207648_10000040112 172
383 3300026095 Ga0207676_10604803 Ga0207676_106048032 172
384 3300026116 Ga0207674_10091491 Ga0207674_100914913 172
385 3300026116 Ga0207674_10185677 Ga0207674_101856774 172
386 3300026121 Ga0207683_10406234 Ga0207683_104062342 172
387 3300026121 Ga0207683_10433370 Ga0207683_104333702 172
388 3300026121 Ga0207683_11020196 Ga0207683_110201962 172
389 3300027111 Ga0209281_1000020 Ga0209281_1000020145 172
390 3300027111 Ga0209281_1000042 Ga0209281_1000042220 172
391 3300027252 Ga0209973_1010653 Ga0209973_10106532 172
392 3300027614 Ga0209970_1001115 Ga0209970_10011152 172
393 3300027665 Ga0209983_1119185 Ga0209983_11191851 172
394 3300027666 Ga0209282_1010228 Ga0209282_10102282 172
395 3300027876 Ga0209974_10001570 Ga0209974_100015707 172
396 3300027876 Ga0209974_10040175 Ga0209974_100401752 172
397 3300027876 Ga0209974_10075366 Ga0209974_100753661 172
398 3300027907 Ga0207428_10365639 Ga0207428_103656392 172
399 3300028379 Ga0268266_10014410 Ga0268266_100144106 172
400 3300028380 Ga0268265_10172957 Ga0268265_101729572 172
401 3300028381 Ga0268264_10233395 Ga0268264_102333954 172
402 3300028786 Ga0307517_10000805 Ga0307517_1000080510 172
403 3300028786 Ga0307517_10479431 Ga0307517_104794311 172
404 3300028794 Ga0307515_10001342 Ga0307515_1000134231 172
405 3300028794 Ga0307515_10002612 Ga0307515_100026123 172
406 3300028794 Ga0307515_10013171 Ga0307515_100131713 172
407 3300028794 Ga0307515_10019472 Ga0307515_100194725 172
408 3300028794 Ga0307515_10084485 Ga0307515_100844852 172
409 3300028794 Ga0307515_10314414 Ga0307515_103144142 172
410 3300028794 Ga0307515_10570329 Ga0307515_105703291 172
411 3300030522 Ga0307512_10019179 Ga0307512_100191795 172
412 3300030522 Ga0307512_10044313 Ga0307512_100443134 172
413 3300030522 Ga0307512_10115617 Ga0307512_101156172 172
414 3300030731 Ga0316177_1181706 Ga0316177_11817062 172
415 3300030732 Ga0316176_1208777 Ga0316176_12087776 172
416 3300030733 Ga0314311_1026962 Ga0314311_10269623 172
417 3300030734 Ga0316179_1036211 Ga0316179_10362113 172
418 3300030735 Ga0316178_1055728 Ga0316178_10557281 172
419 3300030736 Ga0316180_1157758 Ga0316180_11577583 172
420 3300030742 Ga0316183_1008427 Ga0316183_10084271 172
421 3300030742 Ga0316183_1017320 Ga0316183_10173203 172
422 3300030744 Ga0316181_1160208 Ga0316181_11602083 172
423 3300030745 Ga0316182_1388978 Ga0316182_13889782 172
424 3300031235 Ga0265330_10000675 Ga0265330_1000067513 172
425 3300031238 Ga0265332_10000002 Ga0265332_10000002183 172
426 3300031241 Ga0265325_10035119 Ga0265325_100351192 172
427 3300031247 Ga0265340_10009932 Ga0265340_100099326 172
428 3300031456 Ga0307513_10000285 Ga0307513_100002856 172
429 3300031456 Ga0307513_10279241 Ga0307513_102792413 172
430 3300031456 Ga0307513_10818655 Ga0307513_108186551 172
431 3300031507 Ga0307509_10001946 Ga0307509_1000194631 172
432 3300031507 Ga0307509_10045814 Ga0307509_100458145 172
433 3300031507 Ga0307509_10078909 Ga0307509_100789092 172
434 3300031507 Ga0307509_10251580 Ga0307509_102515802 172
435 3300031507 Ga0307509_10310849 Ga0307509_103108493 172
436 3300031548 Ga0307408_100008062 Ga0307408_10000806210 172
437 3300031548 Ga0307408_100008200 Ga0307408_10000820010 172
438 3300031548 Ga0307408_100076543 Ga0307408_1000765432 172
439 3300031548 Ga0307408_100096423 Ga0307408_1000964232 172
440 3300031548 Ga0307408_100352697 Ga0307408_1003526972 172
441 3300031548 Ga0307408_100362532 Ga0307408_1003625323 172
442 3300031616 Ga0307508_10000004 Ga0307508_10000004102 172
443 3300031616 Ga0307508_10000078 Ga0307508_1000007824 172
444 3300031616 Ga0307508_10002611 Ga0307508_100026115 172
445 3300031649 Ga0307514_10023123 Ga0307514_100231235 172
446 3300031649 Ga0307514_10032879 Ga0307514_100328792 172
447 3300031711 Ga0265314_10000012 Ga0265314_10000012202 172
448 3300031730 Ga0307516_10009495 Ga0307516_100094954 172
449 3300031730 Ga0307516_10046323 Ga0307516_100463233 172
450 3300031730 Ga0307516_10285418 Ga0307516_102854182 172
451 3300031730 Ga0307516_10286274 Ga0307516_102862742 172
452 3300031730 Ga0307516_10433175 Ga0307516_104331752 172
453 3300031730 Ga0307516_10455297 Ga0307516_104552972 172
454 3300031731 Ga0307405_10093525 Ga0307405_100935252 172
455 3300031731 Ga0307405_10110081 Ga0307405_101100812 172
456 3300031731 Ga0307405_10310694 Ga0307405_103106942 172
457 3300031731 Ga0307405_10427985 Ga0307405_104279852 172
458 3300031731 Ga0307405_10444466 Ga0307405_104444662 172
459 3300031731 Ga0307405_10521100 Ga0307405_105211002 172
460 3300031731 Ga0307405_10548974 Ga0307405_105489742 172
461 3300031852 Ga0307410_10176786 Ga0307410_101767862 172
462 3300031901 Ga0307406_10084134 Ga0307406_100841343 172
463 3300031901 Ga0307406_10084329 Ga0307406_100843291 172
464 3300031901 Ga0307406_10237368 Ga0307406_102373682 172
465 3300031901 Ga0307406_10482323 Ga0307406_104823232 172
466 3300031903 Ga0307407_10265419 Ga0307407_102654193 172
467 3300031911 Ga0307412_10021895 Ga0307412_100218952 172
468 3300031911 Ga0307412_10031954 Ga0307412_100319543 172
469 3300031911 Ga0307412_10105019 Ga0307412_101050192 172
470 3300031911 Ga0307412_10373355 Ga0307412_103733552 172
471 3300031911 Ga0307412_10674874 Ga0307412_106748741 172
472 3300032002 Ga0307416_100258600 Ga0307416_1002586003 172
473 3300032002 Ga0307416_101057913 Ga0307416_1010579131 172
474 3300032005 Ga0307411_10043221 Ga0307411_100432214 172
475 3300032005 Ga0307411_10154442 Ga0307411_101544423 172
476 3300032005 Ga0307411_11167906 Ga0307411_111679062 172
477 3300032126 Ga0307415_101110832 Ga0307415_1011108321 172
478 3300033179 Ga0307507_10164168 Ga0307507_101641683 172
479 3300033180 Ga0307510_10017087 Ga0307510_100170877 172
480 3300033180 Ga0307510_10041763 Ga0307510_100417634 172
481 3300035084 Ga0373928_0015290 Ga0373928_0015290_494_1018 172
482 3300035112 Ga0373932_0057300 Ga0373932_0057300_270_794 172
483 3300036401 Ga0373937_0498956 Ga0373937_0498956_69_587 172
484 3300037068 Ga0373925_0596284 Ga0373925_0596284_222_746 172
485 3300037418 Ga0395900_0050252 Ga0395900_0050252_3158_3682 172
486 3300037418 Ga0395900_0414718 Ga0395900_0414718_500_1021 172
487 3300037466 Ga0395898_0010705 Ga0395898_0010705_644_1168 172
488 3300037471 Ga0395905_0036288 Ga0395905_0036288_2307_2828 172
489 3300037471 Ga0395905_0037264 Ga0395905_0037264_3793_4317 172
490 3300037471 Ga0395905_0088118 Ga0395905_0088118_300_818 172
491 3300038443 Ga0395901_0084441 Ga0395901_0084441_2320_2844 172
492 3300039447 Ga0436361_0474781 Ga0436361_0474781_5359_5877 172
493 3300041404 Ga0439436_0019407 Ga0439436_0019407_406_924 172
494 3300041406 Ga0439439_0000304 Ga0439439_0000304_1081_1623 172
495 3300041410 Ga0439461_0003861 Ga0439461_0003861_246_764 172
496 3300041410 Ga0439461_0022695 Ga0439461_0022695_79_621 172
497 3300041411 Ga0439466_0002298 Ga0439466_0002298_6163_6705 172
498 3300041411 Ga0439466_0032790 Ga0439466_0032790_1196_1714 172
499 3300041413 Ga0439465_0001722 Ga0439465_0001722_854_1372 172
500 3300041451 Ga0451791_1504222 Ga0451791_1504222_307_825 172
501 3300041451 Ga0451791_1831968 Ga0451791_1831968_112_630 172
502 3300041452 Ga0451793_0420993 Ga0451793_0420993_37_555 172
503 3300041452 Ga0451793_0790542 Ga0451793_0790542_98_616 172
504 3300041456 Ga0451795_0269663 Ga0451795_0269663_780_1298 172
505 3300041458 Ga0451798_0014371 Ga0451798_0014371_452_970 172
506 3300041459 Ga0451800_0719183 Ga0451800_0719183_436_954 172
507 3300041460 Ga0451802_0064298 Ga0451802_0064298_851_1369 172
508 3300041460 Ga0451802_1637868 Ga0451802_1637868_207_758 172
509 3300041496 Ga0451839_0261286 Ga0451839_0261286_137_655 172
510 3300041496 Ga0451839_0744399 Ga0451839_0744399_150_668 172
511 3300041503 Ga0451847_0695134 Ga0451847_0695134_43_594 172
512 3300041507 Ga0451851_0477554 Ga0451851_0477554_134_652 172
513 3300041507 Ga0451851_0721193 Ga0451851_0721193_491_1009 172
514 3300041997 Ga0439431_0002206 Ga0439431_0002206_1336_1854 172
515 3300041997 Ga0439431_0011466 Ga0439431_0011466_516_1058 172
516 3300042004 Ga0439445_0000315 Ga0439445_0000315_5735_6253 172
517 3300042006 Ga0439432_002851 Ga0439432_002851_183_701 172
518 3300042006 Ga0439432_018080 Ga0439432_018080_10_552 172
519 3300042007 Ga0439449_0002911 Ga0439449_0002911_5589_6131 172
520 3300042007 Ga0439449_0004348 Ga0439449_0004348_1478_1996 172
521 3300042007 Ga0439449_0009187 Ga0439449_0009187_1026_1544 172
522 3300042010 Ga0439452_001163 Ga0439452_001163_1153_1671 172
523 3300042010 Ga0439452_023585 Ga0439452_023585_898_1440 172
524 3300042014 Ga0439457_006138 Ga0439457_006138_1897_2439 172
525 3300042014 Ga0439457_043301 Ga0439457_043301_233_751 172
526 3300042015 Ga0439462_0003593 Ga0439462_0003593_554_1096 172
527 3300042116 Ga0450912_001147 Ga0450912_001147_973_1491 172
528 3300042128 Ga0450897_002784 Ga0450897_002784_476_1018 172
529 3300042133 Ga0450896_014578 Ga0450896_014578_446_988 172
530 3300042142 Ga0450905_027826 Ga0450905_027826_254_772 172
531 3300042156 Ga0439446_0006142 Ga0439446_0006142_1426_1944 172
532 3300042156 Ga0439446_0046454 Ga0439446_0046454_51_569 172
533 3300042157 Ga0439458_0083748 Ga0439458_0083748_278_796 172
534 3300042185 Ga0450909_003341 Ga0450909_003341_318_860 172
535 3300042435 Ga0439434_0002020 Ga0439434_0002020_226_744 172
536 3300042435 Ga0439434_0026783 Ga0439434_0026783_994_1536 172
537 3300042438 Ga0439459_0049516 Ga0439459_0049516_320_862 172
538 3300042438 Ga0439459_0067137 Ga0439459_0067137_49_567 172
539 3300042439 Ga0439464_0004567 Ga0439464_0004567_1605_2123 172
540 3300042461 Ga0439460_0237228 Ga0439460_0237228_36_554 172
541 3300042532 Ga0450893_0000990 Ga0450893_0000990_1066_1584 172
542 3300042876 Ga0451577_0924304 Ga0451577_0924304_218_751 172
543 3300044712 Ga0453684_0440397 Ga0453684_0440397_43_561 172
544 3300045051 Ga0451576_0123662 Ga0451576_0123662_2127_2651 172
545 3300045976 Ga0466967_0850764 Ga0466967_0850764_110_628 172
546 3300046454 Ga0495592_0008709 Ga0495592_0008709_6375_6893 172
547 3300046460 Ga0495638_0117704 Ga0495638_0117704_527_1045 172
548 3300046473 Ga0495582_0102426 Ga0495582_0102426_111_635 172
549 3300046512 Ga0495610_0023385 Ga0495610_0023385_2360_2878 172
550 3300046512 Ga0495610_0025850 Ga0495610_0025850_470_1012 172
551 3300046512 Ga0495610_0167991 Ga0495610_0167991_374_892 172
552 3300046513 Ga0495616_0020913 Ga0495616_0020913_1118_1660 172
553 3300046515 Ga0495620_0010437 Ga0495620_0010437_1658_2200 172
554 3300046515 Ga0495620_0091302 Ga0495620_0091302_373_891 172
555 3300046516 Ga0495628_0280774 Ga0495628_0280774_499_1023 172
556 3300046517 Ga0495630_0318281 Ga0495630_0318281_156_680 172
557 3300046518 Ga0495631_0002748 Ga0495631_0002748_9067_9609 172
558 3300046519 Ga0495632_0009715 Ga0495632_0009715_3984_4502 172
559 3300046519 Ga0495632_0056661 Ga0495632_0056661_34_552 172
560 3300046520 Ga0495637_0029215 Ga0495637_0029215_1103_1645 172
561 3300046520 Ga0495637_0072987 Ga0495637_0072987_461_1003 172
562 3300046520 Ga0495637_0174877 Ga0495637_0174877_233_775 172
563 3300046525 Ga0495663_0087722 Ga0495663_0087722_10_528 172
564 3300046530 Ga0495654_0216249 Ga0495654_0216249_89_631 172
565 3300046530 Ga0495654_0363409 Ga0495654_0363409_16_558 172
566 3300046538 Ga0495609_0118628 Ga0495609_0118628_283_825 172
567 3300046539 Ga0495621_0006967 Ga0495621_0006967_620_1162 172
568 3300046539 Ga0495621_0099636 Ga0495621_0099636_285_827 172
569 3300046539 Ga0495621_0153126 Ga0495621_0153126_326_844 172
570 3300046542 Ga0495597_0000153 Ga0495597_0000153_604_1122 172
571 3300046557 Ga0495622_0092513 Ga0495622_0092513_527_1051 172
572 3300046558 Ga0495633_0000827 Ga0495633_0000827_25643_26188 172
573 3300046558 Ga0495633_0117411 Ga0495633_0117411_105_647 172
574 3300046615 Ga0495656_0000929 Ga0495656_0000929_3044_3586 172
575 3300046615 Ga0495656_0342951 Ga0495656_0342951_13_531 172
576 3300046616 Ga0495668_0389801 Ga0495668_0389801_105_632 172
577 3300046660 Ga0495625_0015771 Ga0495625_0015771_2529_3047 172
578 3300046660 Ga0495625_0051251 Ga0495625_0051251_2300_2842 172
579 3300046664 Ga0495659_0174097 Ga0495659_0174097_14_532 172
580 3300046674 Ga0495588_0063669 Ga0495588_0063669_448_990 172
581 3300046674 Ga0495588_0101704 Ga0495588_0101704_352_894 172
582 3300046683 Ga0495658_0039537 Ga0495658_0039537_398_922 172
583 3300046683 Ga0495658_0079416 Ga0495658_0079416_518_1060 172
584 3300046684 Ga0495669_0272242 Ga0495669_0272242_191_709 172
585 3300046691 Ga0495670_0029469 Ga0495670_0029469_40_582 172
586 3300046691 Ga0495670_0130388 Ga0495670_0130388_311_853 172
587 3300046692 Ga0495671_0019317 Ga0495671_0019317_390_932 172
588 3300047321 Ga0495676_0007147 Ga0495676_0007147_3845_4387 172
589 3300047445 Ga0495677_0019590 Ga0495677_0019590_1191_1709 172
590 3300047445 Ga0495677_0053846 Ga0495677_0053846_376_918 172
591 3300047447 Ga0495685_030533 Ga0495685_030533_1010_1528 172
592 3300047470 Ga0495681_0221901 Ga0495681_0221901_26_568 172
593 3300047472 Ga0495686_0047420 Ga0495686_0047420_148_666 172
594 3300047673 Ga0495593_0006672 Ga0495593_0006672_5826_6368 172
595 3300048088 Ga0495602_0158368 Ga0495602_0158368_35_577 172
596 3300048905 Ga0496102_0109713 Ga0496102_0109713_1275_1817 172
597 3300048910 Ga0496107_0156616 Ga0496107_0156616_85_627 172
598 3300048913 Ga0496110_0027229 Ga0496110_0027229_1019_1543 172
599 3300048913 Ga0496110_0956566 Ga0496110_0956566_94_618 172
600 3300048916 Ga0496113_0270259 Ga0496113_0270259_234_752 172
601 3300048917 Ga0496114_0004085 Ga0496114_0004085_6433_6951 172
602 3300048917 Ga0496114_0821022 Ga0496114_0821022_156_674 172
603 3300048918 Ga0496115_0385765 Ga0496115_0385765_12_530 172
604 3300048919 Ga0496116_0080697 Ga0496116_0080697_698_1216 172
605 3300048920 Ga0496117_0038912 Ga0496117_0038912_2017_2535 172
606 3300048920 Ga0496117_0071291 Ga0496117_0071291_979_1521 172
607 3300048920 Ga0496117_0302614 Ga0496117_0302614_41_583 172
608 3300048921 Ga0496118_0032460 Ga0496118_0032460_2281_2823 172
609 3300048921 Ga0496118_0180480 Ga0496118_0180480_538_1080 172
610 3300048922 Ga0496119_0190562 Ga0496119_0190562_24_566 172
611 3300048924 Ga0496121_0050847 Ga0496121_0050847_1940_2482 172
612 3300048924 Ga0496121_0132622 Ga0496121_0132622_393_935 172
613 3300048925 Ga0496122_0000103 Ga0496122_0000103_100636_101154 172
614 3300048925 Ga0496122_0056621 Ga0496122_0056621_2285_2827 172
615 3300048925 Ga0496122_0118048 Ga0496122_0118048_760_1278 172
616 3300048926 Ga0496123_0000261 Ga0496123_0000261_95098_95616 172
617 3300048926 Ga0496123_0020532 Ga0496123_0020532_1227_1769 172
618 3300048926 Ga0496123_0245793 Ga0496123_0245793_252_773 172
619 3300048927 Ga0496124_0051070 Ga0496124_0051070_670_1212 172
620 3300048927 Ga0496124_0082070 Ga0496124_0082070_1594_2136 172
621 3300048927 Ga0496124_0102304 Ga0496124_0102304_305_847 172
622 3300048927 Ga0496124_0123885 Ga0496124_0123885_181_699 172
623 3300048928 Ga0496125_0007765 Ga0496125_0007765_10272_10790 172
624 3300048928 Ga0496125_0031217 Ga0496125_0031217_3084_3602 172
625 3300048928 Ga0496125_0037783 Ga0496125_0037783_3511_4029 172
626 3300048928 Ga0496125_0134457 Ga0496125_0134457_1146_1688 172
627 3300048928 Ga0496125_0140009 Ga0496125_0140009_928_1470 172
628 3300048928 Ga0496125_0336233 Ga0496125_0336233_344_886 172
629 3300049571 Ga0501034_0381306 Ga0501034_0381306_489_1007 172
630 3300049580 Ga0501046_0119725 Ga0501046_0119725_280_825 172
631 3300049581 Ga0501047_0092095 Ga0501047_0092095_1089_1607 172
632 3300049671 Ga0501238_001607 Ga0501238_001607_1999_2517 172
633 3300049679 Ga0501249_011971 Ga0501249_011971_54_572 172
634 3300049686 Ga0501257_048914 Ga0501257_048914_423_941 172
635 3300049705 Ga0501225_0008398 Ga0501225_0008398_1103_1621 172
636 3300049822 Ga0501035_0151722 Ga0501035_0151722_477_995 172
637 3300049823 Ga0501044_0144395 Ga0501044_0144395_1210_1728 172
638 3300050489 nmdc:mga03683_103702_c1 nmdc:mga03683_103702_c1_108_626 172
639 3300050489 nmdc:mga03683_229640_c1 nmdc:mga03683_229640_c1_279_797 172
640 3300050489 nmdc:mga03683_36449_c1 nmdc:mga03683_36449_c1_1100_1618 172
641 3300050489 nmdc:mga03683_71279_c1 nmdc:mga03683_71279_c1_181_750 172
642 3300050489 nmdc:mga03683_77769_c1 nmdc:mga03683_77769_c1_829_1371 172
643 3300050490 nmdc:mga03n38_126332_c1 nmdc:mga03n38_126332_c1_53_571 172
644 3300050490 nmdc:mga03n38_19647_c1 nmdc:mga03n38_19647_c1_63_581 172
645 3300050490 nmdc:mga03n38_238081_c1 nmdc:mga03n38_238081_c1_296_814 172
646 3300050490 nmdc:mga03n38_445120_c1 nmdc:mga03n38_445120_c1_35_553 172
647 3300050491 nmdc:mga00v17_25049_c1 nmdc:mga00v17_25049_c1_1951_2469 172
648 3300050491 nmdc:mga00v17_36752_c1 nmdc:mga00v17_36752_c1_1722_2240 172
649 3300050491 nmdc:mga00v17_484765_c1 nmdc:mga00v17_484765_c1_215_757 172
650 3300050492 nmdc:mga0yw44_2117_c1 nmdc:mga0yw44_2117_c1_3941_4459 172
651 3300050492 nmdc:mga0yw44_302968_c1 nmdc:mga0yw44_302968_c1_419_937 172
652 3300050492 nmdc:mga0yw44_404770_c1 nmdc:mga0yw44_404770_c1_360_878 172
653 3300050493 nmdc:mga0k408_110780_c1 nmdc:mga0k408_110780_c1_864_1382 172
654 3300050493 nmdc:mga0k408_13250_c1 nmdc:mga0k408_13250_c1_2214_2732 172
655 3300050493 nmdc:mga0k408_167179_c1 nmdc:mga0k408_167179_c1_302_829 172
656 3300050493 nmdc:mga0k408_181128_c1 nmdc:mga0k408_181128_c1_233_751 172
657 3300050493 nmdc:mga0k408_22221_c1 nmdc:mga0k408_22221_c1_990_1508 172
658 3300050493 nmdc:mga0k408_224887_c1 nmdc:mga0k408_224887_c1_343_861 172
659 3300050493 nmdc:mga0k408_78454_c1 nmdc:mga0k408_78454_c1_1356_1898 172
660 3300050494 nmdc:mga06z11_140247_c1 nmdc:mga06z11_140247_c1_616_1134 172
661 3300050494 nmdc:mga06z11_225563_c1 nmdc:mga06z11_225563_c1_497_1015 172
662 3300050494 nmdc:mga06z11_578311_c1 nmdc:mga06z11_578311_c1_27_545 172
663 3300050496 nmdc:mga07m45_102670_c1 nmdc:mga07m45_102670_c1_183_701 172
664 3300050496 nmdc:mga07m45_104831_c1 nmdc:mga07m45_104831_c1_66_590 172
665 3300050496 nmdc:mga07m45_10794_c1 nmdc:mga07m45_10794_c1_264_782 172
666 3300050496 nmdc:mga07m45_14093_c1 nmdc:mga07m45_14093_c1_1948_2490 172
667 3300050496 nmdc:mga07m45_178190_c1 nmdc:mga07m45_178190_c1_624_1166 172
668 3300050496 nmdc:mga07m45_23747_c1 nmdc:mga07m45_23747_c1_2133_2675 172
669 3300050496 nmdc:mga07m45_614236_c1 nmdc:mga07m45_614236_c1_75_593 172
670 3300050496 nmdc:mga07m45_8991_c1 nmdc:mga07m45_8991_c1_1200_1718 172
671 3300050508 nmdc:mga09592_18661_c1 nmdc:mga09592_18661_c1_685_1203 172
672 3300050509 nmdc:mga0qj67_74358_c1 nmdc:mga0qj67_74358_c1_1707_2225 172
673 3300050516 nmdc:mga0sz30_33160_c2 nmdc:mga0sz30_33160_c2_894_1463 172
674 3300050516 nmdc:mga0sz30_59406_c1 nmdc:mga0sz30_59406_c1_48_605 172
675 3300053079 Ga0500610_0013258 Ga0500610_0013258_2340_2882 172
676 3300053079 Ga0500610_0087266 Ga0500610_0087266_1060_1602 172
677 3300053087 Ga0500643_013594 Ga0500643_013594_2309_2851 172
678 3300053087 Ga0500643_054543 Ga0500643_054543_52_570 172
679 3300053088 Ga0500644_0003921 Ga0500644_0003921_2143_2661 172
680 3300053088 Ga0500644_0148631 Ga0500644_0148631_255_773 172
681 3300053090 Ga0500646_0019967 Ga0500646_0019967_624_1142 172
682 3300053092 Ga0500583_0238538 Ga0500583_0238538_55_606 172
683 3300053093 Ga0500651_0000430 Ga0500651_0000430_5553_6095 172
684 3300053093 Ga0500651_0042063 Ga0500651_0042063_732_1250 172
685 3300053093 Ga0500651_0347233 Ga0500651_0347233_256_774 172
686 3300053098 Ga0500650_0101407 Ga0500650_0101407_547_1065 172
687 3300053108 Ga0500562_028292 Ga0500562_028292_296_838 172
688 3300053109 Ga0500569_082281 Ga0500569_082281_165_683 172
689 3300053110 Ga0500571_000252 Ga0500571_000252_4178_4720 172
690 3300053116 Ga0500592_047966 Ga0500592_047966_39_581 172
691 3300053117 Ga0500593_000652 Ga0500593_000652_1310_1852 172
692 3300053117 Ga0500593_002060 Ga0500593_002060_328_846 172
693 3300053117 Ga0500593_002533 Ga0500593_002533_2066_2584 172
694 3300053118 Ga0500594_0000441 Ga0500594_0000441_1310_1828 172
695 3300053121 Ga0500607_001874 Ga0500607_001874_3918_4460 172
696 3300053122 Ga0500608_003111 Ga0500608_003111_5196_5738 172
697 3300053123 Ga0500614_053718 Ga0500614_053718_429_947 172
698 3300053125 Ga0500618_038162 Ga0500618_038162_321_839 172
699 3300053128 Ga0500626_028311 Ga0500626_028311_681_1223 172
700 3300053130 Ga0500642_0003789 Ga0500642_0003789_3191_3709 172
701 3300053131 Ga0500652_000307 Ga0500652_000307_11606_12124 172
702 3300053133 Ga0500655_001160 Ga0500655_001160_2354_2896 172
703 3300053134 Ga0500658_0000352 Ga0500658_0000352_15220_15762 172
704 3300053134 Ga0500658_0003377 Ga0500658_0003377_859_1401 172
705 3300053134 Ga0500658_0283932 Ga0500658_0283932_58_576 172
706 3300053136 Ga0500559_0000191 Ga0500559_0000191_34759_35277 172
707 3300053136 Ga0500559_0001027 Ga0500559_0001027_11358_11900 172
708 3300053136 Ga0500559_0011898 Ga0500559_0011898_2107_2649 172
709 3300053136 Ga0500559_0024763 Ga0500559_0024763_1131_1673 172
710 3300053137 Ga0500561_0148396 Ga0500561_0148396_40_582 172
711 3300053138 Ga0500564_047935 Ga0500564_047935_158_700 172
712 3300053139 Ga0500568_0013994 Ga0500568_0013994_719_1261 172
713 3300053140 Ga0500573_0111477 Ga0500573_0111477_517_1059 172
714 3300053141 Ga0500574_002382 Ga0500574_002382_1335_1877 172
715 3300053142 Ga0500577_0014789 Ga0500577_0014789_1358_1876 172
716 3300053148 Ga0500590_055132 Ga0500590_055132_237_755 172
717 3300053151 Ga0500604_0130019 Ga0500604_0130019_185_703 172
718 3300053154 Ga0500619_001373 Ga0500619_001373_998_1516 172
719 3300053154 Ga0500619_060043 Ga0500619_060043_303_821 172
720 3300053156 Ga0500622_0000160 Ga0500622_0000160_30330_30848 172
721 3300053156 Ga0500622_0001454 Ga0500622_0001454_6159_6677 172
722 3300053156 Ga0500622_0084018 Ga0500622_0084018_864_1406 172
723 3300053157 Ga0500624_004796 Ga0500624_004796_392_934 172
724 3300053161 Ga0500634_0016453 Ga0500634_0016453_1218_1760 172
725 3300053161 Ga0500634_0028221 Ga0500634_0028221_2075_2617 172
726 3300053162 Ga0500638_003518 Ga0500638_003518_245_787 172
727 3300053177 Ga0500636_0336229 Ga0500636_0336229_121_639 172
728 3300053177 Ga0500636_0353385 Ga0500636_0353385_99_641 172
729 3300053724 Ga0500570_060968 Ga0500570_060968_741_1259 172
730 3300053730 Ga0500645_003389 Ga0500645_003389_5111_5629 172
731 3300053730 Ga0500645_036265 Ga0500645_036265_214_765 172
732 3300053735 Ga0500596_005608 Ga0500596_005608_1084_1626 172
733 3300053739 Ga0500587_000344 Ga0500587_000344_1692_2210 172
734 3300053739 Ga0500587_002693 Ga0500587_002693_1716_2234 172
735 3300055283 Ga0500661_036114 Ga0500661_036114_133_651 172
736 3300059424 Ga0590075_006111 Ga0590075_006111_1240_1758 172
737 iso_pu_bacteria 2904479285 2904480509 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07743

HSCB_C

HSCB C-terminal oligomerisation domain

103

163

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bvo-assembly1.cif.gz_A crystal structure of human co-chaperone protein hscb 0.9129 1 167
2qsa-assembly1.cif.gz_A crystal structure of j-domain of dnaj homolog dnj-2 precursor from c.elegans. 0.9093 5 78
1fpo-assembly1.cif.gz_A hsc20 (hscb), a j-type co-chaperone from e. coli 0.9028 5 170
4it5-assembly1.cif.gz_D chaperone hscb from vibrio cholerae 0.9 6 170
3bvo-assembly1.cif.gz_A crystal structure of human co-chaperone protein hscb 0.878 1 167
ID Description Score Start End Superfamily
1fpoC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9626 5 82 1.10.287.110
af_Q54PV9_19_125_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9369 4 74 1.10.287.110
1fpoC01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9346 5 82 1.10.287.110
3uo2A02 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.9342 94 164 1.20.1280.20
1fpoB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9339 5 82 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A4Q3MPA3-F1-model_v4 deleted 0.9845 1 74
AF-A0A6N8IN41-F1-model_v4 Co-chaperone protein HscB homolog 0.9745 1 172 GO:0001671
GO:0006457
GO:0044571
GO:0051087
GO:0051259
GO:0097428
GO:1990230
AF-A0A7Y3NEB8-F1-model_v4 Co-chaperone protein HscB homolog 0.963 2 171 GO:0001671
GO:0006457
GO:0044571
GO:0051087
GO:0051259
GO:0097428
GO:1990230
AF-A0A7X8UZG2-F1-model_v4 deleted 0.9609 1 172
AF-A0A4Q3MPA3-F1-model_v4 deleted 0.959 1 74

Feature Viewer

pLDDT pTM Quality
95.18 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map