F478132

General Info

Members Datasets Scaffolds Average Seq Length
734 355 1468 285

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10000007|Ga0081539_10000007466
Length 285
Sequence MTTATAVVMRNSDLSLAGPLGSFDAYLERVSRIPVLSREEEHALAVRFRRDNDIDAARQLVLAHLRFVVHIARGYGGYGLPIGDLVQEGNVGLMKAVKRFDPDLNVRLVSFAVHWIRAEIHEYVLRNWRLVKIATTKAQRKLFFNLRRMKKNLAWLSADETKAVASDLGVTTAEVTEMEQRLAARDMSFDPTPESDEDDVYSPAAFLPAESVEAEEWENDSVDRLQTAMSRLDDRSRDILQRRWMTEEKATLHELADKYGVSAERIRQIESNALGKLRGLMAPAA

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300019162 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
114 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
123 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
195 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
196 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
197 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
228 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
244 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
245 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
246 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
247 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
248 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
257 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
258 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
261 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
301 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
338 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
339 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
342 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
347 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
348 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.92
Metatranscriptomes 13.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.72
Nodule 0
Rhizoplane 4.63
Rhizosphere 87.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10000007 3300005985 Bacteria 532790
2 JGI25406J46586_10018608 3300003203 Bacteria 2851
3 rootH1_10129885 3300003316 Bacteria 4197
4 Ga0058863_11764630 3300004799 Bacteria 1094
5 Ga0058863_11931264 3300004799 Bacteria 1447
6 Ga0058863_11943574 3300004799 Bacteria 1328
7 Ga0058861_10012577 3300004800 Bacteria 1086
8 Ga0058861_11898769 3300004800 Bacteria 1510
9 Ga0058861_12022971 3300004800 Bacteria 1306
10 Ga0058860_12217600 3300004801 Bacteria 971
11 Ga0058862_12571848 3300004803 Bacteria 1033
12 Ga0058862_12644953 3300004803 Bacteria 1162
13 Ga0058862_12759794 3300004803 Bacteria 1076
14 Ga0065707_10083507 3300005295 Bacteria 8911
15 Ga0070676_10277003 3300005328 Bacteria 1129
16 Ga0070683_100015340 3300005329 Bacteria 6726
17 Ga0070690_100017349 3300005330 Bacteria 4327
18 Ga0070690_100128980 3300005330 Bacteria 1706
19 Ga0070670_100433968 3300005331 Bacteria 1163
20 Ga0070677_10003517 3300005333 Bacteria 5053
21 Ga0068869_100101095 3300005334 Bacteria 2181
22 Ga0070666_10031480 3300005335 Bacteria 3501
23 Ga0070666_10134491 3300005335 Bacteria 1719
24 Ga0070666_10175884 3300005335 Bacteria 1500
25 Ga0070680_100000968 3300005336 Bacteria 20318
26 Ga0070680_100007296 3300005336 Bacteria 8427
27 Ga0070680_100364797 3300005336 Bacteria 1229
28 Ga0070680_100451699 3300005336 Bacteria 1098
29 Ga0070682_100014778 3300005337 Bacteria 4516
30 Ga0070682_100054356 3300005337 Bacteria 2512
31 Ga0070682_100137934 3300005337 Bacteria 1659
32 Ga0068868_100003822 3300005338 Bacteria 10513
33 Ga0068868_100077869 3300005338 Bacteria 2653
34 Ga0070689_100008450 3300005340 Bacteria 7253
35 Ga0070687_100083057 3300005343 Bacteria 1753
36 Ga0070687_100084821 3300005343 Bacteria 1737
37 Ga0070668_100127444 3300005347 Bacteria 2040
38 Ga0070669_100198005 3300005353 Bacteria 1579
39 Ga0070675_100017152 3300005354 Bacteria 5754
40 Ga0070675_100042742 3300005354 Bacteria 3703
41 Ga0070675_100346912 3300005354 Bacteria 1316
42 Ga0070675_100395746 3300005354 Bacteria 1232
43 Ga0070671_100023085 3300005355 Bacteria 5085
44 Ga0070671_100144300 3300005355 Bacteria 2009
45 Ga0070671_100254069 3300005355 Bacteria 1493
46 Ga0070674_100054124 3300005356 Bacteria 2774
47 Ga0070674_100315856 3300005356 Bacteria 1251
48 Ga0070673_100052213 3300005364 Bacteria 3207
49 Ga0070673_100198342 3300005364 Bacteria 1728
50 Ga0070688_100077343 3300005365 Bacteria 2144
51 Ga0070659_100233551 3300005366 Bacteria 1520
52 Ga0070667_100000165 3300005367 Bacteria 82440
53 Ga0070667_100013017 3300005367 Bacteria 6878
54 Ga0070667_100021244 3300005367 Bacteria 5393
55 Ga0070667_100039227 3300005367 Bacteria 3969
56 Ga0070667_100054704 3300005367 Bacteria 3370
57 Ga0070709_10042221 3300005434 Bacteria 2815
58 Ga0070709_10239415 3300005434 Bacteria 1302
59 Ga0070714_100012148 3300005435 Bacteria 6861
60 Ga0070713_100001869 3300005436 Bacteria 13588
61 Ga0070713_100369378 3300005436 Bacteria 1334
62 Ga0070710_10134014 3300005437 Bacteria 1513
63 Ga0070701_10003052 3300005438 Bacteria 6561
64 Ga0070711_100005097 3300005439 Bacteria 7821
65 Ga0070711_100010709 3300005439 Bacteria 5684
66 Ga0070700_100036299 3300005441 Bacteria 2988
67 Ga0070694_100280663 3300005444 Bacteria 1270
68 Ga0070663_100134623 3300005455 Bacteria 1880
69 Ga0070678_100008480 3300005456 Bacteria 6156
70 Ga0070678_100114069 3300005456 Bacteria 2119
71 Ga0070681_10010218 3300005458 Bacteria 9259
72 Ga0070681_10082066 3300005458 Bacteria 3179
73 Ga0070681_10093189 3300005458 Bacteria 2961
74 Ga0070681_10260017 3300005458 Bacteria 1648
75 Ga0068867_100074956 3300005459 Bacteria 2537
76 Ga0070699_100081105 3300005518 Bacteria 2828
77 Ga0070679_100002496 3300005530 Bacteria 16667
78 Ga0070679_100009554 3300005530 Bacteria 9175
79 Ga0070679_100034249 3300005530 Bacteria 5033
80 Ga0070679_100055778 3300005530 Bacteria 3935
81 Ga0070679_100438671 3300005530 Bacteria 1251
82 Ga0070679_100564113 3300005530 Bacteria 1082
83 Ga0068853_100064840 3300005539 Bacteria 3168
84 Ga0070672_100000236 3300005543 Bacteria 30867
85 Ga0070672_100007629 3300005543 Bacteria 7361
86 Ga0070672_100111026 3300005543 Bacteria 2234
87 Ga0070672_100156483 3300005543 Bacteria 1888
88 Ga0070672_100568680 3300005543 Bacteria 985
89 Ga0070686_100031879 3300005544 Bacteria 3227
90 Ga0070686_100414295 3300005544 Bacteria 1028
91 Ga0070695_100002155 3300005545 Bacteria 11282
92 Ga0070695_100170053 3300005545 Bacteria 1537
93 Ga0070696_100320924 3300005546 Bacteria 1192
94 Ga0070665_100001424 3300005548 Bacteria 28047
95 Ga0070665_100007001 3300005548 Bacteria 11459
96 Ga0070665_100010146 3300005548 Bacteria 9525
97 Ga0070665_100016181 3300005548 Bacteria 7484
98 Ga0070665_100017839 3300005548 Bacteria 7126
99 Ga0070665_100053941 3300005548 Bacteria 4032
100 Ga0070665_100143575 3300005548 Bacteria 2390
101 Ga0070665_100338821 3300005548 Bacteria 1508
102 Ga0068855_100000777 3300005563 Bacteria 39367
103 Ga0068855_100009302 3300005563 Bacteria 11864
104 Ga0068855_100079140 3300005563 Bacteria 3813
105 Ga0068854_100210983 3300005578 Bacteria 1532
106 Ga0068856_100053859 3300005614 Bacteria 3967
107 Ga0068856_100072735 3300005614 Bacteria 3404
108 Ga0070702_100074020 3300005615 Bacteria 2020
109 Ga0070702_100287858 3300005615 Bacteria 1131
110 Ga0068859_100004119 3300005617 Bacteria 14828
111 Ga0068859_100036217 3300005617 Bacteria 4954
112 Ga0068859_100039647 3300005617 Bacteria 4726
113 Ga0068866_10165119 3300005718 Bacteria 1295
114 Ga0068861_100064291 3300005719 Bacteria 2823
115 Ga0068851_10147677 3300005834 Bacteria 1283
116 Ga0068870_10007528 3300005840 Bacteria 4860
117 Ga0068870_10090929 3300005840 Bacteria 1706
118 Ga0068863_100001602 3300005841 Bacteria 22360
119 Ga0068863_100020019 3300005841 Bacteria 6400
120 Ga0068863_100027185 3300005841 Bacteria 5456
121 Ga0068863_100193640 3300005841 Bacteria 1954
122 Ga0068863_100198225 3300005841 Bacteria 1930
123 Ga0068858_100001047 3300005842 Bacteria 28582
124 Ga0068858_100012107 3300005842 Bacteria 8130
125 Ga0068858_100049858 3300005842 Bacteria 3876
126 Ga0068858_100072414 3300005842 Bacteria 3197
127 Ga0068858_100221767 3300005842 Bacteria 1791
128 Ga0068858_100357806 3300005842 Bacteria 1399
129 Ga0068858_100432909 3300005842 Bacteria 1266
130 Ga0068860_100005935 3300005843 Bacteria 12292
131 Ga0068860_100008794 3300005843 Bacteria 10062
132 Ga0068860_100022131 3300005843 Bacteria 6153
133 Ga0068860_100132755 3300005843 Bacteria 2390
134 Ga0068862_100013575 3300005844 Bacteria 6746
135 Ga0068862_100013944 3300005844 Bacteria 6662
136 Ga0068862_100036871 3300005844 Bacteria 4144
137 Ga0068862_100280613 3300005844 Bacteria 1527
138 Ga0081455_10000812 3300005937 Bacteria 40224
139 Ga0081455_10194632 3300005937 Bacteria 1523
140 Ga0070717_10359137 3300006028 Bacteria 1303
141 Ga0070715_10012328 3300006163 Bacteria 3108
142 Ga0070715_10094530 3300006163 Bacteria 1382
143 Ga0070716_100009275 3300006173 Bacteria 4904
144 Ga0070716_100023952 3300006173 Bacteria 3245
145 Ga0070716_100213895 3300006173 Bacteria 1290
146 Ga0070712_100005047 3300006175 Bacteria 8175
147 Ga0070712_100050631 3300006175 Bacteria 2890
148 Ga0070712_100271791 3300006175 Bacteria 1362
149 Ga0097621_100072892 3300006237 Bacteria 2842
150 Ga0097621_100423363 3300006237 Bacteria 1195
151 Ga0068871_100038606 3300006358 Bacteria 3815
152 Ga0075428_100002675 3300006844 Bacteria 19362
153 Ga0075434_100016044 3300006871 Bacteria 7198
154 Ga0075434_100351680 3300006871 Bacteria 1495
155 Ga0075429_100250511 3300006880 Bacteria 1551
156 Ga0068865_100010753 3300006881 Bacteria 5705
157 Ga0068865_100016586 3300006881 Bacteria 4717
158 Ga0068865_100025569 3300006881 Bacteria 3885
159 Ga0097620_100004119 3300006931 Bacteria 14828
160 Ga0097620_100036217 3300006931 Bacteria 4954
161 Ga0097620_100039649 3300006931 Bacteria 4726
162 Ga0075435_100008896 3300007076 Bacteria 7234
163 Ga0099794_10020476 3300007265 Bacteria 2995
164 Ga0099795_10012348 3300007788 Bacteria 2587
165 Ga0105240_10001173 3300009093 Bacteria 45933
166 Ga0105240_10003212 3300009093 Bacteria 25602
167 Ga0105240_10007033 3300009093 Bacteria 16417
168 Ga0105240_10011536 3300009093 Bacteria 12299
169 Ga0105240_10048173 3300009093 Bacteria 5388
170 Ga0105240_10130635 3300009093 Bacteria 3013
171 Ga0105240_10269295 3300009093 Bacteria 1962
172 Ga0105240_10303930 3300009093 Bacteria 1824
173 Ga0105240_10315120 3300009093 Bacteria 1785
174 Ga0105240_10453042 3300009093 Bacteria 1435
175 Ga0111539_10005694 3300009094 Bacteria 16121
176 Ga0111539_10049703 3300009094 Bacteria 4999
177 Ga0111539_10304090 3300009094 Bacteria 1856
178 Ga0111539_10538465 3300009094 Bacteria 1360
179 Ga0105245_10004931 3300009098 Bacteria 11739
180 Ga0105245_10055928 3300009098 Bacteria 3545
181 Ga0105247_10000233 3300009101 Bacteria 52855
182 Ga0105247_10006413 3300009101 Bacteria 7284
183 Ga0105247_10035632 3300009101 Bacteria 3034
184 Ga0105241_10110591 3300009174 Bacteria 2198
185 Ga0105242_10011050 3300009176 Bacteria 6937
186 Ga0105248_10005023 3300009177 Bacteria 14608
187 Ga0105248_10020612 3300009177 Bacteria 7306
188 Ga0105248_10113573 3300009177 Bacteria 3055
189 Ga0105248_10121316 3300009177 Bacteria 2949
190 Ga0105248_10130530 3300009177 Bacteria 2835
191 Ga0105237_10017936 3300009545 Bacteria 7334
192 Ga0105237_10071630 3300009545 Bacteria 3460
193 Ga0105237_10074216 3300009545 Bacteria 3393
194 Ga0105237_10132327 3300009545 Bacteria 2488
195 Ga0105237_10225231 3300009545 Bacteria 1875
196 Ga0105238_10023620 3300009551 Bacteria 6265
197 Ga0105238_10024574 3300009551 Bacteria 6140
198 Ga0105238_10055964 3300009551 Bacteria 3958
199 Ga0105238_10087076 3300009551 Bacteria 3111
200 Ga0105238_10098843 3300009551 Bacteria 2902
201 Ga0105238_10126847 3300009551 Bacteria 2530
202 Ga0105249_10036598 3300009553 Bacteria 4453
203 Ga0105249_10100841 3300009553 Bacteria 2715
204 Ga0105249_10106142 3300009553 Bacteria 2649
205 Ga0105249_10345639 3300009553 Bacteria 1505
206 Ga0105030_100094 3300009987 Bacteria 6725
207 Ga0099796_10028541 3300010159 Bacteria 1792
208 Ga0099796_10046173 3300010159 Bacteria 1494
209 Ga0105239_10155374 3300010375 Bacteria 2555
210 Ga0105239_10504920 3300010375 Bacteria 1375
211 Ga0105239_10763555 3300010375 Bacteria 1107
212 Ga0157370_10006003 3300013104 Bacteria 13513
213 Ga0157370_10134172 3300013104 Bacteria 2308
214 Ga0157369_10324396 3300013105 Bacteria 1600
215 Ga0157374_10237603 3300013296 Bacteria 1791
216 Ga0157378_10003324 3300013297 Bacteria 14301
217 Ga0163162_10014824 3300013306 Bacteria 7612
218 Ga0163162_10024558 3300013306 Bacteria 5951
219 Ga0163162_10039638 3300013306 Bacteria 4708
220 Ga0163162_10127236 3300013306 Bacteria 2655
221 Ga0163162_10232390 3300013306 Bacteria 1974
222 Ga0157372_10025992 3300013307 Bacteria 6367
223 Ga0157372_10213372 3300013307 Bacteria 2237
224 Ga0157375_10003245 3300013308 Bacteria 14112
225 Ga0157375_10301334 3300013308 Bacteria 1766
226 Ga0157375_10325177 3300013308 Bacteria 1702
227 Ga0163163_10014855 3300014325 Bacteria 7173
228 Ga0163163_10063465 3300014325 Bacteria 3663
229 Ga0163163_10120892 3300014325 Bacteria 2653
230 Ga0163163_10131263 3300014325 Bacteria 2545
231 Ga0163163_10314755 3300014325 Bacteria 1619
232 Ga0157380_10027679 3300014326 Bacteria 4312
233 Ga0157377_10125761 3300014745 Bacteria 1559
234 Ga0157379_10008480 3300014968 Bacteria 8942
235 Ga0157379_10079768 3300014968 Bacteria 2932
236 Ga0157379_10083274 3300014968 Bacteria 2867
237 Ga0157379_10083652 3300014968 Bacteria 2860
238 Ga0157379_10438401 3300014968 Bacteria 1204
239 Ga0157376_10016188 3300014969 Bacteria 5654
240 Ga0157376_10193835 3300014969 Bacteria 1865
241 Ga0163161_10037800 3300017792 Bacteria 3461
242 Ga0184597_111565 3300019162 Bacteria 1154
243 Ga0184597_125559 3300019162 Bacteria 1245
244 Ga0184598_121774 3300019182 Bacteria 1019
245 Ga0184601_113818 3300019183 Bacteria 1172
246 Ga0184599_110495 3300019188 Bacteria 1098
247 Ga0184600_102458 3300019190 Bacteria 1434
248 Ga0184603_112834 3300019192 Bacteria 1345
249 Ga0197907_10033001 3300020069 Bacteria 1217
250 Ga0197907_10127453 3300020069 Bacteria 925
251 Ga0197907_10224130 3300020069 Bacteria 1453
252 Ga0197907_10369171 3300020069 Bacteria 1099
253 Ga0197907_10661878 3300020069 Bacteria 1123
254 Ga0197907_10895211 3300020069 Bacteria 2060
255 Ga0206356_10467607 3300020070 Bacteria 1121
256 Ga0206356_11512272 3300020070 Bacteria 1855
257 Ga0206349_1164651 3300020075 Bacteria 1084
258 Ga0206349_1366518 3300020075 Bacteria 1039
259 Ga0206349_1922415 3300020075 Bacteria 1232
260 Ga0206355_1181007 3300020076 Bacteria 1323
261 Ga0206355_1335841 3300020076 Bacteria 1505
262 Ga0206355_1446450 3300020076 Bacteria 1104
263 Ga0206355_1536653 3300020076 Bacteria 1021
264 Ga0206355_1611024 3300020076 Bacteria 1250
265 Ga0206355_1704285 3300020076 Bacteria 1466
266 Ga0206351_10160823 3300020077 Bacteria 1685
267 Ga0206351_11003600 3300020077 Bacteria 1222
268 Ga0206352_10313169 3300020078 Bacteria 1580
269 Ga0206352_10381664 3300020078 Bacteria 963
270 Ga0206352_10598812 3300020078 Bacteria 1054
271 Ga0206352_10971161 3300020078 Bacteria 1059
272 Ga0206350_10235844 3300020080 Bacteria 1759
273 Ga0206350_10296814 3300020080 Bacteria 1275
274 Ga0206350_10451280 3300020080 Bacteria 1150
275 Ga0206350_10790354 3300020080 Bacteria 1027
276 Ga0206350_10797303 3300020080 Bacteria 1130
277 Ga0206350_10851462 3300020080 Bacteria 1257
278 Ga0206350_10962266 3300020080 Bacteria 2184
279 Ga0206350_11048517 3300020080 Bacteria 1432
280 Ga0206350_11202142 3300020080 Bacteria 2436
281 Ga0206350_11376000 3300020080 Bacteria 1087
282 Ga0206350_11499868 3300020080 Bacteria 1060
283 Ga0206354_10642949 3300020081 Bacteria 1027
284 Ga0206353_10232557 3300020082 Bacteria 1285
285 Ga0206353_10528744 3300020082 Bacteria 1237
286 Ga0154015_1195834 3300020610 Bacteria 1093
287 Ga0154015_1531594 3300020610 Bacteria 2386
288 Ga0154015_1555183 3300020610 Bacteria 926
289 Ga0154015_1669608 3300020610 Bacteria 1452
290 Ga0213874_10006634 3300021377 Bacteria 2746
291 Ga0224712_10015634 3300022467 Bacteria 2474
292 Ga0224712_10023497 3300022467 Bacteria 2141
293 Ga0224712_10061497 3300022467 Bacteria 1498
294 Ga0224712_10061858 3300022467 Bacteria 1494
295 Ga0224712_10067976 3300022467 Bacteria 1439
296 Ga0224712_10094952 3300022467 Bacteria 1255
297 Ga0224712_10099813 3300022467 Bacteria 1229
298 Ga0224712_10106333 3300022467 Bacteria 1197
299 Ga0224712_10112500 3300022467 Bacteria 1169
300 Ga0224712_10117403 3300022467 Bacteria 1148
301 Ga0224712_10128421 3300022467 Bacteria 1105
302 Ga0224712_10129977 3300022467 Bacteria 1099
303 Ga0224712_10135452 3300022467 Bacteria 1079
304 Ga0224712_10167927 3300022467 Bacteria 982
305 Ga0247514_110325 3300023560 Bacteria 1000
306 Ga0247553_101132 3300023672 Bacteria 1103
307 Ga0247553_101856 3300023672 Bacteria 934
308 Ga0207710_10000201 3300025900 Bacteria 55939
309 Ga0207710_10004069 3300025900 Bacteria 6429
310 Ga0207710_10069027 3300025900 Bacteria 1617
311 Ga0207680_10305650 3300025903 Bacteria 1109
312 Ga0207647_10019947 3300025904 Bacteria 4500
313 Ga0207685_10006125 3300025905 Bacteria 3248
314 Ga0207699_10401867 3300025906 Bacteria 976
315 Ga0207654_10288155 3300025911 Bacteria 1113
316 Ga0207707_10000806 3300025912 Bacteria 30648
317 Ga0207707_10013299 3300025912 Bacteria 7173
318 Ga0207707_10045115 3300025912 Bacteria 3841
319 Ga0207707_10070794 3300025912 Bacteria 3039
320 Ga0207707_10150049 3300025912 Bacteria 2038
321 Ga0207695_10007446 3300025913 Bacteria 13920
322 Ga0207695_10007841 3300025913 Bacteria 13499
323 Ga0207695_10042277 3300025913 Bacteria 4869
324 Ga0207695_10047598 3300025913 Bacteria 4536
325 Ga0207695_10099494 3300025913 Bacteria 2905
326 Ga0207695_10099691 3300025913 Bacteria 2902
327 Ga0207695_10150348 3300025913 Bacteria 2268
328 Ga0207695_10190743 3300025913 Bacteria 1967
329 Ga0207671_10087188 3300025914 Bacteria 2347
330 Ga0207671_10189994 3300025914 Bacteria 1601
331 Ga0207671_10252783 3300025914 Bacteria 1386
332 Ga0207693_10000504 3300025915 Bacteria 35283
333 Ga0207693_10024904 3300025915 Bacteria 4746
334 Ga0207693_10325493 3300025915 Bacteria 1203
335 Ga0207663_10034740 3300025916 Bacteria 3018
336 Ga0207663_10149135 3300025916 Bacteria 1638
337 Ga0207660_10053429 3300025917 Bacteria 2879
338 Ga0207660_10102921 3300025917 Bacteria 2136
339 Ga0207662_10159162 3300025918 Bacteria 1441
340 Ga0207649_10279779 3300025920 Bacteria 1213
341 Ga0207652_10005625 3300025921 Bacteria 10166
342 Ga0207652_10058506 3300025921 Bacteria 3321
343 Ga0207652_10109448 3300025921 Bacteria 2449
344 Ga0207681_10087943 3300025923 Bacteria 2212
345 Ga0207681_10136488 3300025923 Bacteria 1821
346 Ga0207681_10234214 3300025923 Bacteria 1426
347 Ga0207694_10005212 3300025924 Bacteria 10037
348 Ga0207694_10064336 3300025924 Bacteria 2859
349 Ga0207659_10017492 3300025926 Bacteria 4684
350 Ga0207659_10052207 3300025926 Bacteria 2911
351 Ga0207659_10292550 3300025926 Bacteria 1335
352 Ga0207687_10059179 3300025927 Bacteria 2698
353 Ga0207700_10050879 3300025928 Bacteria 3089
354 Ga0207700_10146534 3300025928 Bacteria 1946
355 Ga0207664_10012726 3300025929 Bacteria 6022
356 Ga0207664_10263042 3300025929 Bacteria 1509
357 Ga0207644_10005850 3300025931 Bacteria 8015
358 Ga0207644_10083763 3300025931 Bacteria 2362
359 Ga0207644_10094236 3300025931 Bacteria 2237
360 Ga0207644_10112719 3300025931 Bacteria 2059
361 Ga0207644_10220329 3300025931 Bacteria 1504
362 Ga0207706_10119989 3300025933 Bacteria 2312
363 Ga0207686_10018415 3300025934 Bacteria 3955
364 Ga0207686_10064782 3300025934 Bacteria 2328
365 Ga0207669_10022200 3300025937 Bacteria 3366
366 Ga0207669_10188874 3300025937 Bacteria 1484
367 Ga0207704_10289708 3300025938 Bacteria 1249
368 Ga0207704_10487107 3300025938 Bacteria 991
369 Ga0207665_10005133 3300025939 Bacteria 8744
370 Ga0207665_10200575 3300025939 Bacteria 1453
371 Ga0207691_10024658 3300025940 Bacteria 5656
372 Ga0207691_10168297 3300025940 Bacteria 1920
373 Ga0207691_10209848 3300025940 Bacteria 1692
374 Ga0207711_10011299 3300025941 Bacteria 7418
375 Ga0207689_10012800 3300025942 Bacteria 7165
376 Ga0207689_10113017 3300025942 Bacteria 2232
377 Ga0207661_10087395 3300025944 Bacteria 2589
378 Ga0207679_10323000 3300025945 Bacteria 1337
379 Ga0207667_10008439 3300025949 Bacteria 12236
380 Ga0207667_10066119 3300025949 Bacteria 3769
381 Ga0207667_10119191 3300025949 Bacteria 2720
382 Ga0207667_10156865 3300025949 Bacteria 2341
383 Ga0207651_10009266 3300025960 Bacteria 5376
384 Ga0207651_10109781 3300025960 Bacteria 2068
385 Ga0207651_10167115 3300025960 Bacteria 1731
386 Ga0207712_10046881 3300025961 Bacteria 2998
387 Ga0207712_10146362 3300025961 Bacteria 1819
388 Ga0207640_10335512 3300025981 Bacteria 1209
389 Ga0207658_10000303 3300025986 Bacteria 50872
390 Ga0207658_10023831 3300025986 Bacteria 4276
391 Ga0207658_10044116 3300025986 Bacteria 3245
392 Ga0207658_10072199 3300025986 Bacteria 2615
393 Ga0207658_10184172 3300025986 Bacteria 1730
394 Ga0207677_10317549 3300026023 Bacteria 1293
395 Ga0207703_10002179 3300026035 Bacteria 17192
396 Ga0207703_10004549 3300026035 Bacteria 11369
397 Ga0207703_10059220 3300026035 Bacteria 3128
398 Ga0207703_10175297 3300026035 Bacteria 1889
399 Ga0207703_10374207 3300026035 Bacteria 1316
400 Ga0207703_10385545 3300026035 Bacteria 1297
401 Ga0207703_10427890 3300026035 Bacteria 1233
402 Ga0207708_10146321 3300026075 Bacteria 1857
403 Ga0207702_10281539 3300026078 Bacteria 1572
404 Ga0207641_10003736 3300026088 Bacteria 13382
405 Ga0207641_10101651 3300026088 Bacteria 2533
406 Ga0207641_10105598 3300026088 Bacteria 2488
407 Ga0207648_10049949 3300026089 Bacteria 3658
408 Ga0207676_10037441 3300026095 Bacteria 3697
409 Ga0207675_100002742 3300026118 Bacteria 17331
410 Ga0207675_100015132 3300026118 Bacteria 7196
411 Ga0207675_100083665 3300026118 Bacteria 2993
412 Ga0207675_100227542 3300026118 Bacteria 1798
413 Ga0207683_10008203 3300026121 Bacteria 8937
414 Ga0207683_10030187 3300026121 Bacteria 4696
415 Ga0207683_10033265 3300026121 Bacteria 4478
416 Ga0207428_10000990 3300027907 Bacteria 31474
417 Ga0265354_1004666 3300028016 Bacteria 1425
418 Ga0268266_10000820 3300028379 Bacteria 40665
419 Ga0268266_10006072 3300028379 Bacteria 11131
420 Ga0268266_10013499 3300028379 Bacteria 7032
421 Ga0268266_10016248 3300028379 Bacteria 6362
422 Ga0268266_10062162 3300028379 Bacteria 3222
423 Ga0268266_10092389 3300028379 Bacteria 2655
424 Ga0268266_10098845 3300028379 Bacteria 2568
425 Ga0268266_10104381 3300028379 Bacteria 2502
426 Ga0268266_10123083 3300028379 Bacteria 2310
427 Ga0268266_10141098 3300028379 Bacteria 2162
428 Ga0268266_10180567 3300028379 Bacteria 1921
429 Ga0268265_10008339 3300028380 Bacteria 6998
430 Ga0268265_10042513 3300028380 Bacteria 3373
431 Ga0268265_10226252 3300028380 Bacteria 1641
432 Ga0268264_10001238 3300028381 Bacteria 24491
433 Ga0268264_10005713 3300028381 Bacteria 10543
434 Ga0268264_10139323 3300028381 Bacteria 2161
435 Ga0268264_10143158 3300028381 Bacteria 2135
436 Ga0265319_1005097 3300028563 Bacteria 6371
437 Ga0265334_10000471 3300028573 Bacteria 20776
438 Ga0265334_10098285 3300028573 Bacteria 1062
439 Ga0265318_10000764 3300028577 Bacteria 21437
440 Ga0307515_10006279 3300028794 Bacteria 23844
441 Ga0307515_10294496 3300028794 Bacteria 1315
442 Ga0265338_10048932 3300028800 Bacteria 3839
443 Ga0265338_10085316 3300028800 Bacteria 2632
444 Ga0307511_10000172 3300030521 Bacteria 63607
445 Ga0307511_10014775 3300030521 Bacteria 7588
446 Ga0265762_1015890 3300030760 Bacteria 1363
447 Ga0265762_1031995 3300030760 Bacteria 1002
448 Ga0265775_101367 3300030762 Bacteria 1148
449 Ga0265775_102323 3300030762 Bacteria 977
450 Ga0265767_102229 3300030836 Bacteria 1024
451 Ga0265766_1001239 3300030863 Bacteria 1261
452 Ga0265766_1002145 3300030863 Bacteria 1067
453 Ga0265777_101758 3300030877 Bacteria 1197
454 Ga0265770_1007347 3300030878 Bacteria 1550
455 Ga0265770_1018892 3300030878 Bacteria 1077
456 Ga0265764_101625 3300030882 Bacteria 1023
457 Ga0265769_102810 3300030888 Bacteria 935
458 Ga0265771_1001337 3300031010 Bacteria 1154
459 Ga0265760_10000462 3300031090 Bacteria 11486
460 Ga0265760_10063521 3300031090 Bacteria 1125
461 Ga0265330_10070224 3300031235 Bacteria 1515
462 Ga0265332_10006622 3300031238 Bacteria 5247
463 Ga0265328_10036724 3300031239 Bacteria 1810
464 Ga0265320_10024595 3300031240 Bacteria 3183
465 Ga0265329_10016147 3300031242 Bacteria 2594
466 Ga0265340_10013841 3300031247 Bacteria 4228
467 Ga0265340_10041237 3300031247 Bacteria 2270
468 Ga0265340_10056407 3300031247 Bacteria 1889
469 Ga0265339_10087455 3300031249 Bacteria 1638
470 Ga0265331_10027979 3300031250 Bacteria 2822
471 Ga0265331_10053844 3300031250 Bacteria 1917
472 Ga0265316_10026458 3300031344 Bacteria 4824
473 Ga0307513_10006487 3300031456 Bacteria 15276
474 Ga0307513_10031962 3300031456 Bacteria 5947
475 Ga0307509_10001027 3300031507 Bacteria 48002
476 Ga0307509_10006637 3300031507 Bacteria 15455
477 Ga0265313_10006695 3300031595 Bacteria 8073
478 Ga0265313_10032502 3300031595 Bacteria 2663
479 Ga0316575_10014894 3300031665 Bacteria 2926
480 Ga0265314_10005270 3300031711 Bacteria 11702
481 Ga0265342_10038827 3300031712 Bacteria 2897
482 Ga0316576_10181057 3300031727 Bacteria 1589
483 Ga0307516_10000206 3300031730 Bacteria 76797
484 Ga0307405_10043997 3300031731 Bacteria 2728
485 Ga0247548_101192 3300031814 Bacteria 1027
486 Ga0307413_10083091 3300031824 Bacteria 2059
487 Ga0307413_10084250 3300031824 Bacteria 2048
488 Ga0307410_10018875 3300031852 Bacteria 4179
489 Ga0307410_10020952 3300031852 Bacteria 4012
490 Ga0307406_10172876 3300031901 Bacteria 1565
491 Ga0307407_10012384 3300031903 Bacteria 4097
492 Ga0307412_10082892 3300031911 Bacteria 2221
493 Ga0307409_100005169 3300031995 Bacteria 7459
494 Ga0307409_100171429 3300031995 Bacteria 1910
495 Ga0307409_100178507 3300031995 Bacteria 1877
496 Ga0307416_100074694 3300032002 Bacteria 2833
497 Ga0307411_10001043 3300032005 Bacteria 10725
498 Ga0307411_10040084 3300032005 Bacteria 2968
499 Ga0307411_10129715 3300032005 Bacteria 1840
500 Ga0316053_102760 3300032120 Bacteria 1010
501 Ga0307415_100049645 3300032126 Bacteria 2838
502 Ga0307507_10195316 3300033179 Bacteria 1413
503 Ga0307510_10000010 3300033180 Bacteria 377457
504 Ga0307510_10060302 3300033180 Bacteria 3906
505 Ga0373936_0000387 3300035113 Bacteria 14949
506 Ga0373936_0005629 3300035113 Bacteria 4724
507 Ga0373954_0023633 3300035118 Bacteria 2797
508 Ga0373956_0138369 3300035119 Bacteria 1142
509 Ga0373943_0060044 3300035170 Bacteria 1897
510 Ga0373955_0050983 3300035172 Bacteria 2253
511 Ga0373955_0182878 3300035172 Bacteria 1244
512 Ga0316574_0099813 3300035398 Bacteria 1857
513 Ga0373924_0186838 3300035410 Bacteria 912
514 Ga0373935_0195958 3300035692 Bacteria 1394
515 Ga0373935_0370575 3300035692 Bacteria 1024
516 Ga0373927_0021422 3300035695 Bacteria 4237
517 Ga0373947_0164121 3300035725 Bacteria 1438
518 Ga0316582_0037566 3300036647 Bacteria 3004
519 Ga0316584_0015695 3300036712 Bacteria 5421
520 Ga0373925_0211498 3300037068 Bacteria 1545
521 Ga0395900_0351351 3300037418 Bacteria 1448
522 Ga0395898_0154668 3300037466 Bacteria 2194
523 Ga0436364_0232963 3300037853 Bacteria 1233
524 Ga0400483_179029 3300039062 Bacteria 1199
525 Ga0436360_0136600 3300039438 Bacteria 2226
526 Ga0436360_0540350 3300039438 Bacteria 7298
527 Ga0436360_1345115 3300039438 Bacteria 1118
528 Ga0436361_0721142 3300039447 Bacteria 6921
529 Ga0436361_0797630 3300039447 Bacteria 1233
530 Ga0436363_0741125 3300039450 Bacteria 2361
531 Ga0436363_1664576 3300039450 Bacteria 1821
532 Ga0436363_1701332 3300039450 Bacteria 5655
533 Ga0436362_0731860 3300039453 Bacteria 1656
534 Ga0439436_0060728 3300041404 Bacteria 1059
535 Ga0451802_0623511 3300041460 Bacteria 2709
536 Ga0451847_0341006 3300041503 Bacteria 1012
537 Ga0450896_011838 3300042133 Bacteria 1230
538 Ga0450898_016748 3300042134 Bacteria 1254
539 Ga0450910_003700 3300042147 Bacteria 2040
540 Ga0439446_0030424 3300042156 Bacteria 1560
541 Ga0439434_0000893 3300042435 Bacteria 8601
542 Ga0439460_0075178 3300042461 Bacteria 1052
543 Ga0466969_0000982 3300044656 Bacteria 15393
544 Ga0466969_0019033 3300044656 Bacteria 3572
545 Ga0466969_0027833 3300044656 Bacteria 2893
546 Ga0466966_0008594 3300044684 Bacteria 6759
547 Ga0466966_0111161 3300044684 Bacteria 1689
548 Ga0466961_0018690 3300044693 Bacteria 4459
549 Ga0466964_0000252 3300044706 Bacteria 15468
550 Ga0466971_0001315 3300044719 Bacteria 10380
551 Ga0466968_0004844 3300044735 Bacteria 5037
552 Ga0466970_0003983 3300044765 Bacteria 7246
553 Ga0466957_0002354 3300044842 Bacteria 10135
554 Ga0466959_0001331 3300045049 Bacteria 15026
555 Ga0466959_0005736 3300045049 Bacteria 8541
556 Ga0466959_0019796 3300045049 Bacteria 4952
557 Ga0466959_0336435 3300045049 Bacteria 1030
558 Ga0466958_0132991 3300045836 Bacteria 1563
559 Ga0495638_0001478 3300046460 Bacteria 21227
560 Ga0495638_0025399 3300046460 Bacteria 3852
561 Ga0495580_0063343 3300046472 Bacteria 2593
562 Ga0495606_0215072 3300046507 Bacteria 1086
563 Ga0495616_0000953 3300046513 Bacteria 20793
564 Ga0495628_0225297 3300046516 Bacteria 1407
565 Ga0495644_0013722 3300046523 Bacteria 3106
566 Ga0495621_0001937 3300046539 Bacteria 5445
567 Ga0495645_0270083 3300046543 Bacteria 1123
568 Ga0495625_0015112 3300046660 Bacteria 6127
569 Ga0495625_0061956 3300046660 Bacteria 2645
570 Ga0495625_0156991 3300046660 Bacteria 1526
571 Ga0495623_0024105 3300046679 Bacteria 3925
572 Ga0495647_0027835 3300046681 Bacteria 2080
573 Ga0495669_0098688 3300046684 Bacteria 1355
574 Ga0495649_0012680 3300046694 Bacteria 4891
575 Ga0495649_0088471 3300046694 Bacteria 1652
576 Ga0495604_0276943 3300047317 Bacteria 1135
577 Ga0495674_0267715 3300047319 Bacteria 1403
578 Ga0495686_0076002 3300047472 Bacteria 2058
579 Ga0495626_0070892 3300048091 Bacteria 1567
580 Ga0496100_0147699 3300048903 Bacteria 1673
581 Ga0496101_0007381 3300048904 Bacteria 7120
582 Ga0496102_0007000 3300048905 Bacteria 9627
583 Ga0496102_0056846 3300048905 Bacteria 3570
584 Ga0496102_0061803 3300048905 Bacteria 3429
585 Ga0496102_0106864 3300048905 Bacteria 2605
586 Ga0496104_0040305 3300048907 Bacteria 4377
587 Ga0496104_0073680 3300048907 Bacteria 3249
588 Ga0496104_0077958 3300048907 Bacteria 3157
589 Ga0496104_0098923 3300048907 Bacteria 2792
590 Ga0496104_0378754 3300048907 Bacteria 1328
591 Ga0496105_0012014 3300048908 Bacteria 6857
592 Ga0496105_0016979 3300048908 Bacteria 5824
593 Ga0496105_0038460 3300048908 Bacteria 3941
594 Ga0496106_0006662 3300048909 Bacteria 8550
595 Ga0496106_0018401 3300048909 Bacteria 5164
596 Ga0496107_0013643 3300048910 Bacteria 5680
597 Ga0496107_0120393 3300048910 Bacteria 1934
598 Ga0496107_0287677 3300048910 Bacteria 1223
599 Ga0496108_0010890 3300048911 Bacteria 7383
600 Ga0496108_0020195 3300048911 Bacteria 5474
601 Ga0496108_0238467 3300048911 Bacteria 1582
602 Ga0496109_0050334 3300048912 Bacteria 3794
603 Ga0496109_0051526 3300048912 Bacteria 3749
604 Ga0496110_0004736 3300048913 Bacteria 10591
605 Ga0496112_0084220 3300048915 Bacteria 3145
606 Ga0496112_0120094 3300048915 Bacteria 2598
607 Ga0496112_0136516 3300048915 Bacteria 2422
608 Ga0496114_0062807 3300048917 Bacteria 3109
609 Ga0496114_0188954 3300048917 Bacteria 1801
610 Ga0496115_0001917 3300048918 Bacteria 14846
611 Ga0496115_0012849 3300048918 Bacteria 6313
612 Ga0496115_0368929 3300048918 Bacteria 1169
613 Ga0496117_0000581 3300048920 Bacteria 60186
614 Ga0496118_0001068 3300048921 Bacteria 42766
615 Ga0496119_0006228 3300048922 Bacteria 11143
616 Ga0496119_0008182 3300048922 Bacteria 9254
617 Ga0496119_0051096 3300048922 Bacteria 2543
618 Ga0496120_0005721 3300048923 Bacteria 9798
619 Ga0496120_0019117 3300048923 Bacteria 4391
620 Ga0496120_0072180 3300048923 Bacteria 1892
621 Ga0496121_0003828 3300048924 Bacteria 20935
622 Ga0496121_0024252 3300048924 Bacteria 5810
623 Ga0496121_0307502 3300048924 Bacteria 1073
624 Ga0496124_0014428 3300048927 Bacteria 7641
625 Ga0496125_0013799 3300048928 Bacteria 7915
626 Ga0496125_0015004 3300048928 Bacteria 7523
627 Ga0496125_0222353 3300048928 Bacteria 1215
628 Ga0496126_0015627 3300048929 Bacteria 7626
629 Ga0496126_0200104 3300048929 Bacteria 1687
630 Ga0495682_0102583 3300049460 Bacteria 1026
631 Ga0501314_011228 3300049530 Bacteria 844
632 Ga0501031_0060989 3300049568 Bacteria 2458
633 Ga0501031_0078077 3300049568 Bacteria 2157
634 Ga0501033_0017132 3300049570 Bacteria 5477
635 Ga0501036_0165640 3300049572 Bacteria 1863
636 Ga0501036_0204666 3300049572 Bacteria 1659
637 Ga0501037_0116519 3300049573 Bacteria 1922
638 Ga0501037_0361378 3300049573 Bacteria 1000
639 Ga0501038_0012336 3300049574 Bacteria 7808
640 Ga0501039_0069014 3300049575 Bacteria 2744
641 Ga0501039_0072748 3300049575 Bacteria 2671
642 Ga0501040_0003358 3300049576 Bacteria 10340
643 Ga0501040_0040374 3300049576 Bacteria 3175
644 Ga0501040_0105406 3300049576 Bacteria 1969
645 Ga0501041_0006873 3300049577 Bacteria 6669
646 Ga0501042_0007988 3300049578 Bacteria 6964
647 Ga0501042_0099659 3300049578 Bacteria 2089
648 Ga0501043_0119029 3300049579 Bacteria 2071
649 Ga0501043_0240839 3300049579 Bacteria 1395
650 Ga0501046_0006425 3300049580 Bacteria 10419
651 Ga0501046_0078059 3300049580 Bacteria 2562
652 Ga0501048_0112530 3300049582 Bacteria 1922
653 Ga0501067_0032224 3300049583 Bacteria 2909
654 Ga0501067_0203047 3300049583 Bacteria 1104
655 Ga0501068_0064283 3300049584 Bacteria 2233
656 Ga0501068_0123445 3300049584 Bacteria 1616
657 Ga0501071_0019958 3300049587 Bacteria 4655
658 Ga0501071_0046649 3300049587 Bacteria 3112
659 Ga0501071_0073602 3300049587 Bacteria 2492
660 Ga0501072_0022061 3300049588 Bacteria 4939
661 Ga0501072_0066296 3300049588 Bacteria 2848
662 Ga0501072_0103193 3300049588 Bacteria 2266
663 Ga0501073_0002934 3300049589 Bacteria 12799
664 Ga0501073_0041397 3300049589 Bacteria 3255
665 Ga0501074_0080186 3300049590 Bacteria 2342
666 Ga0501074_0246849 3300049590 Bacteria 1269
667 Ga0501075_0087830 3300049591 Bacteria 2357
668 Ga0501075_0202323 3300049591 Bacteria 1514
669 Ga0501075_0397337 3300049591 Bacteria 1051
670 Ga0501075_0466071 3300049591 Bacteria 963
671 Ga0501076_0000571 3300049592 Bacteria 23489
672 Ga0501076_0068592 3300049592 Bacteria 2832
673 Ga0501076_0250256 3300049592 Bacteria 1450
674 Ga0501077_0004283 3300049593 Bacteria 8631
675 Ga0501077_0029796 3300049593 Bacteria 3470
676 Ga0501077_0040025 3300049593 Bacteria 2986
677 Ga0501079_0003026 3300049741 Bacteria 12298
678 Ga0501079_0004118 3300049741 Bacteria 10758
679 Ga0501079_0009071 3300049741 Bacteria 7532
680 Ga0501079_0239511 3300049741 Bacteria 1417
681 Ga0501080_0002421 3300049742 Bacteria 16281
682 Ga0501080_0058658 3300049742 Bacteria 3582
683 Ga0501080_0409830 3300049742 Bacteria 1219
684 Ga0501081_0001576 3300049743 Bacteria 14052
685 Ga0501081_0012667 3300049743 Bacteria 5545
686 Ga0501081_0023280 3300049743 Bacteria 4151
687 Ga0501083_0003344 3300049744 Bacteria 11216
688 Ga0501083_0300228 3300049744 Bacteria 1044
689 Ga0501035_0023200 3300049822 Bacteria 5692
690 Ga0501045_0272650 3300049824 Bacteria 1259
691 nmdc:mga09592_373690_c1 3300050508 Bacteria 1233
692 nmdc:mga08y16_226644_c1 3300050511 Bacteria 1934
693 nmdc:mga08y16_7354_c1 3300050511 Bacteria 11553
694 nmdc:mga08y16_98991_c1 3300050511 Bacteria 3036
695 nmdc:mga0n895_33712_c1 3300050512 Bacteria 4922
696 nmdc:mga0rr50_14364_c1 3300050513 Bacteria 5191
697 nmdc:mga0rr50_44115_c1 3300050513 Bacteria 3268
698 nmdc:mga0a205_1634_c1 3300050515 Bacteria 19252
699 Ga0495612_0126906 3300053078 Bacteria 1100
700 Ga0500644_0002983 3300053088 Bacteria 4197
701 Ga0500583_0006495 3300053092 Bacteria 4032
702 Ga0500583_0048780 3300053092 Bacteria 1956
703 Ga0500583_0066636 3300053092 Bacteria 1713
704 Ga0500583_0107609 3300053092 Bacteria 1370
705 Ga0500641_0019775 3300053096 Bacteria 2549
706 Ga0500641_0044159 3300053096 Bacteria 1812
707 Ga0500648_152598 3300053097 Bacteria 1226
708 Ga0500556_0000137 3300053104 Bacteria 61134
709 Ga0500556_0076387 3300053104 Bacteria 1259
710 Ga0500562_012334 3300053108 Bacteria 2174
711 Ga0500617_100157 3300053124 Bacteria 1225
712 Ga0500642_0161866 3300053130 Bacteria 1049
713 Ga0500568_0079910 3300053139 Bacteria 1242
714 Ga0500616_0000092 3300053153 Bacteria 183860
715 Ga0500622_0005900 3300053156 Bacteria 7232
716 Ga0500622_0148661 3300053156 Bacteria 1110
717 Ga0500627_0168207 3300053158 Bacteria 988
718 Ga0500636_0079998 3300053177 Bacteria 1884
719 Ga0500637_0017998 3300053178 Bacteria 3791
720 Ga0501084_0010733 3300054114 Bacteria 7582
721 Ga0501084_0062879 3300054114 Bacteria 3107
722 Ga0587084_016813 3300059477 Bacteria 1049
723 Ga0587073_0028093 3300059492 Bacteria 1140
724 Ga0587090_023552 3300059510 Bacteria 981
725 Ga0501082_0000958 3300060353 Bacteria 25525
726 Ga0501082_0012886 3300060353 Bacteria 7187
727 Ga0501082_0023758 3300060353 Bacteria 5285
728 Ga0501082_0027004 3300060353 Bacteria 4946
729 Ga0501082_0188289 3300060353 Bacteria 1795
730 Ga0466962_0001142 3300061719 Bacteria 12257
731 Ga0466962_0120156 3300061719 Bacteria 1268
732 Ga0530510_0007633 3300061734 Bacteria 7533
733 Ga0530510_0280939 3300061734 Bacteria 1243
734 Ga0530510_0313759 3300061734 Bacteria 1174
735 Ga0081539_10000007
736 JGI25406J46586_10018608
737 rootH1_10129885
738 Ga0058863_11764630
739 Ga0058863_11931264
740 Ga0058863_11943574
741 Ga0058861_10012577
742 Ga0058861_11898769
743 Ga0058861_12022971
744 Ga0058860_12217600
745 Ga0058862_12571848
746 Ga0058862_12644953
747 Ga0058862_12759794
748 Ga0065707_10083507
749 Ga0070676_10277003
750 Ga0070683_100015340
751 Ga0070690_100017349
752 Ga0070690_100128980
753 Ga0070670_100433968
754 Ga0070677_10003517
755 Ga0068869_100101095
756 Ga0070666_10031480
757 Ga0070666_10134491
758 Ga0070666_10175884
759 Ga0070680_100000968
760 Ga0070680_100007296
761 Ga0070680_100364797
762 Ga0070680_100451699
763 Ga0070682_100014778
764 Ga0070682_100054356
765 Ga0070682_100137934
766 Ga0068868_100003822
767 Ga0068868_100077869
768 Ga0070689_100008450
769 Ga0070687_100083057
770 Ga0070687_100084821
771 Ga0070668_100127444
772 Ga0070669_100198005
773 Ga0070675_100017152
774 Ga0070675_100042742
775 Ga0070675_100346912
776 Ga0070675_100395746
777 Ga0070671_100023085
778 Ga0070671_100144300
779 Ga0070671_100254069
780 Ga0070674_100054124
781 Ga0070674_100315856
782 Ga0070673_100052213
783 Ga0070673_100198342
784 Ga0070688_100077343
785 Ga0070659_100233551
786 Ga0070667_100000165
787 Ga0070667_100013017
788 Ga0070667_100021244
789 Ga0070667_100039227
790 Ga0070667_100054704
791 Ga0070709_10042221
792 Ga0070709_10239415
793 Ga0070714_100012148
794 Ga0070713_100001869
795 Ga0070713_100369378
796 Ga0070710_10134014
797 Ga0070701_10003052
798 Ga0070711_100005097
799 Ga0070711_100010709
800 Ga0070700_100036299
801 Ga0070694_100280663
802 Ga0070663_100134623
803 Ga0070678_100008480
804 Ga0070678_100114069
805 Ga0070681_10010218
806 Ga0070681_10082066
807 Ga0070681_10093189
808 Ga0070681_10260017
809 Ga0068867_100074956
810 Ga0070699_100081105
811 Ga0070679_100002496
812 Ga0070679_100009554
813 Ga0070679_100034249
814 Ga0070679_100055778
815 Ga0070679_100438671
816 Ga0070679_100564113
817 Ga0068853_100064840
818 Ga0070672_100000236
819 Ga0070672_100007629
820 Ga0070672_100111026
821 Ga0070672_100156483
822 Ga0070672_100568680
823 Ga0070686_100031879
824 Ga0070686_100414295
825 Ga0070695_100002155
826 Ga0070695_100170053
827 Ga0070696_100320924
828 Ga0070665_100001424
829 Ga0070665_100007001
830 Ga0070665_100010146
831 Ga0070665_100016181
832 Ga0070665_100017839
833 Ga0070665_100053941
834 Ga0070665_100143575
835 Ga0070665_100338821
836 Ga0068855_100000777
837 Ga0068855_100009302
838 Ga0068855_100079140
839 Ga0068854_100210983
840 Ga0068856_100053859
841 Ga0068856_100072735
842 Ga0070702_100074020
843 Ga0070702_100287858
844 Ga0068859_100004119
845 Ga0068859_100036217
846 Ga0068859_100039647
847 Ga0068866_10165119
848 Ga0068861_100064291
849 Ga0068851_10147677
850 Ga0068870_10007528
851 Ga0068870_10090929
852 Ga0068863_100001602
853 Ga0068863_100020019
854 Ga0068863_100027185
855 Ga0068863_100193640
856 Ga0068863_100198225
857 Ga0068858_100001047
858 Ga0068858_100012107
859 Ga0068858_100049858
860 Ga0068858_100072414
861 Ga0068858_100221767
862 Ga0068858_100357806
863 Ga0068858_100432909
864 Ga0068860_100005935
865 Ga0068860_100008794
866 Ga0068860_100022131
867 Ga0068860_100132755
868 Ga0068862_100013575
869 Ga0068862_100013944
870 Ga0068862_100036871
871 Ga0068862_100280613
872 Ga0081455_10000812
873 Ga0081455_10194632
874 Ga0070717_10359137
875 Ga0070715_10012328
876 Ga0070715_10094530
877 Ga0070716_100009275
878 Ga0070716_100023952
879 Ga0070716_100213895
880 Ga0070712_100005047
881 Ga0070712_100050631
882 Ga0070712_100271791
883 Ga0097621_100072892
884 Ga0097621_100423363
885 Ga0068871_100038606
886 Ga0075428_100002675
887 Ga0075434_100016044
888 Ga0075434_100351680
889 Ga0075429_100250511
890 Ga0068865_100010753
891 Ga0068865_100016586
892 Ga0068865_100025569
893 Ga0097620_100004119
894 Ga0097620_100036217
895 Ga0097620_100039649
896 Ga0075435_100008896
897 Ga0099794_10020476
898 Ga0099795_10012348
899 Ga0105240_10001173
900 Ga0105240_10003212
901 Ga0105240_10007033
902 Ga0105240_10011536
903 Ga0105240_10048173
904 Ga0105240_10130635
905 Ga0105240_10269295
906 Ga0105240_10303930
907 Ga0105240_10315120
908 Ga0105240_10453042
909 Ga0111539_10005694
910 Ga0111539_10049703
911 Ga0111539_10304090
912 Ga0111539_10538465
913 Ga0105245_10004931
914 Ga0105245_10055928
915 Ga0105247_10000233
916 Ga0105247_10006413
917 Ga0105247_10035632
918 Ga0105241_10110591
919 Ga0105242_10011050
920 Ga0105248_10005023
921 Ga0105248_10020612
922 Ga0105248_10113573
923 Ga0105248_10121316
924 Ga0105248_10130530
925 Ga0105237_10017936
926 Ga0105237_10071630
927 Ga0105237_10074216
928 Ga0105237_10132327
929 Ga0105237_10225231
930 Ga0105238_10023620
931 Ga0105238_10024574
932 Ga0105238_10055964
933 Ga0105238_10087076
934 Ga0105238_10098843
935 Ga0105238_10126847
936 Ga0105249_10036598
937 Ga0105249_10100841
938 Ga0105249_10106142
939 Ga0105249_10345639
940 Ga0105030_100094
941 Ga0099796_10028541
942 Ga0099796_10046173
943 Ga0105239_10155374
944 Ga0105239_10504920
945 Ga0105239_10763555
946 Ga0157370_10006003
947 Ga0157370_10134172
948 Ga0157369_10324396
949 Ga0157374_10237603
950 Ga0157378_10003324
951 Ga0163162_10014824
952 Ga0163162_10024558
953 Ga0163162_10039638
954 Ga0163162_10127236
955 Ga0163162_10232390
956 Ga0157372_10025992
957 Ga0157372_10213372
958 Ga0157375_10003245
959 Ga0157375_10301334
960 Ga0157375_10325177
961 Ga0163163_10014855
962 Ga0163163_10063465
963 Ga0163163_10120892
964 Ga0163163_10131263
965 Ga0163163_10314755
966 Ga0157380_10027679
967 Ga0157377_10125761
968 Ga0157379_10008480
969 Ga0157379_10079768
970 Ga0157379_10083274
971 Ga0157379_10083652
972 Ga0157379_10438401
973 Ga0157376_10016188
974 Ga0157376_10193835
975 Ga0163161_10037800
976 Ga0184597_111565
977 Ga0184597_125559
978 Ga0184598_121774
979 Ga0184601_113818
980 Ga0184599_110495
981 Ga0184600_102458
982 Ga0184603_112834
983 Ga0197907_10033001
984 Ga0197907_10127453
985 Ga0197907_10224130
986 Ga0197907_10369171
987 Ga0197907_10661878
988 Ga0197907_10895211
989 Ga0206356_10467607
990 Ga0206356_11512272
991 Ga0206349_1164651
992 Ga0206349_1366518
993 Ga0206349_1922415
994 Ga0206355_1181007
995 Ga0206355_1335841
996 Ga0206355_1446450
997 Ga0206355_1536653
998 Ga0206355_1611024
999 Ga0206355_1704285
1000 Ga0206351_10160823
1001 Ga0206351_11003600
1002 Ga0206352_10313169
1003 Ga0206352_10381664
1004 Ga0206352_10598812
1005 Ga0206352_10971161
1006 Ga0206350_10235844
1007 Ga0206350_10296814
1008 Ga0206350_10451280
1009 Ga0206350_10790354
1010 Ga0206350_10797303
1011 Ga0206350_10851462
1012 Ga0206350_10962266
1013 Ga0206350_11048517
1014 Ga0206350_11202142
1015 Ga0206350_11376000
1016 Ga0206350_11499868
1017 Ga0206354_10642949
1018 Ga0206353_10232557
1019 Ga0206353_10528744
1020 Ga0154015_1195834
1021 Ga0154015_1531594
1022 Ga0154015_1555183
1023 Ga0154015_1669608
1024 Ga0213874_10006634
1025 Ga0224712_10015634
1026 Ga0224712_10023497
1027 Ga0224712_10061497
1028 Ga0224712_10061858
1029 Ga0224712_10067976
1030 Ga0224712_10094952
1031 Ga0224712_10099813
1032 Ga0224712_10106333
1033 Ga0224712_10112500
1034 Ga0224712_10117403
1035 Ga0224712_10128421
1036 Ga0224712_10129977
1037 Ga0224712_10135452
1038 Ga0224712_10167927
1039 Ga0247514_110325
1040 Ga0247553_101132
1041 Ga0247553_101856
1042 Ga0207710_10000201
1043 Ga0207710_10004069
1044 Ga0207710_10069027
1045 Ga0207680_10305650
1046 Ga0207647_10019947
1047 Ga0207685_10006125
1048 Ga0207699_10401867
1049 Ga0207654_10288155
1050 Ga0207707_10000806
1051 Ga0207707_10013299
1052 Ga0207707_10045115
1053 Ga0207707_10070794
1054 Ga0207707_10150049
1055 Ga0207695_10007446
1056 Ga0207695_10007841
1057 Ga0207695_10042277
1058 Ga0207695_10047598
1059 Ga0207695_10099494
1060 Ga0207695_10099691
1061 Ga0207695_10150348
1062 Ga0207695_10190743
1063 Ga0207671_10087188
1064 Ga0207671_10189994
1065 Ga0207671_10252783
1066 Ga0207693_10000504
1067 Ga0207693_10024904
1068 Ga0207693_10325493
1069 Ga0207663_10034740
1070 Ga0207663_10149135
1071 Ga0207660_10053429
1072 Ga0207660_10102921
1073 Ga0207662_10159162
1074 Ga0207649_10279779
1075 Ga0207652_10005625
1076 Ga0207652_10058506
1077 Ga0207652_10109448
1078 Ga0207681_10087943
1079 Ga0207681_10136488
1080 Ga0207681_10234214
1081 Ga0207694_10005212
1082 Ga0207694_10064336
1083 Ga0207659_10017492
1084 Ga0207659_10052207
1085 Ga0207659_10292550
1086 Ga0207687_10059179
1087 Ga0207700_10050879
1088 Ga0207700_10146534
1089 Ga0207664_10012726
1090 Ga0207664_10263042
1091 Ga0207644_10005850
1092 Ga0207644_10083763
1093 Ga0207644_10094236
1094 Ga0207644_10112719
1095 Ga0207644_10220329
1096 Ga0207706_10119989
1097 Ga0207686_10018415
1098 Ga0207686_10064782
1099 Ga0207669_10022200
1100 Ga0207669_10188874
1101 Ga0207704_10289708
1102 Ga0207704_10487107
1103 Ga0207665_10005133
1104 Ga0207665_10200575
1105 Ga0207691_10024658
1106 Ga0207691_10168297
1107 Ga0207691_10209848
1108 Ga0207711_10011299
1109 Ga0207689_10012800
1110 Ga0207689_10113017
1111 Ga0207661_10087395
1112 Ga0207679_10323000
1113 Ga0207667_10008439
1114 Ga0207667_10066119
1115 Ga0207667_10119191
1116 Ga0207667_10156865
1117 Ga0207651_10009266
1118 Ga0207651_10109781
1119 Ga0207651_10167115
1120 Ga0207712_10046881
1121 Ga0207712_10146362
1122 Ga0207640_10335512
1123 Ga0207658_10000303
1124 Ga0207658_10023831
1125 Ga0207658_10044116
1126 Ga0207658_10072199
1127 Ga0207658_10184172
1128 Ga0207677_10317549
1129 Ga0207703_10002179
1130 Ga0207703_10004549
1131 Ga0207703_10059220
1132 Ga0207703_10175297
1133 Ga0207703_10374207
1134 Ga0207703_10385545
1135 Ga0207703_10427890
1136 Ga0207708_10146321
1137 Ga0207702_10281539
1138 Ga0207641_10003736
1139 Ga0207641_10101651
1140 Ga0207641_10105598
1141 Ga0207648_10049949
1142 Ga0207676_10037441
1143 Ga0207675_100002742
1144 Ga0207675_100015132
1145 Ga0207675_100083665
1146 Ga0207675_100227542
1147 Ga0207683_10008203
1148 Ga0207683_10030187
1149 Ga0207683_10033265
1150 Ga0207428_10000990
1151 Ga0265354_1004666
1152 Ga0268266_10000820
1153 Ga0268266_10006072
1154 Ga0268266_10013499
1155 Ga0268266_10016248
1156 Ga0268266_10062162
1157 Ga0268266_10092389
1158 Ga0268266_10098845
1159 Ga0268266_10104381
1160 Ga0268266_10123083
1161 Ga0268266_10141098
1162 Ga0268266_10180567
1163 Ga0268265_10008339
1164 Ga0268265_10042513
1165 Ga0268265_10226252
1166 Ga0268264_10001238
1167 Ga0268264_10005713
1168 Ga0268264_10139323
1169 Ga0268264_10143158
1170 Ga0265319_1005097
1171 Ga0265334_10000471
1172 Ga0265334_10098285
1173 Ga0265318_10000764
1174 Ga0307515_10006279
1175 Ga0307515_10294496
1176 Ga0265338_10048932
1177 Ga0265338_10085316
1178 Ga0307511_10000172
1179 Ga0307511_10014775
1180 Ga0265762_1015890
1181 Ga0265762_1031995
1182 Ga0265775_101367
1183 Ga0265775_102323
1184 Ga0265767_102229
1185 Ga0265766_1001239
1186 Ga0265766_1002145
1187 Ga0265777_101758
1188 Ga0265770_1007347
1189 Ga0265770_1018892
1190 Ga0265764_101625
1191 Ga0265769_102810
1192 Ga0265771_1001337
1193 Ga0265760_10000462
1194 Ga0265760_10063521
1195 Ga0265330_10070224
1196 Ga0265332_10006622
1197 Ga0265328_10036724
1198 Ga0265320_10024595
1199 Ga0265329_10016147
1200 Ga0265340_10013841
1201 Ga0265340_10041237
1202 Ga0265340_10056407
1203 Ga0265339_10087455
1204 Ga0265331_10027979
1205 Ga0265331_10053844
1206 Ga0265316_10026458
1207 Ga0307513_10006487
1208 Ga0307513_10031962
1209 Ga0307509_10001027
1210 Ga0307509_10006637
1211 Ga0265313_10006695
1212 Ga0265313_10032502
1213 Ga0316575_10014894
1214 Ga0265314_10005270
1215 Ga0265342_10038827
1216 Ga0316576_10181057
1217 Ga0307516_10000206
1218 Ga0307405_10043997
1219 Ga0247548_101192
1220 Ga0307413_10083091
1221 Ga0307413_10084250
1222 Ga0307410_10018875
1223 Ga0307410_10020952
1224 Ga0307406_10172876
1225 Ga0307407_10012384
1226 Ga0307412_10082892
1227 Ga0307409_100005169
1228 Ga0307409_100171429
1229 Ga0307409_100178507
1230 Ga0307416_100074694
1231 Ga0307411_10001043
1232 Ga0307411_10040084
1233 Ga0307411_10129715
1234 Ga0316053_102760
1235 Ga0307415_100049645
1236 Ga0307507_10195316
1237 Ga0307510_10000010
1238 Ga0307510_10060302
1239 Ga0373936_0000387
1240 Ga0373936_0005629
1241 Ga0373954_0023633
1242 Ga0373956_0138369
1243 Ga0373943_0060044
1244 Ga0373955_0050983
1245 Ga0373955_0182878
1246 Ga0316574_0099813
1247 Ga0373924_0186838
1248 Ga0373935_0195958
1249 Ga0373935_0370575
1250 Ga0373927_0021422
1251 Ga0373947_0164121
1252 Ga0316582_0037566
1253 Ga0316584_0015695
1254 Ga0373925_0211498
1255 Ga0395900_0351351
1256 Ga0395898_0154668
1257 Ga0436364_0232963
1258 Ga0400483_179029
1259 Ga0436360_0136600
1260 Ga0436360_0540350
1261 Ga0436360_1345115
1262 Ga0436361_0721142
1263 Ga0436361_0797630
1264 Ga0436363_0741125
1265 Ga0436363_1664576
1266 Ga0436363_1701332
1267 Ga0436362_0731860
1268 Ga0439436_0060728
1269 Ga0451802_0623511
1270 Ga0451847_0341006
1271 Ga0450896_011838
1272 Ga0450898_016748
1273 Ga0450910_003700
1274 Ga0439446_0030424
1275 Ga0439434_0000893
1276 Ga0439460_0075178
1277 Ga0466969_0000982
1278 Ga0466969_0019033
1279 Ga0466969_0027833
1280 Ga0466966_0008594
1281 Ga0466966_0111161
1282 Ga0466961_0018690
1283 Ga0466964_0000252
1284 Ga0466971_0001315
1285 Ga0466968_0004844
1286 Ga0466970_0003983
1287 Ga0466957_0002354
1288 Ga0466959_0001331
1289 Ga0466959_0005736
1290 Ga0466959_0019796
1291 Ga0466959_0336435
1292 Ga0466958_0132991
1293 Ga0495638_0001478
1294 Ga0495638_0025399
1295 Ga0495580_0063343
1296 Ga0495606_0215072
1297 Ga0495616_0000953
1298 Ga0495628_0225297
1299 Ga0495644_0013722
1300 Ga0495621_0001937
1301 Ga0495645_0270083
1302 Ga0495625_0015112
1303 Ga0495625_0061956
1304 Ga0495625_0156991
1305 Ga0495623_0024105
1306 Ga0495647_0027835
1307 Ga0495669_0098688
1308 Ga0495649_0012680
1309 Ga0495649_0088471
1310 Ga0495604_0276943
1311 Ga0495674_0267715
1312 Ga0495686_0076002
1313 Ga0495626_0070892
1314 Ga0496100_0147699
1315 Ga0496101_0007381
1316 Ga0496102_0007000
1317 Ga0496102_0056846
1318 Ga0496102_0061803
1319 Ga0496102_0106864
1320 Ga0496104_0040305
1321 Ga0496104_0073680
1322 Ga0496104_0077958
1323 Ga0496104_0098923
1324 Ga0496104_0378754
1325 Ga0496105_0012014
1326 Ga0496105_0016979
1327 Ga0496105_0038460
1328 Ga0496106_0006662
1329 Ga0496106_0018401
1330 Ga0496107_0013643
1331 Ga0496107_0120393
1332 Ga0496107_0287677
1333 Ga0496108_0010890
1334 Ga0496108_0020195
1335 Ga0496108_0238467
1336 Ga0496109_0050334
1337 Ga0496109_0051526
1338 Ga0496110_0004736
1339 Ga0496112_0084220
1340 Ga0496112_0120094
1341 Ga0496112_0136516
1342 Ga0496114_0062807
1343 Ga0496114_0188954
1344 Ga0496115_0001917
1345 Ga0496115_0012849
1346 Ga0496115_0368929
1347 Ga0496117_0000581
1348 Ga0496118_0001068
1349 Ga0496119_0006228
1350 Ga0496119_0008182
1351 Ga0496119_0051096
1352 Ga0496120_0005721
1353 Ga0496120_0019117
1354 Ga0496120_0072180
1355 Ga0496121_0003828
1356 Ga0496121_0024252
1357 Ga0496121_0307502
1358 Ga0496124_0014428
1359 Ga0496125_0013799
1360 Ga0496125_0015004
1361 Ga0496125_0222353
1362 Ga0496126_0015627
1363 Ga0496126_0200104
1364 Ga0495682_0102583
1365 Ga0501314_011228
1366 Ga0501031_0060989
1367 Ga0501031_0078077
1368 Ga0501033_0017132
1369 Ga0501036_0165640
1370 Ga0501036_0204666
1371 Ga0501037_0116519
1372 Ga0501037_0361378
1373 Ga0501038_0012336
1374 Ga0501039_0069014
1375 Ga0501039_0072748
1376 Ga0501040_0003358
1377 Ga0501040_0040374
1378 Ga0501040_0105406
1379 Ga0501041_0006873
1380 Ga0501042_0007988
1381 Ga0501042_0099659
1382 Ga0501043_0119029
1383 Ga0501043_0240839
1384 Ga0501046_0006425
1385 Ga0501046_0078059
1386 Ga0501048_0112530
1387 Ga0501067_0032224
1388 Ga0501067_0203047
1389 Ga0501068_0064283
1390 Ga0501068_0123445
1391 Ga0501071_0019958
1392 Ga0501071_0046649
1393 Ga0501071_0073602
1394 Ga0501072_0022061
1395 Ga0501072_0066296
1396 Ga0501072_0103193
1397 Ga0501073_0002934
1398 Ga0501073_0041397
1399 Ga0501074_0080186
1400 Ga0501074_0246849
1401 Ga0501075_0087830
1402 Ga0501075_0202323
1403 Ga0501075_0397337
1404 Ga0501075_0466071
1405 Ga0501076_0000571
1406 Ga0501076_0068592
1407 Ga0501076_0250256
1408 Ga0501077_0004283
1409 Ga0501077_0029796
1410 Ga0501077_0040025
1411 Ga0501079_0003026
1412 Ga0501079_0004118
1413 Ga0501079_0009071
1414 Ga0501079_0239511
1415 Ga0501080_0002421
1416 Ga0501080_0058658
1417 Ga0501080_0409830
1418 Ga0501081_0001576
1419 Ga0501081_0012667
1420 Ga0501081_0023280
1421 Ga0501083_0003344
1422 Ga0501083_0300228
1423 Ga0501035_0023200
1424 Ga0501045_0272650
1425 nmdc:mga09592_373690_c1
1426 nmdc:mga08y16_226644_c1
1427 nmdc:mga08y16_7354_c1
1428 nmdc:mga08y16_98991_c1
1429 nmdc:mga0n895_33712_c1
1430 nmdc:mga0rr50_14364_c1
1431 nmdc:mga0rr50_44115_c1
1432 nmdc:mga0a205_1634_c1
1433 Ga0495612_0126906
1434 Ga0500644_0002983
1435 Ga0500583_0006495
1436 Ga0500583_0048780
1437 Ga0500583_0066636
1438 Ga0500583_0107609
1439 Ga0500641_0019775
1440 Ga0500641_0044159
1441 Ga0500648_152598
1442 Ga0500556_0000137
1443 Ga0500556_0076387
1444 Ga0500562_012334
1445 Ga0500617_100157
1446 Ga0500642_0161866
1447 Ga0500568_0079910
1448 Ga0500616_0000092
1449 Ga0500622_0005900
1450 Ga0500622_0148661
1451 Ga0500627_0168207
1452 Ga0500636_0079998
1453 Ga0500637_0017998
1454 Ga0501084_0010733
1455 Ga0501084_0062879
1456 Ga0587084_016813
1457 Ga0587073_0028093
1458 Ga0587090_023552
1459 Ga0501082_0000958
1460 Ga0501082_0012886
1461 Ga0501082_0023758
1462 Ga0501082_0027004
1463 Ga0501082_0188289
1464 Ga0466962_0001142
1465 Ga0466962_0120156
1466 Ga0530510_0007633
1467 Ga0530510_0280939
1468 Ga0530510_0313759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

228

279

0.99

PF04542

Sigma70_r2

Sigma-70 region 2

60

130

0.98

PF00140

Sigma70_r1_2

Sigma-70 factor, region 1.2

22

54

0.91

Map