F478080
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 733 | 474 | 609 | 419 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10000166|Ga0105237_1000016633 |
| Length | 466 |
| Sequence | MRIGSQGLLNLRPEAQILSFVRTIRRKAPADSFARGIFARGQLMKLESIALHHGYSSEPTTHAAAVPIYQTTSYTFDNTQHGADLFNLAVPGNIYTRIMNPTTAVLEQRVAEMEGGIAGLCVASGMAAITYSIQAIAGVGDNIVSISQLYGGTYNLFMHSFPRQGIEVRMADQGDFDAIEKLIDDKTKAVFCESIGNPAGNVVDIQRLAEIAHRHGVPVIVDNTVATPYLCKPIKFGADIVVHALTKYIGGHGNSIGGIIVDSGKFDWVKNKERFKVLNEPDPSYHGVVYTEALGPAAYIGRCRVVPLRNTGAALSPHNAFLFLMGLETLGLRMERHCDNAEKLARFLKNHPKVAWVNYAELPDSKYNAVAKKITKGKASGIVSFGIKGGAEAGGRFIDGLNMILRLVNIGDAKSLACHPASTTHRQLGPDELAKAGVSADLVRISVGIEHIDDIIADVEQALAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 2 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 3 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 6 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 7 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 8 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 9 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 10 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 11 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 12 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 13 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 14 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 15 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 16 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 17 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 18 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 19 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 20 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 21 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 22 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 23 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 24 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 25 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 26 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 27 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 28 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 29 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 30 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 31 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 32 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 33 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 34 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 35 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 36 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 37 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 38 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 39 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 40 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 41 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 42 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 43 | 2791355199 | |||
| 44 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 45 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 46 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 47 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 48 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 49 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 50 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 51 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 52 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 53 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 54 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 55 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 56 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 57 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 58 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 59 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 60 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 61 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 62 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 63 | 2881714928 | Pseudidiomarina mangrovi ZQ330 | Isolate | Rhizosphere |
| 64 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 65 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 66 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 67 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 68 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 69 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 70 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 71 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 72 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 73 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 74 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 75 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 76 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 77 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 78 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 79 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 80 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 81 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 82 | 2916699645 | Acinetobacter ursingii M3 | Isolate | Unclassified |
| 83 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 84 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 85 | 2919506607 | Acinetobacter sp. 3657 | Isolate | Unclassified |
| 86 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 87 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 88 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 89 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 90 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 91 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 92 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 93 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 94 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 95 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 96 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 97 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 98 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 99 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 100 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 101 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 102 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 103 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 104 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 105 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 106 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 107 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 108 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 109 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 110 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 111 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 112 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 113 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 114 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 115 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 116 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 117 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 118 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 119 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 120 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 121 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 122 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 123 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 124 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 125 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 126 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 127 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 128 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 129 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 130 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 135 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 139 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 142 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 143 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 148 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 152 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 153 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 155 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 158 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 159 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 160 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 161 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 162 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 163 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 164 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 165 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 166 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 167 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 169 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 170 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 171 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 172 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 173 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 174 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 175 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 176 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 177 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 178 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 180 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 191 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 194 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 195 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 196 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 204 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 207 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 208 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 209 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 210 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 211 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 212 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 213 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 214 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 222 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 225 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 282 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 284 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 286 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 288 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 290 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 291 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 292 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 293 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 294 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 295 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 296 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 297 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 298 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 299 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 300 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 301 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 302 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 303 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 304 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 305 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 306 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 307 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 308 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 309 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 310 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 311 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 312 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 313 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 315 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 316 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 317 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 318 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 319 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 320 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 321 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 322 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 323 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 324 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 325 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 326 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 327 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 328 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 329 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 330 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 331 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 332 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 333 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 334 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 335 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 336 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 337 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 338 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 339 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 340 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 341 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 342 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 343 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 344 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 345 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 346 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 347 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 348 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 349 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 350 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 351 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 352 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 353 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 354 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 355 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 356 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 357 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 358 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 359 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 360 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 361 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 362 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 363 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 364 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 365 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 366 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 409 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 410 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 411 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 412 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 415 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 416 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 417 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 418 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 419 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 420 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 421 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 422 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 423 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 429 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 448 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 449 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 450 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 451 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 452 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 457 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 458 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 459 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 460 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 461 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 462 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 464 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 465 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 466 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 467 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 468 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 469 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 470 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 471 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 472 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 473 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 474 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.51 |
| Metatranscriptomes | 0.68 |
| Isolates | 16.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 5.18 |
| Nodule | 6.28 |
| Rhizoplane | 2.18 |
| Rhizosphere | 69.03 |
| Stem | 0 |
| Stem Tuber | 0.68 |
| Unclassified | 16.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1003467 | 3300002739 | Bacteria | 2435 |
| 2 | JGI25159J45721_1000049 | 3300002987 | Bacteria | 58138 |
| 3 | JGI25165J46597_1002291 | 3300003214 | Bacteria | 6536 |
| 4 | JGI25153J46596_10034954 | 3300003215 | Bacteria | 1635 |
| 5 | rootH1_10010008 | 3300003323 | Bacteria | 19315 |
| 6 | JGI25160J50197_1000147 | 3300003354 | Bacteria | 62036 |
| 7 | JGI25161J50226_1000592 | 3300003374 | Bacteria | 15259 |
| 8 | Ga0055536_1000741 | 3300003781 | Bacteria | 21863 |
| 9 | Ga0055536_1004214 | 3300003781 | Bacteria | 7426 |
| 10 | Ga0055531_10001435 | 3300003794 | Bacteria | 17594 |
| 11 | Ga0058692_1000007 | 3300003856 | Bacteria | 366313 |
| 12 | Ga0055543_1000129 | 3300004625 | Bacteria | 62841 |
| 13 | Ga0065165_1000477 | 3300005262 | Bacteria | 62229 |
| 14 | Ga0065703_1000113 | 3300005272 | Bacteria | 60359 |
| 15 | Ga0065714_10067024 | 3300005288 | Bacteria | 5984 |
| 16 | Ga0065704_10010619 | 3300005289 | Bacteria | 1787 |
| 17 | Ga0065704_10021508 | 3300005289 | Bacteria | 1467 |
| 18 | Ga0065712_10103577 | 3300005290 | Bacteria | 1982 |
| 19 | Ga0070658_10116729 | 3300005327 | Bacteria | 2215 |
| 20 | Ga0070683_100091994 | 3300005329 | Bacteria | 2849 |
| 21 | Ga0070670_100027424 | 3300005331 | Bacteria | 4899 |
| 22 | Ga0070670_100136274 | 3300005331 | Bacteria | 2121 |
| 23 | Ga0070660_100042021 | 3300005339 | Bacteria | 3487 |
| 24 | Ga0070689_100051454 | 3300005340 | Bacteria | 3184 |
| 25 | Ga0070668_100007902 | 3300005347 | Bacteria | 7898 |
| 26 | Ga0070669_100001257 | 3300005353 | Bacteria | 18401 |
| 27 | Ga0070669_100094168 | 3300005353 | Bacteria | 2251 |
| 28 | Ga0070669_100181506 | 3300005353 | Bacteria | 1647 |
| 29 | Ga0070671_100008880 | 3300005355 | Bacteria | 8064 |
| 30 | Ga0070671_100018621 | 3300005355 | Bacteria | 5641 |
| 31 | Ga0070671_100056945 | 3300005355 | Bacteria | 3252 |
| 32 | Ga0070688_100004753 | 3300005365 | Bacteria | 7096 |
| 33 | Ga0070688_100071329 | 3300005365 | Bacteria | 2223 |
| 34 | Ga0070659_100021415 | 3300005366 | Bacteria | 4923 |
| 35 | Ga0070714_100000078 | 3300005435 | Bacteria | 82928 |
| 36 | Ga0070714_100049291 | 3300005435 | Bacteria | 3585 |
| 37 | Ga0070713_100000415 | 3300005436 | Bacteria | 27253 |
| 38 | Ga0070700_100096697 | 3300005441 | Bacteria | 1938 |
| 39 | Ga0070708_100057538 | 3300005445 | Bacteria | 3462 |
| 40 | Ga0070708_100151326 | 3300005445 | Bacteria | 2158 |
| 41 | Ga0070663_100017645 | 3300005455 | Bacteria | 4662 |
| 42 | Ga0070663_100149775 | 3300005455 | Bacteria | 1788 |
| 43 | Ga0070678_100023144 | 3300005456 | Bacteria | 4134 |
| 44 | Ga0070662_100192448 | 3300005457 | Bacteria | 1614 |
| 45 | Ga0068867_100042617 | 3300005459 | Bacteria | 3321 |
| 46 | Ga0070706_100238815 | 3300005467 | Bacteria | 1697 |
| 47 | Ga0070707_100321174 | 3300005468 | Bacteria | 1504 |
| 48 | Ga0070698_100211385 | 3300005471 | Bacteria | 1874 |
| 49 | Ga0070679_100186156 | 3300005530 | Bacteria | 2047 |
| 50 | Ga0070684_100032832 | 3300005535 | Bacteria | 4429 |
| 51 | Ga0070672_100126396 | 3300005543 | Bacteria | 2097 |
| 52 | Ga0070695_100008648 | 3300005545 | Bacteria | 6048 |
| 53 | Ga0070696_100012071 | 3300005546 | Bacteria | 5788 |
| 54 | Ga0070696_100071257 | 3300005546 | Bacteria | 2445 |
| 55 | Ga0070665_100000775 | 3300005548 | Bacteria | 41987 |
| 56 | Ga0070665_100029742 | 3300005548 | Bacteria | 5497 |
| 57 | Ga0070665_100225212 | 3300005548 | Bacteria | 1875 |
| 58 | Ga0068855_100025809 | 3300005563 | Bacteria | 7026 |
| 59 | Ga0068855_100243603 | 3300005563 | Bacteria | 2008 |
| 60 | Ga0068857_100053747 | 3300005577 | Unclassified | 3573 |
| 61 | Ga0068856_100019551 | 3300005614 | Bacteria | 6575 |
| 62 | Ga0068856_100034788 | 3300005614 | Bacteria | 4935 |
| 63 | Ga0068856_100316975 | 3300005614 | Bacteria | 1577 |
| 64 | Ga0068852_100044457 | 3300005616 | Bacteria | 3772 |
| 65 | Ga0068859_100120900 | 3300005617 | Bacteria | 2685 |
| 66 | Ga0068864_100005182 | 3300005618 | Bacteria | 10673 |
| 67 | Ga0068861_100000713 | 3300005719 | Bacteria | 19839 |
| 68 | Ga0068861_100084991 | 3300005719 | Bacteria | 2485 |
| 69 | Ga0068870_10052727 | 3300005840 | Bacteria | 2158 |
| 70 | Ga0068858_100050063 | 3300005842 | Bacteria | 3867 |
| 71 | Ga0081455_10002227 | 3300005937 | Bacteria | 23085 |
| 72 | Ga0070717_10007752 | 3300006028 | Bacteria | 7986 |
| 73 | Ga0075368_10006645 | 3300006042 | Bacteria | 4055 |
| 74 | Ga0070712_100006225 | 3300006175 | Bacteria | 7388 |
| 75 | Ga0075362_10016988 | 3300006177 | Bacteria | 2991 |
| 76 | Ga0075366_10009674 | 3300006195 | Bacteria | 5387 |
| 77 | Ga0068871_100156000 | 3300006358 | Bacteria | 1949 |
| 78 | Ga0075431_100070172 | 3300006847 | Bacteria | 3615 |
| 79 | Ga0075433_10117913 | 3300006852 | Bacteria | 2356 |
| 80 | Ga0075434_100121544 | 3300006871 | Bacteria | 2627 |
| 81 | Ga0075429_100195890 | 3300006880 | Bacteria | 1770 |
| 82 | Ga0068865_100003899 | 3300006881 | Bacteria | 8949 |
| 83 | Ga0068865_100068733 | 3300006881 | Bacteria | 2505 |
| 84 | Ga0097620_100120903 | 3300006931 | Bacteria | 2685 |
| 85 | Ga0079104_1000025 | 3300006946 | Bacteria | 218785 |
| 86 | Ga0079104_1005194 | 3300006946 | Bacteria | 5277 |
| 87 | Ga0105251_10005783 | 3300009011 | Bacteria | 8019 |
| 88 | Ga0105244_10010793 | 3300009036 | Bacteria | 5516 |
| 89 | Ga0105244_10018416 | 3300009036 | Bacteria | 3918 |
| 90 | Ga0105244_10024684 | 3300009036 | Bacteria | 3278 |
| 91 | Ga0105244_10052226 | 3300009036 | Bacteria | 2081 |
| 92 | Ga0105244_10066657 | 3300009036 | Bacteria | 1802 |
| 93 | Ga0105250_10004830 | 3300009092 | Bacteria | 6133 |
| 94 | Ga0105240_10003726 | 3300009093 | Bacteria | 23550 |
| 95 | Ga0105240_10004512 | 3300009093 | Bacteria | 21161 |
| 96 | Ga0111539_10294156 | 3300009094 | Bacteria | 1890 |
| 97 | Ga0105247_10001174 | 3300009101 | Bacteria | 19467 |
| 98 | Ga0105247_10022894 | 3300009101 | Bacteria | 3762 |
| 99 | Ga0105247_10117856 | 3300009101 | Bacteria | 1717 |
| 100 | Ga0114129_10002871 | 3300009147 | Bacteria | 24116 |
| 101 | Ga0114129_10006545 | 3300009147 | Bacteria | 16531 |
| 102 | Ga0114129_10076521 | 3300009147 | Bacteria | 4659 |
| 103 | Ga0114129_10162572 | 3300009147 | Bacteria | 3048 |
| 104 | Ga0114129_10417583 | 3300009147 | Bacteria | 1765 |
| 105 | Ga0105243_10000052 | 3300009148 | Bacteria | 138341 |
| 106 | Ga0105243_10002241 | 3300009148 | Bacteria | 16253 |
| 107 | Ga0105243_10167058 | 3300009148 | Bacteria | 1902 |
| 108 | Ga0105241_10011730 | 3300009174 | Bacteria | 6434 |
| 109 | Ga0105242_10002974 | 3300009176 | Bacteria | 13265 |
| 110 | Ga0105248_10005809 | 3300009177 | Bacteria | 13565 |
| 111 | Ga0105248_10108953 | 3300009177 | Bacteria | 3123 |
| 112 | Ga0105237_10000166 | 3300009545 | Bacteria | 93389 |
| 113 | Ga0105237_10009505 | 3300009545 | Bacteria | 10409 |
| 114 | Ga0105238_10025536 | 3300009551 | Bacteria | 6023 |
| 115 | Ga0105238_10092019 | 3300009551 | Bacteria | 3020 |
| 116 | Ga0105249_10001245 | 3300009553 | Bacteria | 22348 |
| 117 | Ga0105249_10004532 | 3300009553 | Bacteria | 12011 |
| 118 | Ga0105249_10045631 | 3300009553 | Bacteria | 3987 |
| 119 | Ga0105249_10069629 | 3300009553 | Bacteria | 3247 |
| 120 | Ga0105239_10001740 | 3300010375 | Bacteria | 28711 |
| 121 | Ga0105246_10004633 | 3300011119 | Bacteria | 8366 |
| 122 | Ga0157373_10022866 | 3300013100 | Bacteria | 4534 |
| 123 | Ga0157373_10045228 | 3300013100 | Bacteria | 3143 |
| 124 | Ga0157370_10023150 | 3300013104 | Bacteria | 6174 |
| 125 | Ga0157370_10270193 | 3300013104 | Bacteria | 1571 |
| 126 | Ga0157378_10005272 | 3300013297 | Bacteria | 11353 |
| 127 | Ga0163162_10325356 | 3300013306 | Bacteria | 1670 |
| 128 | Ga0157372_10220781 | 3300013307 | Bacteria | 2197 |
| 129 | Ga0157375_10119476 | 3300013308 | Bacteria | 2743 |
| 130 | Ga0163163_10029608 | 3300014325 | Bacteria | 5269 |
| 131 | Ga0163163_10116161 | 3300014325 | Bacteria | 2707 |
| 132 | Ga0163163_10127978 | 3300014325 | Bacteria | 2578 |
| 133 | Ga0163163_10199018 | 3300014325 | Bacteria | 2052 |
| 134 | Ga0182008_10015110 | 3300014497 | Bacteria | 4035 |
| 135 | Ga0182008_10072653 | 3300014497 | Bacteria | 1693 |
| 136 | Ga0157379_10123883 | 3300014968 | Bacteria | 2325 |
| 137 | Ga0157379_10161028 | 3300014968 | Bacteria | 2025 |
| 138 | Ga0157376_10022301 | 3300014969 | Bacteria | 4933 |
| 139 | Ga0163161_10014000 | 3300017792 | Bacteria | 5585 |
| 140 | Ga0163161_10023009 | 3300017792 | Bacteria | 4391 |
| 141 | Ga0163161_10190193 | 3300017792 | Bacteria | 1578 |
| 142 | Ga0197907_10402444 | 3300020069 | Eukaryota | 1495 |
| 143 | Ga0213872_10000439 | 3300021361 | Bacteria | 34128 |
| 144 | Ga0213874_10011758 | 3300021377 | Bacteria | 2227 |
| 145 | Ga0213875_10005448 | 3300021388 | Bacteria | 6830 |
| 146 | Ga0213875_10014710 | 3300021388 | Bacteria | 3815 |
| 147 | Ga0213875_10029488 | 3300021388 | Bacteria | 2602 |
| 148 | Ga0228711_1000009 | 3300022739 | Bacteria | 164684 |
| 149 | Ga0228710_1000011 | 3300022740 | Bacteria | 154551 |
| 150 | Ga0224572_1007930 | 3300024225 | Bacteria | 1956 |
| 151 | Ga0207427_103980 | 3300025231 | Bacteria | 2705 |
| 152 | Ga0209437_100042 | 3300025233 | Bacteria | 444095 |
| 153 | Ga0207425_1000397 | 3300025245 | Bacteria | 29297 |
| 154 | Ga0209233_1000103 | 3300025261 | Bacteria | 284123 |
| 155 | Ga0209233_1000671 | 3300025261 | Bacteria | 16483 |
| 156 | Ga0209130_1000234 | 3300025284 | Bacteria | 71914 |
| 157 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 158 | Ga0209025_1000337 | 3300025294 | Bacteria | 103480 |
| 159 | Ga0209564_1000117 | 3300025295 | Bacteria | 207096 |
| 160 | Ga0209758_1000895 | 3300025297 | Bacteria | 40555 |
| 161 | Ga0209050_1003742 | 3300025298 | Bacteria | 10915 |
| 162 | Ga0209256_1000352 | 3300025299 | Bacteria | 74849 |
| 163 | Ga0207426_1000410 | 3300025302 | Bacteria | 71914 |
| 164 | Ga0209051_1010989 | 3300025303 | Bacteria | 4514 |
| 165 | Ga0209257_1001129 | 3300025304 | Bacteria | 34298 |
| 166 | Ga0207697_10006065 | 3300025315 | Bacteria | 5524 |
| 167 | Ga0207655_1000618 | 3300025728 | Bacteria | 42704 |
| 168 | Ga0207655_1000728 | 3300025728 | Bacteria | 37197 |
| 169 | Ga0207655_1001345 | 3300025728 | Bacteria | 23091 |
| 170 | Ga0207655_1002977 | 3300025728 | Bacteria | 13003 |
| 171 | Ga0207655_1014647 | 3300025728 | Bacteria | 4415 |
| 172 | Ga0207713_1011192 | 3300025735 | Bacteria | 4904 |
| 173 | Ga0207682_10007635 | 3300025893 | Bacteria | 4304 |
| 174 | Ga0207642_10036256 | 3300025899 | Bacteria | 2115 |
| 175 | Ga0207710_10000018 | 3300025900 | Bacteria | 346727 |
| 176 | Ga0207688_10122867 | 3300025901 | Bacteria | 1516 |
| 177 | Ga0207647_10004440 | 3300025904 | Bacteria | 10398 |
| 178 | Ga0207647_10092512 | 3300025904 | Bacteria | 1803 |
| 179 | Ga0207645_10110563 | 3300025907 | Bacteria | 1779 |
| 180 | Ga0207643_10066407 | 3300025908 | Bacteria | 2068 |
| 181 | Ga0207705_10003576 | 3300025909 | Bacteria | 11839 |
| 182 | Ga0207705_10025894 | 3300025909 | Bacteria | 4186 |
| 183 | Ga0207684_10123273 | 3300025910 | Bacteria | 2223 |
| 184 | Ga0207684_10225722 | 3300025910 | Bacteria | 1616 |
| 185 | Ga0207654_10015252 | 3300025911 | Bacteria | 3984 |
| 186 | Ga0207695_10012680 | 3300025913 | Bacteria | 10095 |
| 187 | Ga0207671_10000344 | 3300025914 | Bacteria | 68132 |
| 188 | Ga0207663_10048982 | 3300025916 | Bacteria | 2618 |
| 189 | Ga0207657_10009690 | 3300025919 | Bacteria | 9663 |
| 190 | Ga0207657_10031412 | 3300025919 | Bacteria | 4811 |
| 191 | Ga0207652_10037774 | 3300025921 | Bacteria | 4089 |
| 192 | Ga0207646_10225627 | 3300025922 | Bacteria | 1692 |
| 193 | Ga0207681_10000529 | 3300025923 | Bacteria | 26378 |
| 194 | Ga0207681_10073627 | 3300025923 | Bacteria | 2390 |
| 195 | Ga0207650_10016512 | 3300025925 | Bacteria | 5163 |
| 196 | Ga0207659_10102976 | 3300025926 | Bacteria | 2156 |
| 197 | Ga0207687_10034830 | 3300025927 | Bacteria | 3422 |
| 198 | Ga0207700_10000115 | 3300025928 | Bacteria | 47748 |
| 199 | Ga0207700_10252300 | 3300025928 | Bacteria | 1508 |
| 200 | Ga0207664_10000043 | 3300025929 | Bacteria | 149967 |
| 201 | Ga0207644_10003286 | 3300025931 | Bacteria | 10449 |
| 202 | Ga0207690_10024458 | 3300025932 | Bacteria | 3783 |
| 203 | Ga0207690_10041588 | 3300025932 | Bacteria | 3013 |
| 204 | Ga0207706_10009893 | 3300025933 | Bacteria | 8745 |
| 205 | Ga0207706_10047508 | 3300025933 | Bacteria | 3797 |
| 206 | Ga0207706_10058895 | 3300025933 | Bacteria | 3383 |
| 207 | Ga0207709_10000016 | 3300025935 | Bacteria | 478406 |
| 208 | Ga0207709_10000159 | 3300025935 | Bacteria | 91803 |
| 209 | Ga0207709_10000740 | 3300025935 | Bacteria | 25909 |
| 210 | Ga0207670_10142855 | 3300025936 | Bacteria | 1767 |
| 211 | Ga0207669_10037663 | 3300025937 | Bacteria | 2777 |
| 212 | Ga0207704_10003562 | 3300025938 | Bacteria | 7072 |
| 213 | Ga0207691_10001523 | 3300025940 | Bacteria | 23057 |
| 214 | Ga0207691_10056953 | 3300025940 | Bacteria | 3559 |
| 215 | Ga0207711_10122930 | 3300025941 | Bacteria | 2319 |
| 216 | Ga0207661_10043720 | 3300025944 | Bacteria | 3537 |
| 217 | Ga0207661_10158501 | 3300025944 | Bacteria | 1962 |
| 218 | Ga0207679_10048082 | 3300025945 | Bacteria | 3103 |
| 219 | Ga0207667_10020974 | 3300025949 | Bacteria | 7246 |
| 220 | Ga0207667_10145706 | 3300025949 | Bacteria | 2438 |
| 221 | Ga0207667_10188937 | 3300025949 | Bacteria | 2114 |
| 222 | Ga0207651_10029993 | 3300025960 | Bacteria | 3456 |
| 223 | Ga0207651_10102889 | 3300025960 | Bacteria | 2124 |
| 224 | Ga0207712_10002358 | 3300025961 | Bacteria | 12238 |
| 225 | Ga0207668_10017184 | 3300025972 | Bacteria | 4528 |
| 226 | Ga0207668_10091542 | 3300025972 | Bacteria | 2236 |
| 227 | Ga0207640_10028238 | 3300025981 | Bacteria | 3428 |
| 228 | Ga0207658_10174784 | 3300025986 | Bacteria | 1773 |
| 229 | Ga0207703_10044617 | 3300026035 | Bacteria | 3564 |
| 230 | Ga0207639_10110356 | 3300026041 | Bacteria | 2240 |
| 231 | Ga0207678_10007777 | 3300026067 | Bacteria | 9469 |
| 232 | Ga0207702_10008462 | 3300026078 | Bacteria | 8676 |
| 233 | Ga0207702_10222019 | 3300026078 | Bacteria | 1761 |
| 234 | Ga0207641_10032432 | 3300026088 | Bacteria | 4337 |
| 235 | Ga0207648_10066827 | 3300026089 | Bacteria | 3135 |
| 236 | Ga0207648_10094077 | 3300026089 | Bacteria | 2620 |
| 237 | Ga0207648_10118790 | 3300026089 | Bacteria | 2324 |
| 238 | Ga0207648_10260180 | 3300026089 | Bacteria | 1548 |
| 239 | Ga0207676_10176755 | 3300026095 | Bacteria | 1865 |
| 240 | Ga0207674_10024473 | 3300026116 | Bacteria | 6453 |
| 241 | Ga0207674_10041247 | 3300026116 | Bacteria | 4775 |
| 242 | Ga0207674_10125108 | 3300026116 | Bacteria | 2537 |
| 243 | Ga0207675_100001418 | 3300026118 | Bacteria | 24014 |
| 244 | Ga0207675_100108470 | 3300026118 | Bacteria | 2618 |
| 245 | Ga0207683_10008000 | 3300026121 | Bacteria | 9044 |
| 246 | Ga0207683_10064101 | 3300026121 | Bacteria | 3238 |
| 247 | Ga0207698_10011496 | 3300026142 | Bacteria | 5742 |
| 248 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 249 | Ga0209281_1000132 | 3300027111 | Bacteria | 188464 |
| 250 | Ga0209371_1000024 | 3300027312 | Bacteria | 477286 |
| 251 | Ga0209282_1000018 | 3300027666 | Bacteria | 188472 |
| 252 | Ga0209974_10038284 | 3300027876 | Bacteria | 1593 |
| 253 | Ga0207428_10104598 | 3300027907 | Bacteria | 2184 |
| 254 | Ga0268266_10000167 | 3300028379 | Bacteria | 120012 |
| 255 | Ga0268266_10093792 | 3300028379 | Bacteria | 2634 |
| 256 | Ga0265322_10004158 | 3300028654 | Bacteria | 4329 |
| 257 | Ga0265338_10005109 | 3300028800 | Bacteria | 17299 |
| 258 | Ga0265338_10014863 | 3300028800 | Bacteria | 8611 |
| 259 | Ga0268256_1000026 | 3300030500 | Bacteria | 477260 |
| 260 | Ga0265332_10000021 | 3300031238 | Bacteria | 217090 |
| 261 | Ga0265320_10053549 | 3300031240 | Bacteria | 1950 |
| 262 | Ga0265325_10012739 | 3300031241 | Bacteria | 4799 |
| 263 | Ga0265339_10000128 | 3300031249 | Bacteria | 62891 |
| 264 | Ga0265339_10001796 | 3300031249 | Bacteria | 15766 |
| 265 | Ga0265327_10000270 | 3300031251 | Bacteria | 102617 |
| 266 | Ga0265327_10080705 | 3300031251 | Bacteria | 1608 |
| 267 | Ga0265316_10056814 | 3300031344 | Bacteria | 3054 |
| 268 | Ga0265313_10000246 | 3300031595 | Bacteria | 58903 |
| 269 | Ga0316575_10006080 | 3300031665 | Bacteria | 4327 |
| 270 | Ga0316579_10017893 | 3300031691 | Bacteria | 3114 |
| 271 | Ga0265342_10083993 | 3300031712 | Bacteria | 1835 |
| 272 | Ga0265342_10101813 | 3300031712 | Bacteria | 1635 |
| 273 | Ga0316576_10003878 | 3300031727 | Bacteria | 8856 |
| 274 | Ga0316576_10012947 | 3300031727 | Bacteria | 5523 |
| 275 | Ga0316576_10044936 | 3300031727 | Bacteria | 3192 |
| 276 | Ga0316576_10049679 | 3300031727 | Bacteria | 3047 |
| 277 | Ga0316576_10064800 | 3300031727 | Bacteria | 2684 |
| 278 | Ga0316576_10097988 | 3300031727 | Bacteria | 2189 |
| 279 | Ga0316576_10108845 | 3300031727 | Bacteria | 2076 |
| 280 | Ga0316576_10111539 | 3300031727 | Bacteria | 2050 |
| 281 | Ga0316576_10120411 | 3300031727 | Bacteria | 1970 |
| 282 | Ga0316578_10041198 | 3300031728 | Bacteria | 2674 |
| 283 | Ga0316578_10050663 | 3300031728 | Bacteria | 2430 |
| 284 | Ga0307405_10030034 | 3300031731 | Bacteria | 3183 |
| 285 | Ga0316577_10049859 | 3300031733 | Bacteria | 2336 |
| 286 | Ga0316577_10073580 | 3300031733 | Bacteria | 1908 |
| 287 | Ga0307413_10040290 | 3300031824 | Bacteria | 2725 |
| 288 | Ga0307406_10056494 | 3300031901 | Bacteria | 2514 |
| 289 | Ga0307412_10008741 | 3300031911 | Bacteria | 5795 |
| 290 | Ga0315914_1000332 | 3300031967 | Bacteria | 54587 |
| 291 | Ga0307416_100117152 | 3300032002 | Bacteria | 2364 |
| 292 | Ga0307414_10085841 | 3300032004 | Bacteria | 2320 |
| 293 | Ga0307411_10156481 | 3300032005 | Bacteria | 1701 |
| 294 | Ga0316583_10008253 | 3300032133 | Bacteria | 3754 |
| 295 | Ga0316580_10009353 | 3300032139 | Bacteria | 2943 |
| 296 | Ga0316580_10012702 | 3300032139 | Bacteria | 2567 |
| 297 | Ga0316593_10002050 | 3300032168 | Bacteria | 4659 |
| 298 | Ga0316593_10005976 | 3300032168 | Bacteria | 3255 |
| 299 | Ga0316593_10010856 | 3300032168 | Bacteria | 2628 |
| 300 | Ga0316593_10050484 | 3300032168 | Bacteria | 1404 |
| 301 | Ga0315913_1000072 | 3300033430 | Bacteria | 54585 |
| 302 | Ga0315915_1000006 | 3300033464 | Bacteria | 330709 |
| 303 | Ga0373923_0001939 | 3300035111 | Bacteria | 6196 |
| 304 | Ga0373953_0004269 | 3300035117 | Bacteria | 4538 |
| 305 | Ga0373954_0014915 | 3300035118 | Bacteria | 3468 |
| 306 | Ga0373956_0000522 | 3300035119 | Bacteria | 15766 |
| 307 | Ga0373943_0024442 | 3300035170 | Bacteria | 2817 |
| 308 | Ga0373955_0002506 | 3300035172 | Bacteria | 8024 |
| 309 | Ga0373955_0044783 | 3300035172 | Bacteria | 2385 |
| 310 | Ga0316574_0007711 | 3300035398 | Bacteria | 5918 |
| 311 | Ga0316574_0011205 | 3300035398 | Bacteria | 5090 |
| 312 | Ga0316574_0031279 | 3300035398 | Bacteria | 3228 |
| 313 | Ga0316574_0042223 | 3300035398 | Bacteria | 2813 |
| 314 | Ga0316574_0048209 | 3300035398 | Bacteria | 2644 |
| 315 | Ga0316574_0056360 | 3300035398 | Bacteria | 2458 |
| 316 | Ga0373924_0062347 | 3300035410 | Bacteria | 1561 |
| 317 | Ga0373935_0028567 | 3300035692 | Bacteria | 3447 |
| 318 | Ga0373935_0133431 | 3300035692 | Bacteria | 1671 |
| 319 | Ga0373933_0001691 | 3300035724 | Bacteria | 12832 |
| 320 | Ga0373933_0005988 | 3300035724 | Bacteria | 6618 |
| 321 | Ga0373937_0000652 | 3300036401 | Bacteria | 30454 |
| 322 | Ga0373937_0002173 | 3300036401 | Bacteria | 16431 |
| 323 | Ga0316582_0024509 | 3300036647 | Bacteria | 3611 |
| 324 | Ga0316582_0031930 | 3300036647 | Bacteria | 3223 |
| 325 | Ga0316582_0053319 | 3300036647 | Bacteria | 2572 |
| 326 | Ga0316582_0293341 | 3300036647 | Unclassified | 1117 |
| 327 | Ga0316584_0025258 | 3300036712 | Bacteria | 4355 |
| 328 | Ga0316584_0046843 | 3300036712 | Bacteria | 3230 |
| 329 | Ga0316584_0077443 | 3300036712 | Bacteria | 2491 |
| 330 | Ga0316584_0094592 | 3300036712 | Bacteria | 2237 |
| 331 | Ga0316584_0116588 | 3300036712 | Bacteria | 1997 |
| 332 | Ga0395899_0030484 | 3300037312 | Bacteria | 4056 |
| 333 | Ga0395900_0004697 | 3300037418 | Bacteria | 14399 |
| 334 | Ga0395900_0005946 | 3300037418 | Bacteria | 12737 |
| 335 | Ga0395900_0013612 | 3300037418 | Bacteria | 8308 |
| 336 | Ga0395900_0269586 | 3300037418 | Bacteria | 1697 |
| 337 | Ga0395898_0004262 | 3300037466 | Bacteria | 15687 |
| 338 | Ga0395898_0187932 | 3300037466 | Bacteria | 1974 |
| 339 | Ga0395905_0003994 | 3300037471 | Bacteria | 15499 |
| 340 | Ga0395905_0005717 | 3300037471 | Bacteria | 12641 |
| 341 | Ga0316581_0036438 | 3300037588 | Bacteria | 1493 |
| 342 | Ga0316581_0037502 | 3300037588 | Bacteria | 1473 |
| 343 | Ga0436364_0295817 | 3300037853 | Bacteria | 3226 |
| 344 | Ga0436364_0304718 | 3300037853 | Bacteria | 4030 |
| 345 | Ga0395901_0010019 | 3300038443 | Bacteria | 9608 |
| 346 | Ga0395901_0010623 | 3300038443 | Bacteria | 9328 |
| 347 | Ga0395901_0175495 | 3300038443 | Bacteria | 2248 |
| 348 | Ga0400484_36359 | 3300038725 | Bacteria | 17061 |
| 349 | Ga0400484_37737 | 3300038725 | Bacteria | 6182 |
| 350 | Ga0400484_42782 | 3300038725 | Bacteria | 22609 |
| 351 | Ga0400490_09879 | 3300038726 | Bacteria | 10037 |
| 352 | Ga0400490_18457 | 3300038726 | Bacteria | 45271 |
| 353 | Ga0400491_14515 | 3300038727 | Bacteria | 1610 |
| 354 | Ga0400485_02933 | 3300038735 | Bacteria | 11147 |
| 355 | Ga0400488_05672 | 3300038741 | Bacteria | 4340 |
| 356 | Ga0400488_08497 | 3300038741 | Bacteria | 4900 |
| 357 | Ga0400488_22293 | 3300038741 | Bacteria | 1884 |
| 358 | Ga0400488_24757 | 3300038741 | Bacteria | 21056 |
| 359 | Ga0400488_26284 | 3300038741 | Bacteria | 7290 |
| 360 | Ga0400488_27595 | 3300038741 | Bacteria | 2719 |
| 361 | Ga0400488_42681 | 3300038741 | Bacteria | 4391 |
| 362 | Ga0400486_23147 | 3300038742 | Bacteria | 54344 |
| 363 | Ga0400486_23232 | 3300038742 | Bacteria | 285561 |
| 364 | Ga0400483_020538 | 3300039062 | Bacteria | 3742 |
| 365 | Ga0400483_039692 | 3300039062 | Bacteria | 19529 |
| 366 | Ga0400483_063981 | 3300039062 | Bacteria | 3302 |
| 367 | Ga0400483_064632 | 3300039062 | Bacteria | 149376 |
| 368 | Ga0400483_074051 | 3300039062 | Bacteria | 1568 |
| 369 | Ga0400483_101010 | 3300039062 | Bacteria | 6660 |
| 370 | Ga0400483_125974 | 3300039062 | Bacteria | 14934 |
| 371 | Ga0400483_143205 | 3300039062 | Bacteria | 10837 |
| 372 | Ga0400483_164273 | 3300039062 | Bacteria | 103284 |
| 373 | Ga0400483_167010 | 3300039062 | Bacteria | 16343 |
| 374 | Ga0400483_179661 | 3300039062 | Bacteria | 10571 |
| 375 | Ga0400483_185206 | 3300039062 | Bacteria | 144624 |
| 376 | Ga0400483_186846 | 3300039062 | Bacteria | 3882 |
| 377 | Ga0400483_197539 | 3300039062 | Bacteria | 7625 |
| 378 | Ga0400483_207839 | 3300039062 | Bacteria | 57162 |
| 379 | Ga0400483_220742 | 3300039062 | Bacteria | 22099 |
| 380 | Ga0400483_231265 | 3300039062 | Bacteria | 8305 |
| 381 | Ga0400483_277319 | 3300039062 | Bacteria | 4884 |
| 382 | Ga0400483_290131 | 3300039062 | Bacteria | 2743 |
| 383 | Ga0400487_03892 | 3300039110 | Bacteria | 22882 |
| 384 | Ga0400487_18868 | 3300039110 | Bacteria | 2101 |
| 385 | Ga0400487_29167 | 3300039110 | Bacteria | 39851 |
| 386 | Ga0400487_51021 | 3300039110 | Bacteria | 9608 |
| 387 | Ga0400487_52265 | 3300039110 | Bacteria | 3072 |
| 388 | Ga0400487_65585 | 3300039110 | Bacteria | 14264 |
| 389 | Ga0436360_0090178 | 3300039438 | Bacteria | 14631 |
| 390 | Ga0436361_0076543 | 3300039447 | Bacteria | 28188 |
| 391 | Ga0436361_0613971 | 3300039447 | Bacteria | 4606 |
| 392 | Ga0436363_0067581 | 3300039450 | Bacteria | 3843 |
| 393 | Ga0436363_0134585 | 3300039450 | Bacteria | 4709 |
| 394 | Ga0439466_0040906 | 3300041411 | Bacteria | 1548 |
| 395 | Ga0439431_0009022 | 3300041997 | Bacteria | 2248 |
| 396 | Ga0439435_0001816 | 3300042436 | Bacteria | 4070 |
| 397 | Ga0451577_0103437 | 3300042876 | Bacteria | 2545 |
| 398 | Ga0451577_0159596 | 3300042876 | Bacteria | 2030 |
| 399 | Ga0451577_0168729 | 3300042876 | Bacteria | 1972 |
| 400 | Ga0466972_0000315 | 3300044658 | Bacteria | 27891 |
| 401 | Ga0466978_0024534 | 3300044671 | Bacteria | 3612 |
| 402 | Ga0466965_0020796 | 3300044683 | Bacteria | 3157 |
| 403 | Ga0466966_0001794 | 3300044684 | Bacteria | 13920 |
| 404 | Ga0466961_0000077 | 3300044693 | Bacteria | 60661 |
| 405 | Ga0466963_0055792 | 3300044694 | Bacteria | 2628 |
| 406 | Ga0466964_0005530 | 3300044706 | Bacteria | 4692 |
| 407 | Ga0453684_0001440 | 3300044712 | Bacteria | 67958 |
| 408 | Ga0453684_0002255 | 3300044712 | Bacteria | 47769 |
| 409 | Ga0453684_0009091 | 3300044712 | Bacteria | 17517 |
| 410 | Ga0453684_0036100 | 3300044712 | Bacteria | 6818 |
| 411 | Ga0453684_0064134 | 3300044712 | Bacteria | 4694 |
| 412 | Ga0453684_0146745 | 3300044712 | Bacteria | 2809 |
| 413 | Ga0453684_0162974 | 3300044712 | Bacteria | 2635 |
| 414 | Ga0453684_0163469 | 3300044712 | Bacteria | 2630 |
| 415 | Ga0466968_0010797 | 3300044735 | Bacteria | 3548 |
| 416 | Ga0466970_0000966 | 3300044765 | Bacteria | 13833 |
| 417 | Ga0466957_0061271 | 3300044842 | Bacteria | 2308 |
| 418 | Ga0466960_0016794 | 3300044901 | Bacteria | 3181 |
| 419 | Ga0466959_0001159 | 3300045049 | Bacteria | 15885 |
| 420 | Ga0451576_0140892 | 3300045051 | Bacteria | 2514 |
| 421 | Ga0451576_0175407 | 3300045051 | Bacteria | 2238 |
| 422 | Ga0451576_0438949 | 3300045051 | Bacteria | 1370 |
| 423 | Ga0466967_0048599 | 3300045976 | Bacteria | 3705 |
| 424 | Ga0466967_0093011 | 3300045976 | Bacteria | 2743 |
| 425 | Ga0466967_0285963 | 3300045976 | Bacteria | 1583 |
| 426 | Ga0495603_0025772 | 3300046455 | Bacteria | 3555 |
| 427 | Ga0495629_0014875 | 3300046459 | Bacteria | 5596 |
| 428 | Ga0495629_0066848 | 3300046459 | Bacteria | 2509 |
| 429 | Ga0495638_0091762 | 3300046460 | Bacteria | 1828 |
| 430 | Ga0495651_0003203 | 3300046462 | Bacteria | 12577 |
| 431 | Ga0495651_0029997 | 3300046462 | Bacteria | 4240 |
| 432 | Ga0495651_0064149 | 3300046462 | Bacteria | 2807 |
| 433 | Ga0495653_0000031 | 3300046463 | Bacteria | 137159 |
| 434 | Ga0495653_0000247 | 3300046463 | Bacteria | 43201 |
| 435 | Ga0495584_0033438 | 3300046491 | Bacteria | 2601 |
| 436 | Ga0495607_0000104 | 3300046501 | Bacteria | 89641 |
| 437 | Ga0495608_0000942 | 3300046511 | Bacteria | 20473 |
| 438 | Ga0495608_0001598 | 3300046511 | Bacteria | 16216 |
| 439 | Ga0495618_0011990 | 3300046514 | Bacteria | 5259 |
| 440 | Ga0495628_0000527 | 3300046516 | Bacteria | 35033 |
| 441 | Ga0495628_0070766 | 3300046516 | Bacteria | 2719 |
| 442 | Ga0495630_0004023 | 3300046517 | Bacteria | 10291 |
| 443 | Ga0495631_0082946 | 3300046518 | Bacteria | 1382 |
| 444 | Ga0495632_0071423 | 3300046519 | Bacteria | 1667 |
| 445 | Ga0495643_0051393 | 3300046522 | Bacteria | 2216 |
| 446 | Ga0495663_0019195 | 3300046525 | Bacteria | 1954 |
| 447 | Ga0495652_0000395 | 3300046529 | Bacteria | 51356 |
| 448 | Ga0495652_0016596 | 3300046529 | Bacteria | 6583 |
| 449 | Ga0495640_0036586 | 3300046533 | Bacteria | 3468 |
| 450 | Ga0495586_0032096 | 3300046535 | Bacteria | 2816 |
| 451 | Ga0495587_0000509 | 3300046536 | Bacteria | 27034 |
| 452 | Ga0495587_0001461 | 3300046536 | Bacteria | 15745 |
| 453 | Ga0495609_0070729 | 3300046538 | Bacteria | 1534 |
| 454 | Ga0495597_0025469 | 3300046542 | Bacteria | 2723 |
| 455 | Ga0495645_0006037 | 3300046543 | Bacteria | 8379 |
| 456 | Ga0495633_0061937 | 3300046558 | Bacteria | 1751 |
| 457 | Ga0495667_0001372 | 3300046559 | Bacteria | 16021 |
| 458 | Ga0495667_0001555 | 3300046559 | Bacteria | 15232 |
| 459 | Ga0495634_0040385 | 3300046642 | Bacteria | 3174 |
| 460 | Ga0495625_0039367 | 3300046660 | Bacteria | 3453 |
| 461 | Ga0495635_0000284 | 3300046663 | Bacteria | 32595 |
| 462 | Ga0495635_0115932 | 3300046663 | Bacteria | 1828 |
| 463 | Ga0495657_0000225 | 3300046675 | Bacteria | 51076 |
| 464 | Ga0495599_0001089 | 3300046678 | Bacteria | 15301 |
| 465 | Ga0495623_0000801 | 3300046679 | Bacteria | 21172 |
| 466 | Ga0495623_0050660 | 3300046679 | Bacteria | 2629 |
| 467 | Ga0495646_0027461 | 3300046680 | Bacteria | 3571 |
| 468 | Ga0495658_0092776 | 3300046683 | Bacteria | 1791 |
| 469 | Ga0495600_0000921 | 3300046809 | Bacteria | 15776 |
| 470 | Ga0495600_0002498 | 3300046809 | Bacteria | 10556 |
| 471 | Ga0495604_0000672 | 3300047317 | Bacteria | 28961 |
| 472 | Ga0495604_0003153 | 3300047317 | Bacteria | 13176 |
| 473 | Ga0495674_0002252 | 3300047319 | Bacteria | 18967 |
| 474 | Ga0495674_0041662 | 3300047319 | Bacteria | 4100 |
| 475 | Ga0495672_0043491 | 3300047320 | Bacteria | 2701 |
| 476 | Ga0495680_0001790 | 3300047322 | Bacteria | 22731 |
| 477 | Ga0495680_0003513 | 3300047322 | Bacteria | 15380 |
| 478 | Ga0495675_0001009 | 3300047444 | Bacteria | 17143 |
| 479 | Ga0495675_0173689 | 3300047444 | Bacteria | 1322 |
| 480 | Ga0495681_0063988 | 3300047470 | Bacteria | 1686 |
| 481 | Ga0495684_0001023 | 3300047471 | Bacteria | 22737 |
| 482 | Ga0495602_0000550 | 3300048088 | Bacteria | 35034 |
| 483 | Ga0495615_0000769 | 3300048090 | Bacteria | 4497 |
| 484 | Ga0496102_0290586 | 3300048905 | Bacteria | 1541 |
| 485 | Ga0496104_0005667 | 3300048907 | Bacteria | 10936 |
| 486 | Ga0496104_0069237 | 3300048907 | Bacteria | 3354 |
| 487 | Ga0496105_0010905 | 3300048908 | Bacteria | 7160 |
| 488 | Ga0496105_0016562 | 3300048908 | Bacteria | 5886 |
| 489 | Ga0496106_0046286 | 3300048909 | Bacteria | 3270 |
| 490 | Ga0496106_0108103 | 3300048909 | Bacteria | 2163 |
| 491 | Ga0496106_0132650 | 3300048909 | Bacteria | 1954 |
| 492 | Ga0496108_0041541 | 3300048911 | Bacteria | 3839 |
| 493 | Ga0496108_0044700 | 3300048911 | Bacteria | 3697 |
| 494 | Ga0496109_0030700 | 3300048912 | Bacteria | 4817 |
| 495 | Ga0496114_0037128 | 3300048917 | Bacteria | 4029 |
| 496 | Ga0496114_0119924 | 3300048917 | Bacteria | 2262 |
| 497 | Ga0496115_0209340 | 3300048918 | Bacteria | 1611 |
| 498 | Ga0496116_0085145 | 3300048919 | Bacteria | 1944 |
| 499 | Ga0496118_0021235 | 3300048921 | Bacteria | 5723 |
| 500 | Ga0496118_0042628 | 3300048921 | Bacteria | 3578 |
| 501 | Ga0496118_0064365 | 3300048921 | Bacteria | 2691 |
| 502 | Ga0496122_0000014 | 3300048925 | Bacteria | 491410 |
| 503 | Ga0496122_0000228 | 3300048925 | Bacteria | 125699 |
| 504 | Ga0496122_0002661 | 3300048925 | Bacteria | 24907 |
| 505 | Ga0496122_0039697 | 3300048925 | Bacteria | 3750 |
| 506 | Ga0496123_0044367 | 3300048926 | Bacteria | 3041 |
| 507 | Ga0496124_0056712 | 3300048927 | Bacteria | 3303 |
| 508 | Ga0496124_0058619 | 3300048927 | Bacteria | 3237 |
| 509 | Ga0496125_0000053 | 3300048928 | Bacteria | 279909 |
| 510 | Ga0496125_0001009 | 3300048928 | Bacteria | 43801 |
| 511 | Ga0496125_0045652 | 3300048928 | Bacteria | 3684 |
| 512 | Ga0496125_0084699 | 3300048928 | Bacteria | 2406 |
| 513 | Ga0496125_0091616 | 3300048928 | Bacteria | 2277 |
| 514 | Ga0496126_0000019 | 3300048929 | Bacteria | 564723 |
| 515 | Ga0496126_0000290 | 3300048929 | Bacteria | 106499 |
| 516 | Ga0496126_0006527 | 3300048929 | Bacteria | 12985 |
| 517 | Ga0496126_0055443 | 3300048929 | Bacteria | 3586 |
| 518 | Ga0496126_0099427 | 3300048929 | Bacteria | 2548 |
| 519 | Ga0496126_0112321 | 3300048929 | Bacteria | 2372 |
| 520 | Ga0495682_0042307 | 3300049460 | Bacteria | 1669 |
| 521 | Ga0501031_0029036 | 3300049568 | Bacteria | 3606 |
| 522 | Ga0501031_0030909 | 3300049568 | Bacteria | 3493 |
| 523 | Ga0501032_0006016 | 3300049569 | Bacteria | 8949 |
| 524 | Ga0501032_0044301 | 3300049569 | Bacteria | 3012 |
| 525 | Ga0501033_0039871 | 3300049570 | Bacteria | 3507 |
| 526 | Ga0501033_0040282 | 3300049570 | Bacteria | 3488 |
| 527 | Ga0501033_0197765 | 3300049570 | Bacteria | 1437 |
| 528 | Ga0501034_0003072 | 3300049571 | Bacteria | 19259 |
| 529 | Ga0501034_0003172 | 3300049571 | Bacteria | 18908 |
| 530 | Ga0501034_0028078 | 3300049571 | Bacteria | 5723 |
| 531 | Ga0501034_0040507 | 3300049571 | Bacteria | 4715 |
| 532 | Ga0501034_0078084 | 3300049571 | Bacteria | 3315 |
| 533 | Ga0501034_0150402 | 3300049571 | Bacteria | 2304 |
| 534 | Ga0501034_0183865 | 3300049571 | Bacteria | 2054 |
| 535 | Ga0501036_0005456 | 3300049572 | Bacteria | 10307 |
| 536 | Ga0501036_0026380 | 3300049572 | Bacteria | 4904 |
| 537 | Ga0501036_0055340 | 3300049572 | Bacteria | 3361 |
| 538 | Ga0501036_0079117 | 3300049572 | Bacteria | 2781 |
| 539 | Ga0501036_0179397 | 3300049572 | Bacteria | 1783 |
| 540 | Ga0501037_0004723 | 3300049573 | Bacteria | 9900 |
| 541 | Ga0501037_0040791 | 3300049573 | Bacteria | 3415 |
| 542 | Ga0501038_0006892 | 3300049574 | Bacteria | 10496 |
| 543 | Ga0501038_0008336 | 3300049574 | Bacteria | 9539 |
| 544 | Ga0501038_0011400 | 3300049574 | Bacteria | 8113 |
| 545 | Ga0501039_0005691 | 3300049575 | Bacteria | 9441 |
| 546 | Ga0501039_0029367 | 3300049575 | Bacteria | 4234 |
| 547 | Ga0501039_0083051 | 3300049575 | Bacteria | 2495 |
| 548 | Ga0501039_0169607 | 3300049575 | Bacteria | 1716 |
| 549 | Ga0501040_0029399 | 3300049576 | Unclassified | 3709 |
| 550 | Ga0501040_0040661 | 3300049576 | Bacteria | 3164 |
| 551 | Ga0501040_0047570 | 3300049576 | Bacteria | 2929 |
| 552 | Ga0501043_0011018 | 3300049579 | Bacteria | 7083 |
| 553 | Ga0501043_0038749 | 3300049579 | Bacteria | 3748 |
| 554 | Ga0501043_0107330 | 3300049579 | Bacteria | 2192 |
| 555 | Ga0501047_0010562 | 3300049581 | Bacteria | 8732 |
| 556 | Ga0501047_0033440 | 3300049581 | Bacteria | 4964 |
| 557 | Ga0501047_0082720 | 3300049581 | Bacteria | 3085 |
| 558 | Ga0501047_0101248 | 3300049581 | Bacteria | 2760 |
| 559 | Ga0501047_0269605 | 3300049581 | Bacteria | 1549 |
| 560 | Ga0501067_0060560 | 3300049583 | Bacteria | 2095 |
| 561 | Ga0501069_0034582 | 3300049585 | Bacteria | 2783 |
| 562 | Ga0501070_0000314 | 3300049586 | Bacteria | 43877 |
| 563 | Ga0501070_0021877 | 3300049586 | Bacteria | 5357 |
| 564 | Ga0501070_0024769 | 3300049586 | Bacteria | 5033 |
| 565 | Ga0501070_0072356 | 3300049586 | Bacteria | 2854 |
| 566 | Ga0501071_0212745 | 3300049587 | Bacteria | 1454 |
| 567 | Ga0501072_0022243 | 3300049588 | Bacteria | 4919 |
| 568 | Ga0501072_0116498 | 3300049588 | Bacteria | 2128 |
| 569 | Ga0501074_0016009 | 3300049590 | Bacteria | 5451 |
| 570 | Ga0501075_0016556 | 3300049591 | Bacteria | 5314 |
| 571 | Ga0501075_0109698 | 3300049591 | Bacteria | 2098 |
| 572 | Ga0501079_0102721 | 3300049741 | Bacteria | 2217 |
| 573 | Ga0501080_0052134 | 3300049742 | Bacteria | 3808 |
| 574 | Ga0501035_0020962 | 3300049822 | Bacteria | 6006 |
| 575 | Ga0501035_0024842 | 3300049822 | Bacteria | 5494 |
| 576 | Ga0501035_0026270 | 3300049822 | Bacteria | 5328 |
| 577 | Ga0501035_0028809 | 3300049822 | Bacteria | 5067 |
| 578 | Ga0501044_0000237 | 3300049823 | Bacteria | 69482 |
| 579 | Ga0501044_0000591 | 3300049823 | Bacteria | 44012 |
| 580 | Ga0501044_0004014 | 3300049823 | Bacteria | 16494 |
| 581 | Ga0501044_0108797 | 3300049823 | Bacteria | 2781 |
| 582 | Ga0501044_0208080 | 3300049823 | Bacteria | 1912 |
| 583 | Ga0501044_0303116 | 3300049823 | Bacteria | 1526 |
| 584 | Ga0501045_0190213 | 3300049824 | Bacteria | 1530 |
| 585 | nmdc:mga06z11_48320_c1 | 3300050494 | Bacteria | 2165 |
| 586 | nmdc:mga06z11_93017_c1 | 3300050494 | Bacteria | 1641 |
| 587 | nmdc:mga07m45_44132_c2 | 3300050496 | Bacteria | 2307 |
| 588 | nmdc:mga05p37_23683_c1 | 3300050507 | Bacteria | 7454 |
| 589 | nmdc:mga05p37_383102_c1 | 3300050507 | Bacteria | 1647 |
| 590 | nmdc:mga05p37_480203_c1 | 3300050507 | Bacteria | 1432 |
| 591 | nmdc:mga08y16_199434_c1 | 3300050511 | Bacteria | 2074 |
| 592 | nmdc:mga0n895_67854_c1 | 3300050512 | Bacteria | 3532 |
| 593 | Ga0495601_0023119 | 3300053077 | Bacteria | 3818 |
| 594 | Ga0495601_0052183 | 3300053077 | Bacteria | 2581 |
| 595 | Ga0495612_0000558 | 3300053078 | Bacteria | 14950 |
| 596 | Ga0495612_0003441 | 3300053078 | Bacteria | 6563 |
| 597 | Ga0495595_0000440 | 3300053084 | Bacteria | 15734 |
| 598 | Ga0495619_0003910 | 3300053085 | Bacteria | 9571 |
| 599 | Ga0495619_0047585 | 3300053085 | Bacteria | 2824 |
| 600 | Ga0495619_0108531 | 3300053085 | Bacteria | 1894 |
| 601 | Ga0495619_0153635 | 3300053085 | Bacteria | 1588 |
| 602 | Ga0500647_0075014 | 3300053091 | Bacteria | 1623 |
| 603 | Ga0500557_000056 | 3300053105 | Bacteria | 49363 |
| 604 | Ga0500642_0000031 | 3300053130 | Bacteria | 114671 |
| 605 | Ga0500622_0000550 | 3300053156 | Bacteria | 34405 |
| 606 | Ga0500636_0060626 | 3300053177 | Bacteria | 2209 |
| 607 | Ga0500625_028480 | 3300053729 | Bacteria | 2651 |
| 608 | Ga0501082_0128108 | 3300060353 | Bacteria | 2202 |
| 609 | Ga0530510_0100917 | 3300061734 | Bacteria | 2110 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036647 | Ga0316582_0293341 | Ga0316582_0293341_16_1080 | 317 |
| 2 | 3300005530 | Ga0070679_100186156 | Ga0070679_1001861562 | 322 |
| 3 | 3300005545 | Ga0070695_100008648 | Ga0070695_1000086484 | 322 |
| 4 | 3300049568 | Ga0501031_0029036 | Ga0501031_0029036_623_1924 | 326 |
| 5 | 3300049572 | Ga0501036_0026380 | Ga0501036_0026380_1952_3277 | 326 |
| 6 | 3300049574 | Ga0501038_0008336 | Ga0501038_0008336_1147_2469 | 326 |
| 7 | 3300049579 | Ga0501043_0011018 | Ga0501043_0011018_4243_5568 | 326 |
| 8 | 3300049822 | Ga0501035_0026270 | Ga0501035_0026270_3954_5279 | 326 |
| 9 | 3300049823 | Ga0501044_0000237 | Ga0501044_0000237_54610_55935 | 326 |
| 10 | 3300005471 | Ga0070698_100211385 | Ga0070698_1002113852 | 327 |
| 11 | 3300005546 | Ga0070696_100012071 | Ga0070696_1000120714 | 328 |
| 12 | 3300048905 | Ga0496102_0290586 | Ga0496102_0290586_45_1295 | 332 |
| 13 | 3300038443 | Ga0395901_0175495 | Ga0395901_0175495_1061_2158 | 334 |
| 14 | 3300005457 | Ga0070662_100192448 | Ga0070662_1001924481 | 337 |
| 15 | 3300048911 | Ga0496108_0041541 | Ga0496108_0041541_191_1468 | 337 |
| 16 | 3300048912 | Ga0496109_0030700 | Ga0496109_0030700_424_1701 | 337 |
| 17 | 3300048917 | Ga0496114_0037128 | Ga0496114_0037128_2440_3717 | 337 |
| 18 | 3300031251 | Ga0265327_10080705 | Ga0265327_100807051 | 338 |
| 19 | 3300009147 | Ga0114129_10162572 | Ga0114129_101625722 | 340 |
| 20 | 3300032139 | Ga0316580_10009353 | Ga0316580_100093532 | 340 |
| 21 | 3300050507 | nmdc:mga05p37_480203_c1 | nmdc:mga05p37_480203_c1_75_1304 | 340 |
| 22 | 3300005272 | Ga0065703_1000113 | Ga0065703_100011311 | 343 |
| 23 | 3300005289 | Ga0065704_10010619 | Ga0065704_100106191 | 343 |
| 24 | 3300005289 | Ga0065704_10021508 | Ga0065704_100215081 | 343 |
| 25 | 3300005339 | Ga0070660_100042021 | Ga0070660_1000420213 | 343 |
| 26 | 3300005353 | Ga0070669_100001257 | Ga0070669_1000012573 | 343 |
| 27 | 3300005455 | Ga0070663_100017645 | Ga0070663_1000176452 | 343 |
| 28 | 3300005548 | Ga0070665_100000775 | Ga0070665_10000077522 | 343 |
| 29 | 3300009036 | Ga0105244_10052226 | Ga0105244_100522261 | 343 |
| 30 | 3300009036 | Ga0105244_10066657 | Ga0105244_100666571 | 343 |
| 31 | 3300009148 | Ga0105243_10000052 | Ga0105243_1000005282 | 343 |
| 32 | 3300009553 | Ga0105249_10045631 | Ga0105249_100456313 | 343 |
| 33 | 3300013104 | Ga0157370_10270193 | Ga0157370_102701931 | 343 |
| 34 | 3300017792 | Ga0163161_10014000 | Ga0163161_100140004 | 343 |
| 35 | 3300017792 | Ga0163161_10190193 | Ga0163161_101901931 | 343 |
| 36 | 3300025728 | Ga0207655_1000618 | Ga0207655_10006184 | 343 |
| 37 | 3300025728 | Ga0207655_1001345 | Ga0207655_10013455 | 343 |
| 38 | 3300025735 | Ga0207713_1011192 | Ga0207713_10111922 | 343 |
| 39 | 3300025909 | Ga0207705_10025894 | Ga0207705_100258942 | 343 |
| 40 | 3300025919 | Ga0207657_10009690 | Ga0207657_100096907 | 343 |
| 41 | 3300025923 | Ga0207681_10000529 | Ga0207681_1000052914 | 343 |
| 42 | 3300025935 | Ga0207709_10000016 | Ga0207709_10000016220 | 343 |
| 43 | 3300025949 | Ga0207667_10020974 | Ga0207667_100209742 | 343 |
| 44 | 3300025960 | Ga0207651_10029993 | Ga0207651_100299931 | 343 |
| 45 | 3300041411 | Ga0439466_0040906 | Ga0439466_0040906_199_1476 | 343 |
| 46 | 3300046460 | Ga0495638_0091762 | Ga0495638_0091762_102_1379 | 343 |
| 47 | 3300046519 | Ga0495632_0071423 | Ga0495632_0071423_197_1474 | 343 |
| 48 | 3300046525 | Ga0495663_0019195 | Ga0495663_0019195_81_1358 | 343 |
| 49 | 3300046558 | Ga0495633_0061937 | Ga0495633_0061937_174_1451 | 343 |
| 50 | 3300047470 | Ga0495681_0063988 | Ga0495681_0063988_115_1392 | 343 |
| 51 | 3300049460 | Ga0495682_0042307 | Ga0495682_0042307_201_1478 | 343 |
| 52 | 3300003856 | Ga0058692_1000007 | Ga0058692_100000793 | 345 |
| 53 | 3300006177 | Ga0075362_10016988 | Ga0075362_100169882 | 345 |
| 54 | 3300009036 | Ga0105244_10018416 | Ga0105244_100184164 | 345 |
| 55 | 3300009093 | Ga0105240_10004512 | Ga0105240_100045125 | 345 |
| 56 | 3300009101 | Ga0105247_10001174 | Ga0105247_1000117419 | 345 |
| 57 | 3300025728 | Ga0207655_1014647 | Ga0207655_10146474 | 345 |
| 58 | 3300025900 | Ga0207710_10000018 | Ga0207710_1000001878 | 345 |
| 59 | 3300025913 | Ga0207695_10012680 | Ga0207695_100126808 | 345 |
| 60 | 3300027312 | Ga0209371_1000024 | Ga0209371_1000024260 | 345 |
| 61 | 3300030500 | Ga0268256_1000026 | Ga0268256_1000026260 | 345 |
| 62 | 3300035398 | Ga0316574_0048209 | Ga0316574_0048209_931_2250 | 347 |
| 63 | 3300036712 | Ga0316584_0025258 | Ga0316584_0025258_1093_2412 | 347 |
| 64 | 3300009094 | Ga0111539_10294156 | Ga0111539_102941562 | 349 |
| 65 | 3300027907 | Ga0207428_10104598 | Ga0207428_101045982 | 349 |
| 66 | 3300049586 | Ga0501070_0021877 | Ga0501070_0021877_1714_2919 | 349 |
| 67 | 3300050511 | nmdc:mga08y16_199434_c1 | nmdc:mga08y16_199434_c1_518_1795 | 349 |
| 68 | 3300009011 | Ga0105251_10005783 | Ga0105251_100057834 | 351 |
| 69 | 3300009036 | Ga0105244_10010793 | Ga0105244_100107934 | 351 |
| 70 | 3300009036 | Ga0105244_10024684 | Ga0105244_100246841 | 351 |
| 71 | 3300009092 | Ga0105250_10004830 | Ga0105250_100048304 | 351 |
| 72 | 3300009553 | Ga0105249_10001245 | Ga0105249_100012452 | 351 |
| 73 | 3300025728 | Ga0207655_1000728 | Ga0207655_100072818 | 351 |
| 74 | 3300025728 | Ga0207655_1002977 | Ga0207655_10029779 | 351 |
| 75 | 3300025961 | Ga0207712_10002358 | Ga0207712_1000235811 | 351 |
| 76 | 3300031728 | Ga0316578_10050663 | Ga0316578_100506632 | 351 |
| 77 | 3300046660 | Ga0495625_0039367 | Ga0495625_0039367_98_1375 | 351 |
| 78 | 3300048929 | Ga0496126_0099427 | Ga0496126_0099427_400_1677 | 351 |
| 79 | 3300005467 | Ga0070706_100238815 | Ga0070706_1002388152 | 352 |
| 80 | 3300025910 | Ga0207684_10225722 | Ga0207684_102257221 | 352 |
| 81 | 3300049583 | Ga0501067_0060560 | Ga0501067_0060560_871_2013 | 352 |
| 82 | 3300005288 | Ga0065714_10067024 | Ga0065714_100670241 | 353 |
| 83 | 3300006946 | Ga0079104_1000025 | Ga0079104_1000025131 | 354 |
| 84 | 3300009148 | Ga0105243_10002241 | Ga0105243_100022418 | 354 |
| 85 | 3300025935 | Ga0207709_10000159 | Ga0207709_1000015928 | 354 |
| 86 | 3300025935 | Ga0207709_10000740 | Ga0207709_100007408 | 354 |
| 87 | 3300025936 | Ga0207670_10142855 | Ga0207670_101428552 | 354 |
| 88 | 3300027111 | Ga0209281_1000007 | Ga0209281_100000791 | 354 |
| 89 | 3300038735 | Ga0400485_02933 | Ga0400485_02933_7643_8923 | 357 |
| 90 | 3300038742 | Ga0400486_23147 | Ga0400486_23147_50803_52083 | 357 |
| 91 | 3300039110 | Ga0400487_52265 | Ga0400487_52265_601_1881 | 357 |
| 92 | 3300031251 | Ga0265327_10000270 | Ga0265327_1000027038 | 358 |
| 93 | 3300046642 | Ga0495634_0040385 | Ga0495634_0040385_26_1249 | 359 |
| 94 | 3300047444 | Ga0495675_0173689 | Ga0495675_0173689_85_1308 | 359 |
| 95 | 3300042876 | Ga0451577_0168729 | Ga0451577_0168729_656_1819 | 361 |
| 96 | 3300044712 | Ga0453684_0036100 | Ga0453684_0036100_5225_6388 | 361 |
| 97 | 3300044712 | Ga0453684_0162974 | Ga0453684_0162974_742_1905 | 361 |
| 98 | 3300045051 | Ga0451576_0438949 | Ga0451576_0438949_150_1313 | 361 |
| 99 | 3300048927 | Ga0496124_0056712 | Ga0496124_0056712_1894_3210 | 362 |
| 100 | 3300005435 | Ga0070714_100000078 | Ga0070714_10000007845 | 363 |
| 101 | 3300025929 | Ga0207664_10000043 | Ga0207664_1000004388 | 363 |
| 102 | 3300031240 | Ga0265320_10053549 | Ga0265320_100535492 | 364 |
| 103 | 3300049576 | Ga0501040_0029399 | Ga0501040_0029399_41_1183 | 364 |
| 104 | 3300005347 | Ga0070668_100007902 | Ga0070668_1000079023 | 367 |
| 105 | 3300005563 | Ga0068855_100025809 | Ga0068855_1000258093 | 367 |
| 106 | 3300005719 | Ga0068861_100000713 | Ga0068861_1000007137 | 367 |
| 107 | 3300009553 | Ga0105249_10004532 | Ga0105249_100045326 | 367 |
| 108 | 3300025927 | Ga0207687_10034830 | Ga0207687_100348302 | 367 |
| 109 | 3300025933 | Ga0207706_10009893 | Ga0207706_100098933 | 367 |
| 110 | 3300025972 | Ga0207668_10017184 | Ga0207668_100171843 | 367 |
| 111 | 3300026118 | Ga0207675_100001418 | Ga0207675_10000141812 | 367 |
| 112 | 3300045051 | Ga0451576_0175407 | Ga0451576_0175407_113_1252 | 367 |
| 113 | 3300028654 | Ga0265322_10004158 | Ga0265322_100041582 | 369 |
| 114 | 3300031344 | Ga0265316_10056814 | Ga0265316_100568143 | 369 |
| 115 | 3300031712 | Ga0265342_10101813 | Ga0265342_101018132 | 369 |
| 116 | 3300046462 | Ga0495651_0064149 | Ga0495651_0064149_552_1838 | 369 |
| 117 | 3300006881 | Ga0068865_100068733 | Ga0068865_1000687331 | 370 |
| 118 | 3300017792 | Ga0163161_10023009 | Ga0163161_100230092 | 370 |
| 119 | 3300053085 | Ga0495619_0108531 | Ga0495619_0108531_203_1489 | 370 |
| 120 | 3300021361 | Ga0213872_10000439 | Ga0213872_100004394 | 371 |
| 121 | 3300039447 | Ga0436361_0076543 | Ga0436361_0076543_14761_16035 | 371 |
| 122 | 3300014325 | Ga0163163_10199018 | Ga0163163_101990182 | 373 |
| 123 | 3300031727 | Ga0316576_10097988 | Ga0316576_100979882 | 373 |
| 124 | 3300039062 | Ga0400483_064632 | Ga0400483_064632_29073_30344 | 373 |
| 125 | 3300039062 | Ga0400483_185206 | Ga0400483_185206_24406_25677 | 373 |
| 126 | 3300048925 | Ga0496122_0039697 | Ga0496122_0039697_2416_3666 | 373 |
| 127 | 3300014325 | Ga0163163_10116161 | Ga0163163_101161612 | 374 |
| 128 | 3300048925 | Ga0496122_0002661 | Ga0496122_0002661_16376_17773 | 374 |
| 129 | 3300048928 | Ga0496125_0001009 | Ga0496125_0001009_17920_19317 | 374 |
| 130 | 3300049571 | Ga0501034_0150402 | Ga0501034_0150402_97_1398 | 376 |
| 131 | 3300041997 | Ga0439431_0009022 | Ga0439431_0009022_693_2000 | 378 |
| 132 | 3300042876 | Ga0451577_0103437 | Ga0451577_0103437_1259_2437 | 378 |
| 133 | 3300014497 | Ga0182008_10072653 | Ga0182008_100726532 | 379 |
| 134 | 3300044712 | Ga0453684_0146745 | Ga0453684_0146745_1464_2642 | 380 |
| 135 | iso_pu_bacteria | 2574179768 | 2574431361 | 380 |
| 136 | iso_pu_bacteria | 2643221541 | 2643728649 | 380 |
| 137 | iso_pu_bacteria | 2643221580 | 2643910956 | 380 |
| 138 | iso_pu_bacteria | 2643221591 | 2643966671 | 380 |
| 139 | iso_pu_bacteria | 2643221606 | 2644042534 | 380 |
| 140 | iso_pu_bacteria | 2643221671 | 2644392113 | 380 |
| 141 | iso_pu_bacteria | 2721755523 | 2722882681 | 380 |
| 142 | iso_pu_bacteria | 2891633521 | 2891636998 | 380 |
| 143 | iso_pu_bacteria | 2916178963 | 2916179305 | 380 |
| 144 | iso_pu_bacteria | 8047673197 | 8047677106 | 380 |
| 145 | 3300005327 | Ga0070658_10116729 | Ga0070658_101167292 | 381 |
| 146 | 3300031665 | Ga0316575_10006080 | Ga0316575_100060801 | 381 |
| 147 | iso_pu_bacteria | 2513237095 | 2513652647 | 381 |
| 148 | iso_pu_bacteria | 2547132512 | 2548847539 | 381 |
| 149 | iso_pu_bacteria | 2643221629 | 2644164142 | 381 |
| 150 | iso_pu_bacteria | 2643221662 | 2644348193 | 381 |
| 151 | iso_pu_bacteria | 2816332527 | 2818243314 | 381 |
| 152 | iso_pu_bacteria | 2846540461 | 2846542935 | 381 |
| 153 | iso_pu_bacteria | 2885409591 | 2885415557 | 381 |
| 154 | iso_pu_bacteria | 2888378607 | 2888381793 | 381 |
| 155 | iso_pu_bacteria | 2889033259 | 2889034696 | 381 |
| 156 | iso_pu_bacteria | 2941515067 | 2941522548 | 381 |
| 157 | 3300028800 | Ga0265338_10014863 | Ga0265338_100148636 | 382 |
| 158 | 3300035398 | Ga0316574_0031279 | Ga0316574_0031279_532_1734 | 382 |
| 159 | 3300044712 | Ga0453684_0064134 | Ga0453684_0064134_587_1804 | 382 |
| 160 | iso_pu_bacteria | 2639762793 | 2640735989 | 382 |
| 161 | iso_pu_bacteria | 2643221614 | 2644086121 | 382 |
| 162 | iso_pu_bacteria | 2643221661 | 2644345212 | 382 |
| 163 | iso_pu_bacteria | 2643221665 | 2644364871 | 382 |
| 164 | iso_pu_bacteria | 2643221666 | 2644369486 | 382 |
| 165 | iso_pu_bacteria | 2739367655 | 2739611779 | 382 |
| 166 | iso_pu_bacteria | 2744054655 | 2745159755 | 382 |
| 167 | iso_pu_bacteria | 2773857761 | 2774390237 | 382 |
| 168 | iso_pu_bacteria | 2773857770 | 2774437910 | 382 |
| 169 | iso_pu_bacteria | 2811994881 | 2812370193 | 382 |
| 170 | iso_pu_bacteria | 2852103415 | 2852107900 | 382 |
| 171 | iso_pu_bacteria | 2881927736 | 2881931283 | 382 |
| 172 | iso_pu_bacteria | 2882806704 | 2882807553 | 382 |
| 173 | iso_pu_bacteria | 2887375801 | 2887380663 | 382 |
| 174 | iso_pu_bacteria | 2919182534 | 2919184593 | 382 |
| 175 | iso_pu_bacteria | 2919506607 | 2919507694 | 382 |
| 176 | iso_pu_bacteria | 2923519811 | 2923524285 | 382 |
| 177 | iso_pu_bacteria | 2928515477 | 2928517661 | 382 |
| 178 | iso_pu_bacteria | 2990196909 | 2990199567 | 382 |
| 179 | iso_pu_bacteria | 8033232454 | 8033234246 | 382 |
| 180 | iso_pu_bacteria | 8048746797 | 8048748524 | 382 |
| 181 | iso_pu_bacteria | 8055878733 | 8055882219 | 382 |
| 182 | iso_pu_bacteria | 8057101203 | 8057101303 | 382 |
| 183 | 3300027876 | Ga0209974_10038284 | Ga0209974_100382842 | 383 |
| 184 | 3300031727 | Ga0316576_10044936 | Ga0316576_100449362 | 383 |
| 185 | 3300031727 | Ga0316576_10120411 | Ga0316576_101204112 | 383 |
| 186 | 3300036647 | Ga0316582_0031930 | Ga0316582_0031930_1547_2758 | 383 |
| 187 | 3300036712 | Ga0316584_0077443 | Ga0316584_0077443_898_2109 | 383 |
| 188 | 3300048928 | Ga0496125_0091616 | Ga0496125_0091616_78_1352 | 383 |
| 189 | 3300049588 | Ga0501072_0022243 | Ga0501072_0022243_2417_3664 | 383 |
| 190 | 3300049590 | Ga0501074_0016009 | Ga0501074_0016009_41_1288 | 383 |
| 191 | 3300049591 | Ga0501075_0016556 | Ga0501075_0016556_4018_5265 | 383 |
| 192 | iso_pu_bacteria | 2537561728 | 2538426417 | 383 |
| 193 | iso_pu_bacteria | 2643221598 | 2644000123 | 383 |
| 194 | iso_pu_bacteria | 2855195626 | 2855198059 | 383 |
| 195 | iso_pu_bacteria | 2858466076 | 2858466616 | 383 |
| 196 | iso_pu_bacteria | 2871272651 | 2871273389 | 383 |
| 197 | iso_pu_bacteria | 2871282230 | 2871282968 | 383 |
| 198 | iso_pu_bacteria | 2881714928 | 2881715668 | 383 |
| 199 | iso_pu_bacteria | 2884791551 | 2884793350 | 383 |
| 200 | iso_pu_bacteria | 2896184354 | 2896185431 | 383 |
| 201 | iso_pu_bacteria | 2896253425 | 2896256656 | 383 |
| 202 | iso_pu_bacteria | 2900051742 | 2900054618 | 383 |
| 203 | iso_pu_bacteria | 8002392321 | 8002395415 | 383 |
| 204 | 3300003215 | JGI25153J46596_10034954 | JGI25153J46596_100349542 | 384 |
| 205 | 3300005366 | Ga0070659_100021415 | Ga0070659_1000214152 | 384 |
| 206 | 3300005468 | Ga0070707_100321174 | Ga0070707_1003211742 | 384 |
| 207 | 3300005546 | Ga0070696_100071257 | Ga0070696_1000712571 | 384 |
| 208 | 3300005548 | Ga0070665_100029742 | Ga0070665_1000297424 | 384 |
| 209 | 3300005563 | Ga0068855_100243603 | Ga0068855_1002436032 | 384 |
| 210 | 3300005614 | Ga0068856_100019551 | Ga0068856_1000195518 | 384 |
| 211 | 3300005618 | Ga0068864_100005182 | Ga0068864_1000051822 | 384 |
| 212 | 3300009147 | Ga0114129_10417583 | Ga0114129_104175832 | 384 |
| 213 | 3300014325 | Ga0163163_10029608 | Ga0163163_100296087 | 384 |
| 214 | 3300014968 | Ga0157379_10123883 | Ga0157379_101238832 | 384 |
| 215 | 3300025231 | Ga0207427_103980 | Ga0207427_1039802 | 384 |
| 216 | 3300025245 | Ga0207425_1000397 | Ga0207425_100039717 | 384 |
| 217 | 3300025261 | Ga0209233_1000671 | Ga0209233_10006717 | 384 |
| 218 | 3300025297 | Ga0209758_1000895 | Ga0209758_100089511 | 384 |
| 219 | 3300025909 | Ga0207705_10003576 | Ga0207705_100035766 | 384 |
| 220 | 3300025910 | Ga0207684_10123273 | Ga0207684_101232733 | 384 |
| 221 | 3300025914 | Ga0207671_10000344 | Ga0207671_1000034429 | 384 |
| 222 | 3300025919 | Ga0207657_10031412 | Ga0207657_100314123 | 384 |
| 223 | 3300025922 | Ga0207646_10225627 | Ga0207646_102256271 | 384 |
| 224 | 3300025928 | Ga0207700_10252300 | Ga0207700_102523001 | 384 |
| 225 | 3300025932 | Ga0207690_10024458 | Ga0207690_100244584 | 384 |
| 226 | 3300025949 | Ga0207667_10188937 | Ga0207667_101889372 | 384 |
| 227 | 3300026078 | Ga0207702_10008462 | Ga0207702_100084623 | 384 |
| 228 | 3300026088 | Ga0207641_10032432 | Ga0207641_100324323 | 384 |
| 229 | 3300026089 | Ga0207648_10094077 | Ga0207648_100940772 | 384 |
| 230 | 3300026095 | Ga0207676_10176755 | Ga0207676_101767552 | 384 |
| 231 | 3300026116 | Ga0207674_10041247 | Ga0207674_100412472 | 384 |
| 232 | 3300026142 | Ga0207698_10011496 | Ga0207698_100114963 | 384 |
| 233 | 3300028379 | Ga0268266_10000167 | Ga0268266_100001676 | 384 |
| 234 | 3300031727 | Ga0316576_10003878 | Ga0316576_100038785 | 384 |
| 235 | 3300031727 | Ga0316576_10064800 | Ga0316576_100648001 | 384 |
| 236 | 3300031731 | Ga0307405_10030034 | Ga0307405_100300344 | 384 |
| 237 | 3300031733 | Ga0316577_10049859 | Ga0316577_100498592 | 384 |
| 238 | 3300031824 | Ga0307413_10040290 | Ga0307413_100402902 | 384 |
| 239 | 3300032004 | Ga0307414_10085841 | Ga0307414_100858412 | 384 |
| 240 | 3300032133 | Ga0316583_10008253 | Ga0316583_100082531 | 384 |
| 241 | 3300032139 | Ga0316580_10012702 | Ga0316580_100127021 | 384 |
| 242 | 3300032168 | Ga0316593_10010856 | Ga0316593_100108562 | 384 |
| 243 | 3300035398 | Ga0316574_0011205 | Ga0316574_0011205_3442_4713 | 384 |
| 244 | 3300035398 | Ga0316574_0056360 | Ga0316574_0056360_518_1789 | 384 |
| 245 | 3300036647 | Ga0316582_0053319 | Ga0316582_0053319_216_1487 | 384 |
| 246 | 3300036712 | Ga0316584_0116588 | Ga0316584_0116588_245_1516 | 384 |
| 247 | 3300037312 | Ga0395899_0030484 | Ga0395899_0030484_2271_3542 | 384 |
| 248 | 3300037418 | Ga0395900_0004697 | Ga0395900_0004697_7084_8355 | 384 |
| 249 | 3300037418 | Ga0395900_0005946 | Ga0395900_0005946_8390_9661 | 384 |
| 250 | 3300037418 | Ga0395900_0269586 | Ga0395900_0269586_304_1575 | 384 |
| 251 | 3300037466 | Ga0395898_0004262 | Ga0395898_0004262_8568_9839 | 384 |
| 252 | 3300037466 | Ga0395898_0187932 | Ga0395898_0187932_88_1359 | 384 |
| 253 | 3300037471 | Ga0395905_0005717 | Ga0395905_0005717_1851_3122 | 384 |
| 254 | 3300037588 | Ga0316581_0037502 | Ga0316581_0037502_59_1330 | 384 |
| 255 | 3300038443 | Ga0395901_0010019 | Ga0395901_0010019_2057_3328 | 384 |
| 256 | 3300038443 | Ga0395901_0010623 | Ga0395901_0010623_5724_6995 | 384 |
| 257 | 3300039062 | Ga0400483_125974 | Ga0400483_125974_12747_14018 | 384 |
| 258 | 3300039062 | Ga0400483_164273 | Ga0400483_164273_14335_15606 | 384 |
| 259 | 3300042876 | Ga0451577_0159596 | Ga0451577_0159596_379_1650 | 384 |
| 260 | 3300044684 | Ga0466966_0001794 | Ga0466966_0001794_8868_10139 | 384 |
| 261 | 3300044706 | Ga0466964_0005530 | Ga0466964_0005530_155_1426 | 384 |
| 262 | 3300044712 | Ga0453684_0001440 | Ga0453684_0001440_15062_16333 | 384 |
| 263 | 3300045051 | Ga0451576_0140892 | Ga0451576_0140892_241_1512 | 384 |
| 264 | 3300045976 | Ga0466967_0093011 | Ga0466967_0093011_1318_2589 | 384 |
| 265 | 3300046463 | Ga0495653_0000031 | Ga0495653_0000031_6066_7337 | 384 |
| 266 | 3300048909 | Ga0496106_0046286 | Ga0496106_0046286_30_1301 | 384 |
| 267 | 3300048917 | Ga0496114_0119924 | Ga0496114_0119924_670_1941 | 384 |
| 268 | 3300048919 | Ga0496116_0085145 | Ga0496116_0085145_333_1604 | 384 |
| 269 | 3300048927 | Ga0496124_0058619 | Ga0496124_0058619_494_1765 | 384 |
| 270 | 3300048928 | Ga0496125_0000053 | Ga0496125_0000053_59408_60679 | 384 |
| 271 | 3300048928 | Ga0496125_0045652 | Ga0496125_0045652_790_2061 | 384 |
| 272 | 3300048929 | Ga0496126_0006527 | Ga0496126_0006527_6575_7846 | 384 |
| 273 | 3300048929 | Ga0496126_0055443 | Ga0496126_0055443_1368_2639 | 384 |
| 274 | 3300049571 | Ga0501034_0003072 | Ga0501034_0003072_4540_5811 | 384 |
| 275 | 3300049581 | Ga0501047_0101248 | Ga0501047_0101248_1026_2297 | 384 |
| 276 | 3300049586 | Ga0501070_0072356 | Ga0501070_0072356_1092_2363 | 384 |
| 277 | 3300049742 | Ga0501080_0052134 | Ga0501080_0052134_1877_3148 | 384 |
| 278 | 3300049822 | Ga0501035_0020962 | Ga0501035_0020962_2060_3331 | 384 |
| 279 | 3300049823 | Ga0501044_0000591 | Ga0501044_0000591_21620_22891 | 384 |
| 280 | 3300050507 | nmdc:mga05p37_383102_c1 | nmdc:mga05p37_383102_c1_191_1417 | 384 |
| 281 | iso_pu_bacteria | 2916699645 | 2916700964 | 384 |
| 282 | iso_pu_bacteria | 2919497567 | 2919499323 | 384 |
| 283 | iso_pu_bacteria | 2984568884 | 2984571735 | 384 |
| 284 | 3300005329 | Ga0070683_100091994 | Ga0070683_1000919942 | 385 |
| 285 | 3300005331 | Ga0070670_100027424 | Ga0070670_1000274242 | 385 |
| 286 | 3300005355 | Ga0070671_100008880 | Ga0070671_1000088809 | 385 |
| 287 | 3300005355 | Ga0070671_100018621 | Ga0070671_1000186214 | 385 |
| 288 | 3300005365 | Ga0070688_100004753 | Ga0070688_1000047534 | 385 |
| 289 | 3300005535 | Ga0070684_100032832 | Ga0070684_1000328322 | 385 |
| 290 | 3300005543 | Ga0070672_100126396 | Ga0070672_1001263961 | 385 |
| 291 | 3300005548 | Ga0070665_100225212 | Ga0070665_1002252121 | 385 |
| 292 | 3300005842 | Ga0068858_100050063 | Ga0068858_1000500632 | 385 |
| 293 | 3300005937 | Ga0081455_10002227 | Ga0081455_1000222715 | 385 |
| 294 | 3300006042 | Ga0075368_10006645 | Ga0075368_100066453 | 385 |
| 295 | 3300006195 | Ga0075366_10009674 | Ga0075366_100096745 | 385 |
| 296 | 3300006358 | Ga0068871_100156000 | Ga0068871_1001560002 | 385 |
| 297 | 3300006847 | Ga0075431_100070172 | Ga0075431_1000701722 | 385 |
| 298 | 3300006852 | Ga0075433_10117913 | Ga0075433_101179132 | 385 |
| 299 | 3300006871 | Ga0075434_100121544 | Ga0075434_1001215442 | 385 |
| 300 | 3300006880 | Ga0075429_100195890 | Ga0075429_1001958902 | 385 |
| 301 | 3300006881 | Ga0068865_100003899 | Ga0068865_1000038994 | 385 |
| 302 | 3300009101 | Ga0105247_10022894 | Ga0105247_100228942 | 385 |
| 303 | 3300009147 | Ga0114129_10002871 | Ga0114129_1000287114 | 385 |
| 304 | 3300009147 | Ga0114129_10006545 | Ga0114129_1000654511 | 385 |
| 305 | 3300009147 | Ga0114129_10076521 | Ga0114129_100765212 | 385 |
| 306 | 3300009174 | Ga0105241_10011730 | Ga0105241_100117303 | 385 |
| 307 | 3300009176 | Ga0105242_10002974 | Ga0105242_100029743 | 385 |
| 308 | 3300009177 | Ga0105248_10005809 | Ga0105248_1000580912 | 385 |
| 309 | 3300009177 | Ga0105248_10108953 | Ga0105248_101089533 | 385 |
| 310 | 3300009545 | Ga0105237_10009505 | Ga0105237_100095056 | 385 |
| 311 | 3300009551 | Ga0105238_10025536 | Ga0105238_100255363 | 385 |
| 312 | 3300011119 | Ga0105246_10004633 | Ga0105246_100046336 | 385 |
| 313 | 3300013104 | Ga0157370_10023150 | Ga0157370_100231502 | 385 |
| 314 | 3300013306 | Ga0163162_10325356 | Ga0163162_103253561 | 385 |
| 315 | 3300014325 | Ga0163163_10127978 | Ga0163163_101279782 | 385 |
| 316 | 3300014968 | Ga0157379_10161028 | Ga0157379_101610282 | 385 |
| 317 | 3300014969 | Ga0157376_10022301 | Ga0157376_100223014 | 385 |
| 318 | 3300021377 | Ga0213874_10011758 | Ga0213874_100117582 | 385 |
| 319 | 3300021388 | Ga0213875_10005448 | Ga0213875_100054484 | 385 |
| 320 | 3300024225 | Ga0224572_1007930 | Ga0224572_10079302 | 385 |
| 321 | 3300025315 | Ga0207697_10006065 | Ga0207697_100060653 | 385 |
| 322 | 3300025911 | Ga0207654_10015252 | Ga0207654_100152523 | 385 |
| 323 | 3300025916 | Ga0207663_10048982 | Ga0207663_100489822 | 385 |
| 324 | 3300025925 | Ga0207650_10016512 | Ga0207650_100165122 | 385 |
| 325 | 3300025931 | Ga0207644_10003286 | Ga0207644_100032862 | 385 |
| 326 | 3300025933 | Ga0207706_10047508 | Ga0207706_100475083 | 385 |
| 327 | 3300025933 | Ga0207706_10058895 | Ga0207706_100588953 | 385 |
| 328 | 3300025938 | Ga0207704_10003562 | Ga0207704_100035624 | 385 |
| 329 | 3300025944 | Ga0207661_10043720 | Ga0207661_100437202 | 385 |
| 330 | 3300025944 | Ga0207661_10158501 | Ga0207661_101585012 | 385 |
| 331 | 3300025960 | Ga0207651_10102889 | Ga0207651_101028892 | 385 |
| 332 | 3300025981 | Ga0207640_10028238 | Ga0207640_100282382 | 385 |
| 333 | 3300025986 | Ga0207658_10174784 | Ga0207658_101747842 | 385 |
| 334 | 3300026035 | Ga0207703_10044617 | Ga0207703_100446173 | 385 |
| 335 | 3300026067 | Ga0207678_10007777 | Ga0207678_100077779 | 385 |
| 336 | 3300026089 | Ga0207648_10260180 | Ga0207648_102601802 | 385 |
| 337 | 3300028379 | Ga0268266_10093792 | Ga0268266_100937922 | 385 |
| 338 | 3300028800 | Ga0265338_10005109 | Ga0265338_1000510912 | 385 |
| 339 | 3300031238 | Ga0265332_10000021 | Ga0265332_10000021137 | 385 |
| 340 | 3300031241 | Ga0265325_10012739 | Ga0265325_100127391 | 385 |
| 341 | 3300031249 | Ga0265339_10000128 | Ga0265339_1000012818 | 385 |
| 342 | 3300031595 | Ga0265313_10000246 | Ga0265313_1000024626 | 385 |
| 343 | 3300031712 | Ga0265342_10083993 | Ga0265342_100839932 | 385 |
| 344 | 3300031727 | Ga0316576_10049679 | Ga0316576_100496793 | 385 |
| 345 | 3300031727 | Ga0316576_10108845 | Ga0316576_101088452 | 385 |
| 346 | 3300031727 | Ga0316576_10111539 | Ga0316576_101115391 | 385 |
| 347 | 3300031901 | Ga0307406_10056494 | Ga0307406_100564942 | 385 |
| 348 | 3300032002 | Ga0307416_100117152 | Ga0307416_1001171522 | 385 |
| 349 | 3300032005 | Ga0307411_10156481 | Ga0307411_101564812 | 385 |
| 350 | 3300032168 | Ga0316593_10005976 | Ga0316593_100059762 | 385 |
| 351 | 3300032168 | Ga0316593_10050484 | Ga0316593_100504841 | 385 |
| 352 | 3300035118 | Ga0373954_0014915 | Ga0373954_0014915_1820_3127 | 385 |
| 353 | 3300035170 | Ga0373943_0024442 | Ga0373943_0024442_1431_2735 | 385 |
| 354 | 3300035172 | Ga0373955_0044783 | Ga0373955_0044783_35_1342 | 385 |
| 355 | 3300035398 | Ga0316574_0007711 | Ga0316574_0007711_4512_5786 | 385 |
| 356 | 3300035398 | Ga0316574_0042223 | Ga0316574_0042223_1086_2360 | 385 |
| 357 | 3300035692 | Ga0373935_0028567 | Ga0373935_0028567_886_2190 | 385 |
| 358 | 3300035692 | Ga0373935_0133431 | Ga0373935_0133431_29_1336 | 385 |
| 359 | 3300035724 | Ga0373933_0005988 | Ga0373933_0005988_4926_6233 | 385 |
| 360 | 3300036401 | Ga0373937_0000652 | Ga0373937_0000652_18069_19376 | 385 |
| 361 | 3300036647 | Ga0316582_0024509 | Ga0316582_0024509_847_2121 | 385 |
| 362 | 3300036712 | Ga0316584_0094592 | Ga0316584_0094592_88_1362 | 385 |
| 363 | 3300037853 | Ga0436364_0295817 | Ga0436364_0295817_1267_2571 | 385 |
| 364 | 3300039438 | Ga0436360_0090178 | Ga0436360_0090178_3936_5240 | 385 |
| 365 | 3300039447 | Ga0436361_0613971 | Ga0436361_0613971_561_1865 | 385 |
| 366 | 3300039450 | Ga0436363_0067581 | Ga0436363_0067581_182_1486 | 385 |
| 367 | 3300044694 | Ga0466963_0055792 | Ga0466963_0055792_302_1576 | 385 |
| 368 | 3300046459 | Ga0495629_0014875 | Ga0495629_0014875_2723_4030 | 385 |
| 369 | 3300046459 | Ga0495629_0066848 | Ga0495629_0066848_151_1455 | 385 |
| 370 | 3300046462 | Ga0495651_0029997 | Ga0495651_0029997_2614_3921 | 385 |
| 371 | 3300046511 | Ga0495608_0001598 | Ga0495608_0001598_3390_4697 | 385 |
| 372 | 3300046514 | Ga0495618_0011990 | Ga0495618_0011990_2610_3917 | 385 |
| 373 | 3300046516 | Ga0495628_0070766 | Ga0495628_0070766_780_2087 | 385 |
| 374 | 3300046518 | Ga0495631_0082946 | Ga0495631_0082946_69_1343 | 385 |
| 375 | 3300046522 | Ga0495643_0051393 | Ga0495643_0051393_143_1444 | 385 |
| 376 | 3300046529 | Ga0495652_0016596 | Ga0495652_0016596_2143_3450 | 385 |
| 377 | 3300046536 | Ga0495587_0001461 | Ga0495587_0001461_11340_12647 | 385 |
| 378 | 3300046538 | Ga0495609_0070729 | Ga0495609_0070729_44_1318 | 385 |
| 379 | 3300046542 | Ga0495597_0025469 | Ga0495597_0025469_406_1707 | 385 |
| 380 | 3300046559 | Ga0495667_0001555 | Ga0495667_0001555_3654_4961 | 385 |
| 381 | 3300046663 | Ga0495635_0115932 | Ga0495635_0115932_77_1384 | 385 |
| 382 | 3300046678 | Ga0495599_0001089 | Ga0495599_0001089_2556_3863 | 385 |
| 383 | 3300046679 | Ga0495623_0050660 | Ga0495623_0050660_988_2295 | 385 |
| 384 | 3300046680 | Ga0495646_0027461 | Ga0495646_0027461_988_2295 | 385 |
| 385 | 3300046683 | Ga0495658_0092776 | Ga0495658_0092776_14_1336 | 385 |
| 386 | 3300046809 | Ga0495600_0002498 | Ga0495600_0002498_6149_7456 | 385 |
| 387 | 3300047317 | Ga0495604_0003153 | Ga0495604_0003153_378_1685 | 385 |
| 388 | 3300047319 | Ga0495674_0041662 | Ga0495674_0041662_1140_2447 | 385 |
| 389 | 3300047322 | Ga0495680_0001790 | Ga0495680_0001790_11392_12699 | 385 |
| 390 | 3300048907 | Ga0496104_0005667 | Ga0496104_0005667_4587_5891 | 385 |
| 391 | 3300048907 | Ga0496104_0069237 | Ga0496104_0069237_798_2099 | 385 |
| 392 | 3300048908 | Ga0496105_0010905 | Ga0496105_0010905_3439_4743 | 385 |
| 393 | 3300048908 | Ga0496105_0016562 | Ga0496105_0016562_3142_4443 | 385 |
| 394 | 3300048909 | Ga0496106_0108103 | Ga0496106_0108103_377_1681 | 385 |
| 395 | 3300048909 | Ga0496106_0132650 | Ga0496106_0132650_226_1527 | 385 |
| 396 | 3300048911 | Ga0496108_0044700 | Ga0496108_0044700_783_2084 | 385 |
| 397 | 3300048918 | Ga0496115_0209340 | Ga0496115_0209340_30_1331 | 385 |
| 398 | 3300048921 | Ga0496118_0042628 | Ga0496118_0042628_199_1500 | 385 |
| 399 | 3300048921 | Ga0496118_0064365 | Ga0496118_0064365_1145_2428 | 385 |
| 400 | 3300048925 | Ga0496122_0000228 | Ga0496122_0000228_106992_108275 | 385 |
| 401 | 3300048929 | Ga0496126_0000290 | Ga0496126_0000290_87829_89112 | 385 |
| 402 | 3300049568 | Ga0501031_0030909 | Ga0501031_0030909_2135_3409 | 385 |
| 403 | 3300049569 | Ga0501032_0006016 | Ga0501032_0006016_4510_5784 | 385 |
| 404 | 3300049570 | Ga0501033_0039871 | Ga0501033_0039871_1594_2874 | 385 |
| 405 | 3300049570 | Ga0501033_0197765 | Ga0501033_0197765_50_1348 | 385 |
| 406 | 3300049571 | Ga0501034_0040507 | Ga0501034_0040507_2492_3766 | 385 |
| 407 | 3300049571 | Ga0501034_0078084 | Ga0501034_0078084_2005_3279 | 385 |
| 408 | 3300049572 | Ga0501036_0005456 | Ga0501036_0005456_6038_7312 | 385 |
| 409 | 3300049572 | Ga0501036_0179397 | Ga0501036_0179397_143_1375 | 385 |
| 410 | 3300049574 | Ga0501038_0006892 | Ga0501038_0006892_1174_2448 | 385 |
| 411 | 3300049575 | Ga0501039_0029367 | Ga0501039_0029367_1174_2448 | 385 |
| 412 | 3300049575 | Ga0501039_0169607 | Ga0501039_0169607_25_1257 | 385 |
| 413 | 3300049576 | Ga0501040_0047570 | Ga0501040_0047570_1272_2504 | 385 |
| 414 | 3300049579 | Ga0501043_0107330 | Ga0501043_0107330_827_2101 | 385 |
| 415 | 3300049581 | Ga0501047_0082720 | Ga0501047_0082720_1313_2587 | 385 |
| 416 | 3300049586 | Ga0501070_0024769 | Ga0501070_0024769_3057_4331 | 385 |
| 417 | 3300049587 | Ga0501071_0212745 | Ga0501071_0212745_162_1436 | 385 |
| 418 | 3300049591 | Ga0501075_0109698 | Ga0501075_0109698_242_1474 | 385 |
| 419 | 3300049741 | Ga0501079_0102721 | Ga0501079_0102721_346_1575 | 385 |
| 420 | 3300049822 | Ga0501035_0024842 | Ga0501035_0024842_3400_4674 | 385 |
| 421 | 3300049823 | Ga0501044_0108797 | Ga0501044_0108797_670_1944 | 385 |
| 422 | 3300049824 | Ga0501045_0190213 | Ga0501045_0190213_168_1397 | 385 |
| 423 | 3300050494 | nmdc:mga06z11_48320_c1 | nmdc:mga06z11_48320_c1_216_1490 | 385 |
| 424 | 3300050494 | nmdc:mga06z11_93017_c1 | nmdc:mga06z11_93017_c1_41_1342 | 385 |
| 425 | 3300050496 | nmdc:mga07m45_44132_c2 | nmdc:mga07m45_44132_c2_358_1659 | 385 |
| 426 | 3300050507 | nmdc:mga05p37_23683_c1 | nmdc:mga05p37_23683_c1_1537_2832 | 385 |
| 427 | 3300050512 | nmdc:mga0n895_67854_c1 | nmdc:mga0n895_67854_c1_1025_2323 | 385 |
| 428 | 3300053077 | Ga0495601_0052183 | Ga0495601_0052183_301_1608 | 385 |
| 429 | 3300053078 | Ga0495612_0003441 | Ga0495612_0003441_3129_4436 | 385 |
| 430 | 3300053084 | Ga0495595_0000440 | Ga0495595_0000440_11390_12697 | 385 |
| 431 | 3300053085 | Ga0495619_0047585 | Ga0495619_0047585_1140_2447 | 385 |
| 432 | 3300053085 | Ga0495619_0153635 | Ga0495619_0153635_198_1499 | 385 |
| 433 | 3300053091 | Ga0500647_0075014 | Ga0500647_0075014_24_1298 | 385 |
| 434 | 3300053105 | Ga0500557_000056 | Ga0500557_000056_23057_24331 | 385 |
| 435 | 3300053130 | Ga0500642_0000031 | Ga0500642_0000031_1104_2378 | 385 |
| 436 | 3300053177 | Ga0500636_0060626 | Ga0500636_0060626_318_1592 | 385 |
| 437 | 3300053729 | Ga0500625_028480 | Ga0500625_028480_918_2192 | 385 |
| 438 | 3300060353 | Ga0501082_0128108 | Ga0501082_0128108_755_1984 | 385 |
| 439 | iso_pu_bacteria | 2747842501 | 2748016738 | 385 |
| 440 | iso_pu_bacteria | 2765235840 | 2765580215 | 385 |
| 441 | iso_pu_bacteria | 2852684882 | 2852686797 | 385 |
| 442 | iso_pu_bacteria | 2883068021 | 2883072041 | 385 |
| 443 | iso_pu_bacteria | 2896085136 | 2896089324 | 385 |
| 444 | iso_pu_bacteria | 2896109856 | 2896111352 | 385 |
| 445 | iso_pu_bacteria | 8021622325 | 8021625141 | 385 |
| 446 | iso_pu_bacteria | 8021626552 | 8021629460 | 385 |
| 447 | iso_pu_bacteria | 8021648035 | 8021650548 | 385 |
| 448 | 3300013100 | Ga0157373_10022866 | Ga0157373_100228661 | 386 |
| 449 | 3300020069 | Ga0197907_10402444 | Ga0197907_104024441 | 386 |
| 450 | 3300031727 | Ga0316576_10012947 | Ga0316576_100129475 | 386 |
| 451 | 3300031728 | Ga0316578_10041198 | Ga0316578_100411982 | 386 |
| 452 | 3300038725 | Ga0400484_36359 | Ga0400484_36359_5011_6288 | 386 |
| 453 | 3300038725 | Ga0400484_37737 | Ga0400484_37737_1246_2523 | 386 |
| 454 | 3300038725 | Ga0400484_42782 | Ga0400484_42782_5122_6399 | 386 |
| 455 | 3300038726 | Ga0400490_09879 | Ga0400490_09879_5490_6767 | 386 |
| 456 | 3300038727 | Ga0400491_14515 | Ga0400491_14515_84_1361 | 386 |
| 457 | 3300038741 | Ga0400488_05672 | Ga0400488_05672_2636_3913 | 386 |
| 458 | 3300038741 | Ga0400488_08497 | Ga0400488_08497_3290_4567 | 386 |
| 459 | 3300038741 | Ga0400488_22293 | Ga0400488_22293_287_1564 | 386 |
| 460 | 3300038741 | Ga0400488_24757 | Ga0400488_24757_13379_14656 | 386 |
| 461 | 3300038741 | Ga0400488_26284 | Ga0400488_26284_5388_6665 | 386 |
| 462 | 3300038741 | Ga0400488_27595 | Ga0400488_27595_1026_2303 | 386 |
| 463 | 3300038741 | Ga0400488_42681 | Ga0400488_42681_2783_4060 | 386 |
| 464 | 3300038742 | Ga0400486_23232 | Ga0400486_23232_257074_258351 | 386 |
| 465 | 3300039062 | Ga0400483_039692 | Ga0400483_039692_15716_16993 | 386 |
| 466 | 3300039062 | Ga0400483_074051 | Ga0400483_074051_112_1389 | 386 |
| 467 | 3300039062 | Ga0400483_101010 | Ga0400483_101010_2527_3804 | 386 |
| 468 | 3300039062 | Ga0400483_143205 | Ga0400483_143205_3223_4500 | 386 |
| 469 | 3300039062 | Ga0400483_167010 | Ga0400483_167010_2005_3282 | 386 |
| 470 | 3300039062 | Ga0400483_179661 | Ga0400483_179661_2583_3860 | 386 |
| 471 | 3300039062 | Ga0400483_207839 | Ga0400483_207839_14003_15280 | 386 |
| 472 | 3300039062 | Ga0400483_220742 | Ga0400483_220742_9366_10643 | 386 |
| 473 | 3300039062 | Ga0400483_231265 | Ga0400483_231265_6675_7952 | 386 |
| 474 | 3300039062 | Ga0400483_277319 | Ga0400483_277319_1550_2827 | 386 |
| 475 | 3300039110 | Ga0400487_29167 | Ga0400487_29167_24056_25333 | 386 |
| 476 | 3300039110 | Ga0400487_51021 | Ga0400487_51021_1118_2395 | 386 |
| 477 | 3300039110 | Ga0400487_65585 | Ga0400487_65585_963_2240 | 386 |
| 478 | 3300048928 | Ga0496125_0084699 | Ga0496125_0084699_743_2020 | 386 |
| 479 | 3300049573 | Ga0501037_0040791 | Ga0501037_0040791_1137_2423 | 386 |
| 480 | 3300049581 | Ga0501047_0269605 | Ga0501047_0269605_79_1365 | 386 |
| 481 | iso_pu_bacteria | 2818991460 | 2819678264 | 386 |
| 482 | iso_pu_bacteria | 2929177148 | 2929181029 | 386 |
| 483 | iso_pu_bacteria | 2945977869 | 2945983430 | 386 |
| 484 | iso_pu_bacteria | 2946013367 | 2946017179 | 386 |
| 485 | 3300005577 | Ga0068857_100053747 | Ga0068857_1000537472 | 387 |
| 486 | 3300026116 | Ga0207674_10024473 | Ga0207674_100244732 | 387 |
| 487 | 3300026116 | Ga0207674_10125108 | Ga0207674_101251082 | 387 |
| 488 | 3300031691 | Ga0316579_10017893 | Ga0316579_100178933 | 387 |
| 489 | 3300031733 | Ga0316577_10073580 | Ga0316577_100735802 | 387 |
| 490 | 3300032168 | Ga0316593_10002050 | Ga0316593_100020503 | 387 |
| 491 | 3300036712 | Ga0316584_0046843 | Ga0316584_0046843_1634_2914 | 387 |
| 492 | 3300037418 | Ga0395900_0013612 | Ga0395900_0013612_3572_4852 | 387 |
| 493 | 3300037588 | Ga0316581_0036438 | Ga0316581_0036438_34_1314 | 387 |
| 494 | 3300039062 | Ga0400483_020538 | Ga0400483_020538_1095_2375 | 387 |
| 495 | 3300039450 | Ga0436363_0134585 | Ga0436363_0134585_1892_3217 | 387 |
| 496 | 3300045976 | Ga0466967_0285963 | Ga0466967_0285963_20_1312 | 387 |
| 497 | 3300049571 | Ga0501034_0028078 | Ga0501034_0028078_4263_5543 | 387 |
| 498 | 3300049585 | Ga0501069_0034582 | Ga0501069_0034582_275_1582 | 387 |
| 499 | 3300049586 | Ga0501070_0000314 | Ga0501070_0000314_39581_40888 | 387 |
| 500 | 3300053156 | Ga0500622_0000550 | Ga0500622_0000550_15245_16549 | 387 |
| 501 | iso_pu_bacteria | 8055225921 | 8055228308 | 387 |
| 502 | 3300003323 | rootH1_10010008 | rootH1_1001000811 | 388 |
| 503 | 3300005355 | Ga0070671_100056945 | Ga0070671_1000569452 | 388 |
| 504 | 3300005435 | Ga0070714_100049291 | Ga0070714_1000492912 | 388 |
| 505 | 3300005436 | Ga0070713_100000415 | Ga0070713_10000041517 | 388 |
| 506 | 3300005459 | Ga0068867_100042617 | Ga0068867_1000426172 | 388 |
| 507 | 3300005614 | Ga0068856_100316975 | Ga0068856_1003169751 | 388 |
| 508 | 3300005616 | Ga0068852_100044457 | Ga0068852_1000444574 | 388 |
| 509 | 3300006028 | Ga0070717_10007752 | Ga0070717_100077526 | 388 |
| 510 | 3300006175 | Ga0070712_100006225 | Ga0070712_1000062253 | 388 |
| 511 | 3300013308 | Ga0157375_10119476 | Ga0157375_101194762 | 388 |
| 512 | 3300021388 | Ga0213875_10014710 | Ga0213875_100147103 | 388 |
| 513 | 3300025928 | Ga0207700_10000115 | Ga0207700_1000011521 | 388 |
| 514 | 3300025940 | Ga0207691_10056953 | Ga0207691_100569532 | 388 |
| 515 | 3300025945 | Ga0207679_10048082 | Ga0207679_100480823 | 388 |
| 516 | 3300026078 | Ga0207702_10222019 | Ga0207702_102220192 | 388 |
| 517 | 3300026089 | Ga0207648_10118790 | Ga0207648_101187902 | 388 |
| 518 | 3300026121 | Ga0207683_10008000 | Ga0207683_100080006 | 388 |
| 519 | 3300031249 | Ga0265339_10001796 | Ga0265339_1000179612 | 388 |
| 520 | 3300031911 | Ga0307412_10008741 | Ga0307412_100087416 | 388 |
| 521 | 3300035111 | Ga0373923_0001939 | Ga0373923_0001939_3540_4886 | 388 |
| 522 | 3300035117 | Ga0373953_0004269 | Ga0373953_0004269_973_2319 | 388 |
| 523 | 3300035119 | Ga0373956_0000522 | Ga0373956_0000522_11546_12892 | 388 |
| 524 | 3300035172 | Ga0373955_0002506 | Ga0373955_0002506_4977_6323 | 388 |
| 525 | 3300035410 | Ga0373924_0062347 | Ga0373924_0062347_38_1384 | 388 |
| 526 | 3300035724 | Ga0373933_0001691 | Ga0373933_0001691_9291_10637 | 388 |
| 527 | 3300036401 | Ga0373937_0002173 | Ga0373937_0002173_10840_12186 | 388 |
| 528 | 3300044712 | Ga0453684_0002255 | Ga0453684_0002255_13013_14296 | 388 |
| 529 | 3300044712 | Ga0453684_0163469 | Ga0453684_0163469_1186_2466 | 388 |
| 530 | 3300046462 | Ga0495651_0003203 | Ga0495651_0003203_10195_11541 | 388 |
| 531 | 3300046463 | Ga0495653_0000247 | Ga0495653_0000247_17638_18984 | 388 |
| 532 | 3300046511 | Ga0495608_0000942 | Ga0495608_0000942_7605_8951 | 388 |
| 533 | 3300046516 | Ga0495628_0000527 | Ga0495628_0000527_21191_22537 | 388 |
| 534 | 3300046517 | Ga0495630_0004023 | Ga0495630_0004023_7114_8460 | 388 |
| 535 | 3300046529 | Ga0495652_0000395 | Ga0495652_0000395_41524_42870 | 388 |
| 536 | 3300046533 | Ga0495640_0036586 | Ga0495640_0036586_712_2058 | 388 |
| 537 | 3300046535 | Ga0495586_0032096 | Ga0495586_0032096_646_1992 | 388 |
| 538 | 3300046536 | Ga0495587_0000509 | Ga0495587_0000509_12416_13762 | 388 |
| 539 | 3300046543 | Ga0495645_0006037 | Ga0495645_0006037_4159_5505 | 388 |
| 540 | 3300046559 | Ga0495667_0001372 | Ga0495667_0001372_3061_4407 | 388 |
| 541 | 3300046663 | Ga0495635_0000284 | Ga0495635_0000284_9635_10981 | 388 |
| 542 | 3300046675 | Ga0495657_0000225 | Ga0495657_0000225_13274_14620 | 388 |
| 543 | 3300046679 | Ga0495623_0000801 | Ga0495623_0000801_17638_18984 | 388 |
| 544 | 3300046809 | Ga0495600_0000921 | Ga0495600_0000921_9245_10591 | 388 |
| 545 | 3300047317 | Ga0495604_0000672 | Ga0495604_0000672_11954_13300 | 388 |
| 546 | 3300047319 | Ga0495674_0002252 | Ga0495674_0002252_9410_10756 | 388 |
| 547 | 3300047320 | Ga0495672_0043491 | Ga0495672_0043491_1307_2617 | 388 |
| 548 | 3300047322 | Ga0495680_0003513 | Ga0495680_0003513_1464_2810 | 388 |
| 549 | 3300047444 | Ga0495675_0001009 | Ga0495675_0001009_9928_11274 | 388 |
| 550 | 3300047471 | Ga0495684_0001023 | Ga0495684_0001023_12416_13762 | 388 |
| 551 | 3300048088 | Ga0495602_0000550 | Ga0495602_0000550_31496_32842 | 388 |
| 552 | 3300048921 | Ga0496118_0021235 | Ga0496118_0021235_515_1810 | 388 |
| 553 | 3300048929 | Ga0496126_0112321 | Ga0496126_0112321_680_1972 | 388 |
| 554 | 3300049572 | Ga0501036_0055340 | Ga0501036_0055340_1581_2819 | 388 |
| 555 | 3300049575 | Ga0501039_0083051 | Ga0501039_0083051_402_1640 | 388 |
| 556 | 3300049576 | Ga0501040_0040661 | Ga0501040_0040661_986_2224 | 388 |
| 557 | 3300049579 | Ga0501043_0038749 | Ga0501043_0038749_690_1976 | 388 |
| 558 | 3300049581 | Ga0501047_0033440 | Ga0501047_0033440_1914_3200 | 388 |
| 559 | 3300049588 | Ga0501072_0116498 | Ga0501072_0116498_187_1425 | 388 |
| 560 | 3300049823 | Ga0501044_0004014 | Ga0501044_0004014_14740_16026 | 388 |
| 561 | 3300053077 | Ga0495601_0023119 | Ga0495601_0023119_2274_3620 | 388 |
| 562 | 3300053078 | Ga0495612_0000558 | Ga0495612_0000558_93_1439 | 388 |
| 563 | 3300053085 | Ga0495619_0003910 | Ga0495619_0003910_2220_3566 | 388 |
| 564 | 3300061734 | Ga0530510_0100917 | Ga0530510_0100917_195_1433 | 388 |
| 565 | iso_pu_bacteria | 2599185292 | 2599903571 | 388 |
| 566 | iso_pu_bacteria | 2643221569 | 2643860062 | 388 |
| 567 | iso_pu_bacteria | 2738543031 | 2739350891 | 388 |
| 568 | 3300003781 | Ga0055536_1004214 | Ga0055536_10042143 | 389 |
| 569 | 3300005290 | Ga0065712_10103577 | Ga0065712_101035771 | 389 |
| 570 | 3300005441 | Ga0070700_100096697 | Ga0070700_1000966972 | 389 |
| 571 | 3300005445 | Ga0070708_100057538 | Ga0070708_1000575383 | 389 |
| 572 | 3300005445 | Ga0070708_100151326 | Ga0070708_1001513261 | 389 |
| 573 | 3300005614 | Ga0068856_100034788 | Ga0068856_1000347884 | 389 |
| 574 | 3300009148 | Ga0105243_10167058 | Ga0105243_101670582 | 389 |
| 575 | 3300013297 | Ga0157378_10005272 | Ga0157378_100052727 | 389 |
| 576 | 3300013307 | Ga0157372_10220781 | Ga0157372_102207812 | 389 |
| 577 | 3300025292 | Ga0209676_1000037 | Ga0209676_1000037247 | 389 |
| 578 | 3300039062 | Ga0400483_063981 | Ga0400483_063981_379_1716 | 389 |
| 579 | 3300039062 | Ga0400483_186846 | Ga0400483_186846_1234_2571 | 389 |
| 580 | 3300049569 | Ga0501032_0044301 | Ga0501032_0044301_1189_2511 | 389 |
| 581 | 3300049570 | Ga0501033_0040282 | Ga0501033_0040282_907_2229 | 389 |
| 582 | 3300049571 | Ga0501034_0003172 | Ga0501034_0003172_10184_11506 | 389 |
| 583 | 3300049571 | Ga0501034_0183865 | Ga0501034_0183865_713_2026 | 389 |
| 584 | 3300049572 | Ga0501036_0079117 | Ga0501036_0079117_1378_2700 | 389 |
| 585 | 3300049573 | Ga0501037_0004723 | Ga0501037_0004723_7672_8994 | 389 |
| 586 | 3300049574 | Ga0501038_0011400 | Ga0501038_0011400_1748_3070 | 389 |
| 587 | 3300049575 | Ga0501039_0005691 | Ga0501039_0005691_1923_3245 | 389 |
| 588 | 3300049581 | Ga0501047_0010562 | Ga0501047_0010562_2683_4005 | 389 |
| 589 | 3300049822 | Ga0501035_0028809 | Ga0501035_0028809_1923_3245 | 389 |
| 590 | 3300049823 | Ga0501044_0303116 | Ga0501044_0303116_33_1355 | 389 |
| 591 | iso_pu_bacteria | 2857576091 | 2857579967 | 389 |
| 592 | 3300009093 | Ga0105240_10003726 | Ga0105240_100037264 | 390 |
| 593 | 3300009551 | Ga0105238_10092019 | Ga0105238_100920192 | 390 |
| 594 | 3300013100 | Ga0157373_10045228 | Ga0157373_100452282 | 390 |
| 595 | 3300014497 | Ga0182008_10015110 | Ga0182008_100151103 | 390 |
| 596 | 3300021388 | Ga0213875_10029488 | Ga0213875_100294882 | 390 |
| 597 | 3300025904 | Ga0207647_10092512 | Ga0207647_100925121 | 390 |
| 598 | 3300025932 | Ga0207690_10041588 | Ga0207690_100415882 | 390 |
| 599 | 3300037853 | Ga0436364_0304718 | Ga0436364_0304718_1930_3240 | 390 |
| 600 | 3300039110 | Ga0400487_03892 | Ga0400487_03892_7404_8693 | 390 |
| 601 | 3300039110 | Ga0400487_18868 | Ga0400487_18868_667_1956 | 390 |
| 602 | 3300046501 | Ga0495607_0000104 | Ga0495607_0000104_24569_25870 | 390 |
| 603 | 3300048925 | Ga0496122_0000014 | Ga0496122_0000014_413993_415333 | 390 |
| 604 | 3300048926 | Ga0496123_0044367 | Ga0496123_0044367_1243_2583 | 390 |
| 605 | 3300048929 | Ga0496126_0000019 | Ga0496126_0000019_413993_415333 | 390 |
| 606 | 3300038726 | Ga0400490_18457 | Ga0400490_18457_1607_2953 | 391 |
| 607 | 3300044658 | Ga0466972_0000315 | Ga0466972_0000315_9672_10979 | 391 |
| 608 | 3300044671 | Ga0466978_0024534 | Ga0466978_0024534_1491_2798 | 391 |
| 609 | 3300044683 | Ga0466965_0020796 | Ga0466965_0020796_1755_3062 | 391 |
| 610 | 3300044693 | Ga0466961_0000077 | Ga0466961_0000077_38875_40182 | 391 |
| 611 | 3300044735 | Ga0466968_0010797 | Ga0466968_0010797_1441_2748 | 391 |
| 612 | 3300044765 | Ga0466970_0000966 | Ga0466970_0000966_7396_8703 | 391 |
| 613 | 3300044842 | Ga0466957_0061271 | Ga0466957_0061271_783_2090 | 391 |
| 614 | 3300044901 | Ga0466960_0016794 | Ga0466960_0016794_690_1997 | 391 |
| 615 | 3300045049 | Ga0466959_0001159 | Ga0466959_0001159_7381_8688 | 391 |
| 616 | 3300045976 | Ga0466967_0048599 | Ga0466967_0048599_246_1553 | 391 |
| 617 | iso_pu_bacteria | 2551306352 | 2552748409 | 391 |
| 618 | iso_pu_bacteria | 2904479285 | 2904480340 | 391 |
| 619 | 3300009545 | Ga0105237_10000166 | Ga0105237_1000016633 | 392 |
| 620 | 3300010375 | Ga0105239_10001740 | Ga0105239_1000174024 | 392 |
| 621 | 3300039062 | Ga0400483_197539 | Ga0400483_197539_6008_7303 | 392 |
| 622 | 3300039062 | Ga0400483_290131 | Ga0400483_290131_728_2023 | 392 |
| 623 | 3300005331 | Ga0070670_100136274 | Ga0070670_1001362742 | 393 |
| 624 | 3300005340 | Ga0070689_100051454 | Ga0070689_1000514543 | 393 |
| 625 | 3300005353 | Ga0070669_100094168 | Ga0070669_1000941682 | 393 |
| 626 | 3300005353 | Ga0070669_100181506 | Ga0070669_1001815061 | 393 |
| 627 | 3300005365 | Ga0070688_100071329 | Ga0070688_1000713292 | 393 |
| 628 | 3300005455 | Ga0070663_100149775 | Ga0070663_1001497752 | 393 |
| 629 | 3300005456 | Ga0070678_100023144 | Ga0070678_1000231442 | 393 |
| 630 | 3300005617 | Ga0068859_100120900 | Ga0068859_1001209003 | 393 |
| 631 | 3300005719 | Ga0068861_100084991 | Ga0068861_1000849912 | 393 |
| 632 | 3300005840 | Ga0068870_10052727 | Ga0068870_100527272 | 393 |
| 633 | 3300006931 | Ga0097620_100120903 | Ga0097620_1001209033 | 393 |
| 634 | 3300009101 | Ga0105247_10117856 | Ga0105247_101178562 | 393 |
| 635 | 3300009553 | Ga0105249_10069629 | Ga0105249_100696292 | 393 |
| 636 | 3300025893 | Ga0207682_10007635 | Ga0207682_100076353 | 393 |
| 637 | 3300025899 | Ga0207642_10036256 | Ga0207642_100362562 | 393 |
| 638 | 3300025901 | Ga0207688_10122867 | Ga0207688_101228671 | 393 |
| 639 | 3300025904 | Ga0207647_10004440 | Ga0207647_100044405 | 393 |
| 640 | 3300025907 | Ga0207645_10110563 | Ga0207645_101105632 | 393 |
| 641 | 3300025908 | Ga0207643_10066407 | Ga0207643_100664072 | 393 |
| 642 | 3300025921 | Ga0207652_10037774 | Ga0207652_100377742 | 393 |
| 643 | 3300025923 | Ga0207681_10073627 | Ga0207681_100736272 | 393 |
| 644 | 3300025926 | Ga0207659_10102976 | Ga0207659_101029762 | 393 |
| 645 | 3300025937 | Ga0207669_10037663 | Ga0207669_100376632 | 393 |
| 646 | 3300025940 | Ga0207691_10001523 | Ga0207691_1000152320 | 393 |
| 647 | 3300025941 | Ga0207711_10122930 | Ga0207711_101229302 | 393 |
| 648 | 3300025949 | Ga0207667_10145706 | Ga0207667_101457062 | 393 |
| 649 | 3300025972 | Ga0207668_10091542 | Ga0207668_100915422 | 393 |
| 650 | 3300026041 | Ga0207639_10110356 | Ga0207639_101103562 | 393 |
| 651 | 3300026089 | Ga0207648_10066827 | Ga0207648_100668273 | 393 |
| 652 | 3300026118 | Ga0207675_100108470 | Ga0207675_1001084702 | 393 |
| 653 | 3300026121 | Ga0207683_10064101 | Ga0207683_100641012 | 393 |
| 654 | 3300042436 | Ga0439435_0001816 | Ga0439435_0001816_787_2076 | 393 |
| 655 | 3300046455 | Ga0495603_0025772 | Ga0495603_0025772_1644_2975 | 393 |
| 656 | 3300046491 | Ga0495584_0033438 | Ga0495584_0033438_1131_2462 | 393 |
| 657 | 3300048090 | Ga0495615_0000769 | Ga0495615_0000769_2562_3851 | 393 |
| 658 | 3300049823 | Ga0501044_0208080 | Ga0501044_0208080_237_1637 | 393 |
| 659 | iso_pu_bacteria | 2791355199 | 2793078988 | 393 |
| 660 | iso_pu_bacteria | 2879110137 | 2879116219 | 393 |
| 661 | iso_pu_bacteria | 2941507105 | 2941514568 | 393 |
| 662 | iso_pu_bacteria | 2941523033 | 2941530428 | 393 |
| 663 | 3300044712 | Ga0453684_0009091 | Ga0453684_0009091_4143_5336 | 396 |
| 664 | iso_pu_bacteria | 2512047086 | 2512529682 | 396 |
| 665 | iso_pu_bacteria | 2512875026 | 2512970072 | 396 |
| 666 | iso_pu_bacteria | 2513237089 | 2513602675 | 396 |
| 667 | iso_pu_bacteria | 2513237156 | 2513987045 | 396 |
| 668 | iso_pu_bacteria | 2513237160 | 2514005568 | 396 |
| 669 | iso_pu_bacteria | 2582581316 | 2585333197 | 396 |
| 670 | iso_pu_bacteria | 2643221618 | 2644105833 | 396 |
| 671 | iso_pu_bacteria | 2643221655 | 2644310445 | 396 |
| 672 | iso_pu_bacteria | 2643221659 | 2644334770 | 396 |
| 673 | iso_pu_bacteria | 2643221698 | 2644545036 | 396 |
| 674 | iso_pu_bacteria | 2643221712 | 2644612547 | 396 |
| 675 | iso_pu_bacteria | 2802428858 | 2802716495 | 396 |
| 676 | iso_pu_bacteria | 2802428859 | 2802722466 | 396 |
| 677 | iso_pu_bacteria | 2802428860 | 2802734246 | 396 |
| 678 | iso_pu_bacteria | 2802428861 | 2802735785 | 396 |
| 679 | iso_pu_bacteria | 2802428862 | 2802741642 | 396 |
| 680 | iso_pu_bacteria | 2842482326 | 2842486503 | 396 |
| 681 | iso_pu_bacteria | 2844163670 | 2844165527 | 396 |
| 682 | iso_pu_bacteria | 2915980308 | 2915983516 | 396 |
| 683 | iso_pu_bacteria | 2916061851 | 2916064646 | 396 |
| 684 | iso_pu_bacteria | 2937029754 | 2937032728 | 396 |
| 685 | iso_pu_bacteria | 2937036028 | 2937041024 | 396 |
| 686 | iso_pu_bacteria | 2937078374 | 2937082166 | 396 |
| 687 | iso_pu_bacteria | 2937084907 | 2937090263 | 396 |
| 688 | iso_pu_bacteria | 2941499720 | 2941506094 | 396 |
| 689 | iso_pu_bacteria | 2957375807 | 2957378746 | 396 |
| 690 | iso_pu_bacteria | 2957437181 | 2957438567 | 396 |
| 691 | iso_pu_bacteria | 2960591022 | 2960594846 | 396 |
| 692 | iso_pu_bacteria | 2960631154 | 2960631220 | 396 |
| 693 | iso_pu_bacteria | 2960680706 | 2960682959 | 396 |
| 694 | iso_pu_bacteria | 2960693952 | 2960699514 | 396 |
| 695 | iso_pu_bacteria | 2967686174 | 2967688714 | 396 |
| 696 | iso_pu_bacteria | 2967728569 | 2967731299 | 396 |
| 697 | iso_pu_bacteria | 2970122695 | 2970125446 | 396 |
| 698 | iso_pu_bacteria | 2970143518 | 2970146683 | 396 |
| 699 | iso_pu_bacteria | 2977530762 | 2977534016 | 396 |
| 700 | iso_pu_bacteria | 2977544691 | 2977546753 | 396 |
| 701 | iso_pu_bacteria | 8003999396 | 8004005001 | 396 |
| 702 | iso_pu_bacteria | 2946033335 | 2946036660 | 398 |
| 703 | iso_pu_bacteria | 2643221637 | 2644207556 | 399 |
| 704 | iso_pu_bacteria | 2643221718 | 2644651305 | 399 |
| 705 | iso_pu_bacteria | 2643221723 | 2644671967 | 399 |
| 706 | 3300003214 | JGI25165J46597_1002291 | JGI25165J46597_10022917 | 400 |
| 707 | 3300006946 | Ga0079104_1005194 | Ga0079104_10051943 | 400 |
| 708 | 3300022739 | Ga0228711_1000009 | Ga0228711_1000009104 | 400 |
| 709 | 3300022740 | Ga0228710_1000011 | Ga0228710_1000011102 | 400 |
| 710 | 3300025233 | Ga0209437_100042 | Ga0209437_10004244 | 400 |
| 711 | 3300025261 | Ga0209233_1000103 | Ga0209233_100010344 | 400 |
| 712 | 3300027111 | Ga0209281_1000132 | Ga0209281_100013271 | 400 |
| 713 | 3300027666 | Ga0209282_1000018 | Ga0209282_100001871 | 400 |
| 714 | 3300031967 | Ga0315914_1000332 | Ga0315914_100033229 | 400 |
| 715 | 3300033430 | Ga0315913_1000072 | Ga0315913_100007230 | 400 |
| 716 | 3300033464 | Ga0315915_1000006 | Ga0315915_1000006232 | 400 |
| 717 | 3300037471 | Ga0395905_0003994 | Ga0395905_0003994_462_1664 | 400 |
| 718 | 3300002739 | JGI25158J39367_1003467 | JGI25158J39367_10034672 | 403 |
| 719 | 3300002987 | JGI25159J45721_1000049 | JGI25159J45721_100004940 | 403 |
| 720 | 3300003354 | JGI25160J50197_1000147 | JGI25160J50197_100014723 | 403 |
| 721 | 3300003374 | JGI25161J50226_1000592 | JGI25161J50226_10005927 | 403 |
| 722 | 3300003781 | Ga0055536_1000741 | Ga0055536_100074115 | 403 |
| 723 | 3300003794 | Ga0055531_10001435 | Ga0055531_100014357 | 403 |
| 724 | 3300004625 | Ga0055543_1000129 | Ga0055543_100012942 | 403 |
| 725 | 3300005262 | Ga0065165_1000477 | Ga0065165_100047723 | 403 |
| 726 | 3300025284 | Ga0209130_1000234 | Ga0209130_100023439 | 403 |
| 727 | 3300025294 | Ga0209025_1000337 | Ga0209025_100033745 | 403 |
| 728 | 3300025295 | Ga0209564_1000117 | Ga0209564_100011787 | 403 |
| 729 | 3300025298 | Ga0209050_1003742 | Ga0209050_10037427 | 403 |
| 730 | 3300025299 | Ga0209256_1000352 | Ga0209256_100035245 | 403 |
| 731 | 3300025302 | Ga0207426_1000410 | Ga0207426_100041039 | 403 |
| 732 | 3300025303 | Ga0209051_1010989 | Ga0209051_10109893 | 403 |
| 733 | 3300025304 | Ga0209257_1001129 | Ga0209257_100112920 | 403 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4l0o-assembly3.cif.gz_G-3 | structure determination of cystathionine gamma-synthase from helicobacter pylori | 0.968 | 9 | 397 |
| 4l0o-assembly2.cif.gz_E | structure determination of cystathionine gamma-synthase from helicobacter pylori | 0.9671 | 9 | 397 |
| 3acz-assembly1.cif.gz_B | crystal structure of entamoeba histolytica methionine gamma-lyase 1 | 0.9645 | 8 | 396 |
| 5e4z-assembly1.cif.gz_A | crystal structure of methionine gamma-lyase from citrobacter freundii with c115a substitution | 0.9635 | 7 | 399 |
| 3qi6-assembly1.cif.gz_C | crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 | 0.9634 | 9 | 396 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1n8pD02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9695 | 267 | 399 | 3.90.1150.10 |
| 3ndnB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9688 | 266 | 396 | 3.90.1150.10 |
| af_O13326_295_429_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9636 | 268 | 398 | 3.90.1150.10 |
| af_Q4DUG8_270_407_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9621 | 266 | 397 | 3.90.1150.10 |
| 2nmpB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9616 | 267 | 400 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3U932-F1-model_v4 | Bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (EC 2.5.1.49) | 0.9832 | 64 | 155 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A544VQ81-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9822 | 70 | 206 |
GO:0003962
GO:0004123 GO:0005737 GO:0008483 GO:0009086 GO:0019343 GO:0019346 GO:0030170 |
| AF-A0A848VQE9-F1-model_v4 | O-succinylhomoserine sulfhydrylase | 0.979 | 247 | 399 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A7V2W9G7-F1-model_v4 | O-succinylhomoserine sulfhydrylase | 0.979 | 250 | 396 |
GO:0005737
GO:0016846 GO:0019346 GO:0030170 |
| AF-R8BUP8-F1-model_v4 | Putative homocysteine synthase protein | 0.9788 | 55 | 399 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar