F478080

General Info

Members Datasets Scaffolds Average Seq Length
733 474 609 419

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10000166|Ga0105237_1000016633
Length 466
Sequence MRIGSQGLLNLRPEAQILSFVRTIRRKAPADSFARGIFARGQLMKLESIALHHGYSSEPTTHAAAVPIYQTTSYTFDNTQHGADLFNLAVPGNIYTRIMNPTTAVLEQRVAEMEGGIAGLCVASGMAAITYSIQAIAGVGDNIVSISQLYGGTYNLFMHSFPRQGIEVRMADQGDFDAIEKLIDDKTKAVFCESIGNPAGNVVDIQRLAEIAHRHGVPVIVDNTVATPYLCKPIKFGADIVVHALTKYIGGHGNSIGGIIVDSGKFDWVKNKERFKVLNEPDPSYHGVVYTEALGPAAYIGRCRVVPLRNTGAALSPHNAFLFLMGLETLGLRMERHCDNAEKLARFLKNHPKVAWVNYAELPDSKYNAVAKKITKGKASGIVSFGIKGGAEAGGRFIDGLNMILRLVNIGDAKSLACHPASTTHRQLGPDELAKAGVSADLVRISVGIEHIDDIIADVEQALAAA

Samples

Sample ID Description Type Environment
1 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
2 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
3 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
6 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2547132512 Azospira oryzae 6a3 Isolate Unclassified
9 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
10 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
11 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
12 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
13 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
14 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
15 2643221569 Achromobacter sp. Root565 Isolate Unclassified
16 2643221580 Devosia sp. Root635 Isolate Unclassified
17 2643221591 Devosia sp. Root685 Isolate Unclassified
18 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
19 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
20 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
21 2643221618 Ensifer sp. Root231 Isolate Unclassified
22 2643221629 Devosia sp. Root105 Isolate Unclassified
23 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
24 2643221655 Ensifer sp. Root1252 Isolate Unclassified
25 2643221659 Ensifer sp. Root127 Isolate Unclassified
26 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
27 2643221662 Devosia sp. Root413D1 Isolate Unclassified
28 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
29 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
30 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
31 2643221698 Ensifer sp. Root142 Isolate Unclassified
32 2643221712 Ensifer sp. Root258 Isolate Unclassified
33 2643221718 Rhizobium sp. Root268 Isolate Unclassified
34 2643221723 Ensifer sp. Root278 Isolate Unclassified
35 2721755523 Delftia sp. HK171 Isolate Unclassified
36 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
37 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
38 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
39 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
40 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
41 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
42 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
43 2791355199
44 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
45 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
46 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
47 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
48 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
49 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
50 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
51 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
52 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
53 2844163670 Ensifer sp. 1H6 Isolate Unclassified
54 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
55 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
56 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
57 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
58 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
59 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
60 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
61 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
62 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
63 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
64 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
65 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
66 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
67 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
68 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
69 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
70 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
71 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
72 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
73 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
74 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
75 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
76 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
77 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
78 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
79 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
80 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
81 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
82 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
83 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
84 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
85 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
86 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
87 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
88 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
89 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
90 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
91 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
92 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
93 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
94 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
95 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
96 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
97 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
98 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
99 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
100 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
101 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
102 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
103 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
104 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
105 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
106 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
107 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
108 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
109 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
110 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
111 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
112 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
113 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
114 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
115 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
116 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
117 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
118 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
119 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
120 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
121 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
122 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
123 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
124 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
125 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
126 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
127 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
128 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
129 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
130 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
131 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
132 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
133 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
134 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
135 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
136 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
137 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
138 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
139 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
140 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
141 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
142 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
143 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
144 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
145 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
146 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
147 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
148 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
149 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
150 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
151 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
152 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
153 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
154 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
155 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
156 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
157 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
158 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
159 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
160 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
161 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
162 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
163 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
164 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
165 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
166 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
167 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
168 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
169 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
170 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
171 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
172 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
173 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
174 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
175 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
176 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
177 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
178 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
179 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
180 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
181 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
182 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
183 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
184 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
185 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
186 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
187 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
188 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
189 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
190 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
191 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
192 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
193 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
194 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
195 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
196 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
197 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
198 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
199 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
200 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
201 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
202 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
203 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
204 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
205 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
206 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
207 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
208 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
209 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
210 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
211 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
212 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
213 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
214 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
215 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
216 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
217 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
218 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
219 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
221 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
223 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
225 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
226 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
282 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
284 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
286 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
288 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
289 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
290 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
291 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
292 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
293 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
294 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
295 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
296 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
297 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
298 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
299 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
300 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
301 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
302 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
303 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
310 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
311 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
312 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
313 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
315 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
316 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
318 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
319 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
320 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
321 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
322 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
323 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
324 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
325 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
326 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
327 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
328 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
329 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
330 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
331 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
332 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
333 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
334 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
337 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
338 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
339 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
340 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
341 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
342 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
343 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
344 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
345 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
346 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
347 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
348 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
349 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
350 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
351 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
352 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
353 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
354 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
355 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
356 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
357 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
358 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
359 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
360 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
361 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
362 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
363 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
364 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
365 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
366 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
367 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
368 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
369 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
370 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
371 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
372 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
373 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
374 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
375 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
376 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
377 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
378 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
379 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
380 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
381 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
382 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
383 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
387 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
388 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
389 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
390 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
391 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
392 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
393 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
394 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
395 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
396 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
397 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
398 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
399 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
400 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
401 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
402 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
403 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
404 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
405 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
408 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
413 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
418 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
419 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
420 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
421 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
422 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
423 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
424 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
425 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
427 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
436 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
437 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
438 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
439 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
440 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
441 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
442 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
443 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
444 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
449 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
450 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
451 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
452 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
453 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
454 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
455 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
456 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
457 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
458 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
459 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
460 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
461 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
462 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
463 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
464 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
465 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
466 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
467 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
468 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
469 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
470 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
471 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
472 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
473 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
474 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.51
Metatranscriptomes 0.68
Isolates 16.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 5.18
Nodule 6.28
Rhizoplane 2.18
Rhizosphere 69.03
Stem 0
Stem Tuber 0.68
Unclassified 16.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1003467 3300002739 Bacteria 2435
2 JGI25159J45721_1000049 3300002987 Bacteria 58138
3 JGI25165J46597_1002291 3300003214 Bacteria 6536
4 JGI25153J46596_10034954 3300003215 Bacteria 1635
5 rootH1_10010008 3300003323 Bacteria 19315
6 JGI25160J50197_1000147 3300003354 Bacteria 62036
7 JGI25161J50226_1000592 3300003374 Bacteria 15259
8 Ga0055536_1000741 3300003781 Bacteria 21863
9 Ga0055536_1004214 3300003781 Bacteria 7426
10 Ga0055531_10001435 3300003794 Bacteria 17594
11 Ga0058692_1000007 3300003856 Bacteria 366313
12 Ga0055543_1000129 3300004625 Bacteria 62841
13 Ga0065165_1000477 3300005262 Bacteria 62229
14 Ga0065703_1000113 3300005272 Bacteria 60359
15 Ga0065714_10067024 3300005288 Bacteria 5984
16 Ga0065704_10010619 3300005289 Bacteria 1787
17 Ga0065704_10021508 3300005289 Bacteria 1467
18 Ga0065712_10103577 3300005290 Bacteria 1982
19 Ga0070658_10116729 3300005327 Bacteria 2215
20 Ga0070683_100091994 3300005329 Bacteria 2849
21 Ga0070670_100027424 3300005331 Bacteria 4899
22 Ga0070670_100136274 3300005331 Bacteria 2121
23 Ga0070660_100042021 3300005339 Bacteria 3487
24 Ga0070689_100051454 3300005340 Bacteria 3184
25 Ga0070668_100007902 3300005347 Bacteria 7898
26 Ga0070669_100001257 3300005353 Bacteria 18401
27 Ga0070669_100094168 3300005353 Bacteria 2251
28 Ga0070669_100181506 3300005353 Bacteria 1647
29 Ga0070671_100008880 3300005355 Bacteria 8064
30 Ga0070671_100018621 3300005355 Bacteria 5641
31 Ga0070671_100056945 3300005355 Bacteria 3252
32 Ga0070688_100004753 3300005365 Bacteria 7096
33 Ga0070688_100071329 3300005365 Bacteria 2223
34 Ga0070659_100021415 3300005366 Bacteria 4923
35 Ga0070714_100000078 3300005435 Bacteria 82928
36 Ga0070714_100049291 3300005435 Bacteria 3585
37 Ga0070713_100000415 3300005436 Bacteria 27253
38 Ga0070700_100096697 3300005441 Bacteria 1938
39 Ga0070708_100057538 3300005445 Bacteria 3462
40 Ga0070708_100151326 3300005445 Bacteria 2158
41 Ga0070663_100017645 3300005455 Bacteria 4662
42 Ga0070663_100149775 3300005455 Bacteria 1788
43 Ga0070678_100023144 3300005456 Bacteria 4134
44 Ga0070662_100192448 3300005457 Bacteria 1614
45 Ga0068867_100042617 3300005459 Bacteria 3321
46 Ga0070706_100238815 3300005467 Bacteria 1697
47 Ga0070707_100321174 3300005468 Bacteria 1504
48 Ga0070698_100211385 3300005471 Bacteria 1874
49 Ga0070679_100186156 3300005530 Bacteria 2047
50 Ga0070684_100032832 3300005535 Bacteria 4429
51 Ga0070672_100126396 3300005543 Bacteria 2097
52 Ga0070695_100008648 3300005545 Bacteria 6048
53 Ga0070696_100012071 3300005546 Bacteria 5788
54 Ga0070696_100071257 3300005546 Bacteria 2445
55 Ga0070665_100000775 3300005548 Bacteria 41987
56 Ga0070665_100029742 3300005548 Bacteria 5497
57 Ga0070665_100225212 3300005548 Bacteria 1875
58 Ga0068855_100025809 3300005563 Bacteria 7026
59 Ga0068855_100243603 3300005563 Bacteria 2008
60 Ga0068857_100053747 3300005577 Unclassified 3573
61 Ga0068856_100019551 3300005614 Bacteria 6575
62 Ga0068856_100034788 3300005614 Bacteria 4935
63 Ga0068856_100316975 3300005614 Bacteria 1577
64 Ga0068852_100044457 3300005616 Bacteria 3772
65 Ga0068859_100120900 3300005617 Bacteria 2685
66 Ga0068864_100005182 3300005618 Bacteria 10673
67 Ga0068861_100000713 3300005719 Bacteria 19839
68 Ga0068861_100084991 3300005719 Bacteria 2485
69 Ga0068870_10052727 3300005840 Bacteria 2158
70 Ga0068858_100050063 3300005842 Bacteria 3867
71 Ga0081455_10002227 3300005937 Bacteria 23085
72 Ga0070717_10007752 3300006028 Bacteria 7986
73 Ga0075368_10006645 3300006042 Bacteria 4055
74 Ga0070712_100006225 3300006175 Bacteria 7388
75 Ga0075362_10016988 3300006177 Bacteria 2991
76 Ga0075366_10009674 3300006195 Bacteria 5387
77 Ga0068871_100156000 3300006358 Bacteria 1949
78 Ga0075431_100070172 3300006847 Bacteria 3615
79 Ga0075433_10117913 3300006852 Bacteria 2356
80 Ga0075434_100121544 3300006871 Bacteria 2627
81 Ga0075429_100195890 3300006880 Bacteria 1770
82 Ga0068865_100003899 3300006881 Bacteria 8949
83 Ga0068865_100068733 3300006881 Bacteria 2505
84 Ga0097620_100120903 3300006931 Bacteria 2685
85 Ga0079104_1000025 3300006946 Bacteria 218785
86 Ga0079104_1005194 3300006946 Bacteria 5277
87 Ga0105251_10005783 3300009011 Bacteria 8019
88 Ga0105244_10010793 3300009036 Bacteria 5516
89 Ga0105244_10018416 3300009036 Bacteria 3918
90 Ga0105244_10024684 3300009036 Bacteria 3278
91 Ga0105244_10052226 3300009036 Bacteria 2081
92 Ga0105244_10066657 3300009036 Bacteria 1802
93 Ga0105250_10004830 3300009092 Bacteria 6133
94 Ga0105240_10003726 3300009093 Bacteria 23550
95 Ga0105240_10004512 3300009093 Bacteria 21161
96 Ga0111539_10294156 3300009094 Bacteria 1890
97 Ga0105247_10001174 3300009101 Bacteria 19467
98 Ga0105247_10022894 3300009101 Bacteria 3762
99 Ga0105247_10117856 3300009101 Bacteria 1717
100 Ga0114129_10002871 3300009147 Bacteria 24116
101 Ga0114129_10006545 3300009147 Bacteria 16531
102 Ga0114129_10076521 3300009147 Bacteria 4659
103 Ga0114129_10162572 3300009147 Bacteria 3048
104 Ga0114129_10417583 3300009147 Bacteria 1765
105 Ga0105243_10000052 3300009148 Bacteria 138341
106 Ga0105243_10002241 3300009148 Bacteria 16253
107 Ga0105243_10167058 3300009148 Bacteria 1902
108 Ga0105241_10011730 3300009174 Bacteria 6434
109 Ga0105242_10002974 3300009176 Bacteria 13265
110 Ga0105248_10005809 3300009177 Bacteria 13565
111 Ga0105248_10108953 3300009177 Bacteria 3123
112 Ga0105237_10000166 3300009545 Bacteria 93389
113 Ga0105237_10009505 3300009545 Bacteria 10409
114 Ga0105238_10025536 3300009551 Bacteria 6023
115 Ga0105238_10092019 3300009551 Bacteria 3020
116 Ga0105249_10001245 3300009553 Bacteria 22348
117 Ga0105249_10004532 3300009553 Bacteria 12011
118 Ga0105249_10045631 3300009553 Bacteria 3987
119 Ga0105249_10069629 3300009553 Bacteria 3247
120 Ga0105239_10001740 3300010375 Bacteria 28711
121 Ga0105246_10004633 3300011119 Bacteria 8366
122 Ga0157373_10022866 3300013100 Bacteria 4534
123 Ga0157373_10045228 3300013100 Bacteria 3143
124 Ga0157370_10023150 3300013104 Bacteria 6174
125 Ga0157370_10270193 3300013104 Bacteria 1571
126 Ga0157378_10005272 3300013297 Bacteria 11353
127 Ga0163162_10325356 3300013306 Bacteria 1670
128 Ga0157372_10220781 3300013307 Bacteria 2197
129 Ga0157375_10119476 3300013308 Bacteria 2743
130 Ga0163163_10029608 3300014325 Bacteria 5269
131 Ga0163163_10116161 3300014325 Bacteria 2707
132 Ga0163163_10127978 3300014325 Bacteria 2578
133 Ga0163163_10199018 3300014325 Bacteria 2052
134 Ga0182008_10015110 3300014497 Bacteria 4035
135 Ga0182008_10072653 3300014497 Bacteria 1693
136 Ga0157379_10123883 3300014968 Bacteria 2325
137 Ga0157379_10161028 3300014968 Bacteria 2025
138 Ga0157376_10022301 3300014969 Bacteria 4933
139 Ga0163161_10014000 3300017792 Bacteria 5585
140 Ga0163161_10023009 3300017792 Bacteria 4391
141 Ga0163161_10190193 3300017792 Bacteria 1578
142 Ga0197907_10402444 3300020069 Eukaryota 1495
143 Ga0213872_10000439 3300021361 Bacteria 34128
144 Ga0213874_10011758 3300021377 Bacteria 2227
145 Ga0213875_10005448 3300021388 Bacteria 6830
146 Ga0213875_10014710 3300021388 Bacteria 3815
147 Ga0213875_10029488 3300021388 Bacteria 2602
148 Ga0228711_1000009 3300022739 Bacteria 164684
149 Ga0228710_1000011 3300022740 Bacteria 154551
150 Ga0224572_1007930 3300024225 Bacteria 1956
151 Ga0207427_103980 3300025231 Bacteria 2705
152 Ga0209437_100042 3300025233 Bacteria 444095
153 Ga0207425_1000397 3300025245 Bacteria 29297
154 Ga0209233_1000103 3300025261 Bacteria 284123
155 Ga0209233_1000671 3300025261 Bacteria 16483
156 Ga0209130_1000234 3300025284 Bacteria 71914
157 Ga0209676_1000037 3300025292 Bacteria 457562
158 Ga0209025_1000337 3300025294 Bacteria 103480
159 Ga0209564_1000117 3300025295 Bacteria 207096
160 Ga0209758_1000895 3300025297 Bacteria 40555
161 Ga0209050_1003742 3300025298 Bacteria 10915
162 Ga0209256_1000352 3300025299 Bacteria 74849
163 Ga0207426_1000410 3300025302 Bacteria 71914
164 Ga0209051_1010989 3300025303 Bacteria 4514
165 Ga0209257_1001129 3300025304 Bacteria 34298
166 Ga0207697_10006065 3300025315 Bacteria 5524
167 Ga0207655_1000618 3300025728 Bacteria 42704
168 Ga0207655_1000728 3300025728 Bacteria 37197
169 Ga0207655_1001345 3300025728 Bacteria 23091
170 Ga0207655_1002977 3300025728 Bacteria 13003
171 Ga0207655_1014647 3300025728 Bacteria 4415
172 Ga0207713_1011192 3300025735 Bacteria 4904
173 Ga0207682_10007635 3300025893 Bacteria 4304
174 Ga0207642_10036256 3300025899 Bacteria 2115
175 Ga0207710_10000018 3300025900 Bacteria 346727
176 Ga0207688_10122867 3300025901 Bacteria 1516
177 Ga0207647_10004440 3300025904 Bacteria 10398
178 Ga0207647_10092512 3300025904 Bacteria 1803
179 Ga0207645_10110563 3300025907 Bacteria 1779
180 Ga0207643_10066407 3300025908 Bacteria 2068
181 Ga0207705_10003576 3300025909 Bacteria 11839
182 Ga0207705_10025894 3300025909 Bacteria 4186
183 Ga0207684_10123273 3300025910 Bacteria 2223
184 Ga0207684_10225722 3300025910 Bacteria 1616
185 Ga0207654_10015252 3300025911 Bacteria 3984
186 Ga0207695_10012680 3300025913 Bacteria 10095
187 Ga0207671_10000344 3300025914 Bacteria 68132
188 Ga0207663_10048982 3300025916 Bacteria 2618
189 Ga0207657_10009690 3300025919 Bacteria 9663
190 Ga0207657_10031412 3300025919 Bacteria 4811
191 Ga0207652_10037774 3300025921 Bacteria 4089
192 Ga0207646_10225627 3300025922 Bacteria 1692
193 Ga0207681_10000529 3300025923 Bacteria 26378
194 Ga0207681_10073627 3300025923 Bacteria 2390
195 Ga0207650_10016512 3300025925 Bacteria 5163
196 Ga0207659_10102976 3300025926 Bacteria 2156
197 Ga0207687_10034830 3300025927 Bacteria 3422
198 Ga0207700_10000115 3300025928 Bacteria 47748
199 Ga0207700_10252300 3300025928 Bacteria 1508
200 Ga0207664_10000043 3300025929 Bacteria 149967
201 Ga0207644_10003286 3300025931 Bacteria 10449
202 Ga0207690_10024458 3300025932 Bacteria 3783
203 Ga0207690_10041588 3300025932 Bacteria 3013
204 Ga0207706_10009893 3300025933 Bacteria 8745
205 Ga0207706_10047508 3300025933 Bacteria 3797
206 Ga0207706_10058895 3300025933 Bacteria 3383
207 Ga0207709_10000016 3300025935 Bacteria 478406
208 Ga0207709_10000159 3300025935 Bacteria 91803
209 Ga0207709_10000740 3300025935 Bacteria 25909
210 Ga0207670_10142855 3300025936 Bacteria 1767
211 Ga0207669_10037663 3300025937 Bacteria 2777
212 Ga0207704_10003562 3300025938 Bacteria 7072
213 Ga0207691_10001523 3300025940 Bacteria 23057
214 Ga0207691_10056953 3300025940 Bacteria 3559
215 Ga0207711_10122930 3300025941 Bacteria 2319
216 Ga0207661_10043720 3300025944 Bacteria 3537
217 Ga0207661_10158501 3300025944 Bacteria 1962
218 Ga0207679_10048082 3300025945 Bacteria 3103
219 Ga0207667_10020974 3300025949 Bacteria 7246
220 Ga0207667_10145706 3300025949 Bacteria 2438
221 Ga0207667_10188937 3300025949 Bacteria 2114
222 Ga0207651_10029993 3300025960 Bacteria 3456
223 Ga0207651_10102889 3300025960 Bacteria 2124
224 Ga0207712_10002358 3300025961 Bacteria 12238
225 Ga0207668_10017184 3300025972 Bacteria 4528
226 Ga0207668_10091542 3300025972 Bacteria 2236
227 Ga0207640_10028238 3300025981 Bacteria 3428
228 Ga0207658_10174784 3300025986 Bacteria 1773
229 Ga0207703_10044617 3300026035 Bacteria 3564
230 Ga0207639_10110356 3300026041 Bacteria 2240
231 Ga0207678_10007777 3300026067 Bacteria 9469
232 Ga0207702_10008462 3300026078 Bacteria 8676
233 Ga0207702_10222019 3300026078 Bacteria 1761
234 Ga0207641_10032432 3300026088 Bacteria 4337
235 Ga0207648_10066827 3300026089 Bacteria 3135
236 Ga0207648_10094077 3300026089 Bacteria 2620
237 Ga0207648_10118790 3300026089 Bacteria 2324
238 Ga0207648_10260180 3300026089 Bacteria 1548
239 Ga0207676_10176755 3300026095 Bacteria 1865
240 Ga0207674_10024473 3300026116 Bacteria 6453
241 Ga0207674_10041247 3300026116 Bacteria 4775
242 Ga0207674_10125108 3300026116 Bacteria 2537
243 Ga0207675_100001418 3300026118 Bacteria 24014
244 Ga0207675_100108470 3300026118 Bacteria 2618
245 Ga0207683_10008000 3300026121 Bacteria 9044
246 Ga0207683_10064101 3300026121 Bacteria 3238
247 Ga0207698_10011496 3300026142 Bacteria 5742
248 Ga0209281_1000007 3300027111 Bacteria 938265
249 Ga0209281_1000132 3300027111 Bacteria 188464
250 Ga0209371_1000024 3300027312 Bacteria 477286
251 Ga0209282_1000018 3300027666 Bacteria 188472
252 Ga0209974_10038284 3300027876 Bacteria 1593
253 Ga0207428_10104598 3300027907 Bacteria 2184
254 Ga0268266_10000167 3300028379 Bacteria 120012
255 Ga0268266_10093792 3300028379 Bacteria 2634
256 Ga0265322_10004158 3300028654 Bacteria 4329
257 Ga0265338_10005109 3300028800 Bacteria 17299
258 Ga0265338_10014863 3300028800 Bacteria 8611
259 Ga0268256_1000026 3300030500 Bacteria 477260
260 Ga0265332_10000021 3300031238 Bacteria 217090
261 Ga0265320_10053549 3300031240 Bacteria 1950
262 Ga0265325_10012739 3300031241 Bacteria 4799
263 Ga0265339_10000128 3300031249 Bacteria 62891
264 Ga0265339_10001796 3300031249 Bacteria 15766
265 Ga0265327_10000270 3300031251 Bacteria 102617
266 Ga0265327_10080705 3300031251 Bacteria 1608
267 Ga0265316_10056814 3300031344 Bacteria 3054
268 Ga0265313_10000246 3300031595 Bacteria 58903
269 Ga0316575_10006080 3300031665 Bacteria 4327
270 Ga0316579_10017893 3300031691 Bacteria 3114
271 Ga0265342_10083993 3300031712 Bacteria 1835
272 Ga0265342_10101813 3300031712 Bacteria 1635
273 Ga0316576_10003878 3300031727 Bacteria 8856
274 Ga0316576_10012947 3300031727 Bacteria 5523
275 Ga0316576_10044936 3300031727 Bacteria 3192
276 Ga0316576_10049679 3300031727 Bacteria 3047
277 Ga0316576_10064800 3300031727 Bacteria 2684
278 Ga0316576_10097988 3300031727 Bacteria 2189
279 Ga0316576_10108845 3300031727 Bacteria 2076
280 Ga0316576_10111539 3300031727 Bacteria 2050
281 Ga0316576_10120411 3300031727 Bacteria 1970
282 Ga0316578_10041198 3300031728 Bacteria 2674
283 Ga0316578_10050663 3300031728 Bacteria 2430
284 Ga0307405_10030034 3300031731 Bacteria 3183
285 Ga0316577_10049859 3300031733 Bacteria 2336
286 Ga0316577_10073580 3300031733 Bacteria 1908
287 Ga0307413_10040290 3300031824 Bacteria 2725
288 Ga0307406_10056494 3300031901 Bacteria 2514
289 Ga0307412_10008741 3300031911 Bacteria 5795
290 Ga0315914_1000332 3300031967 Bacteria 54587
291 Ga0307416_100117152 3300032002 Bacteria 2364
292 Ga0307414_10085841 3300032004 Bacteria 2320
293 Ga0307411_10156481 3300032005 Bacteria 1701
294 Ga0316583_10008253 3300032133 Bacteria 3754
295 Ga0316580_10009353 3300032139 Bacteria 2943
296 Ga0316580_10012702 3300032139 Bacteria 2567
297 Ga0316593_10002050 3300032168 Bacteria 4659
298 Ga0316593_10005976 3300032168 Bacteria 3255
299 Ga0316593_10010856 3300032168 Bacteria 2628
300 Ga0316593_10050484 3300032168 Bacteria 1404
301 Ga0315913_1000072 3300033430 Bacteria 54585
302 Ga0315915_1000006 3300033464 Bacteria 330709
303 Ga0373923_0001939 3300035111 Bacteria 6196
304 Ga0373953_0004269 3300035117 Bacteria 4538
305 Ga0373954_0014915 3300035118 Bacteria 3468
306 Ga0373956_0000522 3300035119 Bacteria 15766
307 Ga0373943_0024442 3300035170 Bacteria 2817
308 Ga0373955_0002506 3300035172 Bacteria 8024
309 Ga0373955_0044783 3300035172 Bacteria 2385
310 Ga0316574_0007711 3300035398 Bacteria 5918
311 Ga0316574_0011205 3300035398 Bacteria 5090
312 Ga0316574_0031279 3300035398 Bacteria 3228
313 Ga0316574_0042223 3300035398 Bacteria 2813
314 Ga0316574_0048209 3300035398 Bacteria 2644
315 Ga0316574_0056360 3300035398 Bacteria 2458
316 Ga0373924_0062347 3300035410 Bacteria 1561
317 Ga0373935_0028567 3300035692 Bacteria 3447
318 Ga0373935_0133431 3300035692 Bacteria 1671
319 Ga0373933_0001691 3300035724 Bacteria 12832
320 Ga0373933_0005988 3300035724 Bacteria 6618
321 Ga0373937_0000652 3300036401 Bacteria 30454
322 Ga0373937_0002173 3300036401 Bacteria 16431
323 Ga0316582_0024509 3300036647 Bacteria 3611
324 Ga0316582_0031930 3300036647 Bacteria 3223
325 Ga0316582_0053319 3300036647 Bacteria 2572
326 Ga0316582_0293341 3300036647 Unclassified 1117
327 Ga0316584_0025258 3300036712 Bacteria 4355
328 Ga0316584_0046843 3300036712 Bacteria 3230
329 Ga0316584_0077443 3300036712 Bacteria 2491
330 Ga0316584_0094592 3300036712 Bacteria 2237
331 Ga0316584_0116588 3300036712 Bacteria 1997
332 Ga0395899_0030484 3300037312 Bacteria 4056
333 Ga0395900_0004697 3300037418 Bacteria 14399
334 Ga0395900_0005946 3300037418 Bacteria 12737
335 Ga0395900_0013612 3300037418 Bacteria 8308
336 Ga0395900_0269586 3300037418 Bacteria 1697
337 Ga0395898_0004262 3300037466 Bacteria 15687
338 Ga0395898_0187932 3300037466 Bacteria 1974
339 Ga0395905_0003994 3300037471 Bacteria 15499
340 Ga0395905_0005717 3300037471 Bacteria 12641
341 Ga0316581_0036438 3300037588 Bacteria 1493
342 Ga0316581_0037502 3300037588 Bacteria 1473
343 Ga0436364_0295817 3300037853 Bacteria 3226
344 Ga0436364_0304718 3300037853 Bacteria 4030
345 Ga0395901_0010019 3300038443 Bacteria 9608
346 Ga0395901_0010623 3300038443 Bacteria 9328
347 Ga0395901_0175495 3300038443 Bacteria 2248
348 Ga0400484_36359 3300038725 Bacteria 17061
349 Ga0400484_37737 3300038725 Bacteria 6182
350 Ga0400484_42782 3300038725 Bacteria 22609
351 Ga0400490_09879 3300038726 Bacteria 10037
352 Ga0400490_18457 3300038726 Bacteria 45271
353 Ga0400491_14515 3300038727 Bacteria 1610
354 Ga0400485_02933 3300038735 Bacteria 11147
355 Ga0400488_05672 3300038741 Bacteria 4340
356 Ga0400488_08497 3300038741 Bacteria 4900
357 Ga0400488_22293 3300038741 Bacteria 1884
358 Ga0400488_24757 3300038741 Bacteria 21056
359 Ga0400488_26284 3300038741 Bacteria 7290
360 Ga0400488_27595 3300038741 Bacteria 2719
361 Ga0400488_42681 3300038741 Bacteria 4391
362 Ga0400486_23147 3300038742 Bacteria 54344
363 Ga0400486_23232 3300038742 Bacteria 285561
364 Ga0400483_020538 3300039062 Bacteria 3742
365 Ga0400483_039692 3300039062 Bacteria 19529
366 Ga0400483_063981 3300039062 Bacteria 3302
367 Ga0400483_064632 3300039062 Bacteria 149376
368 Ga0400483_074051 3300039062 Bacteria 1568
369 Ga0400483_101010 3300039062 Bacteria 6660
370 Ga0400483_125974 3300039062 Bacteria 14934
371 Ga0400483_143205 3300039062 Bacteria 10837
372 Ga0400483_164273 3300039062 Bacteria 103284
373 Ga0400483_167010 3300039062 Bacteria 16343
374 Ga0400483_179661 3300039062 Bacteria 10571
375 Ga0400483_185206 3300039062 Bacteria 144624
376 Ga0400483_186846 3300039062 Bacteria 3882
377 Ga0400483_197539 3300039062 Bacteria 7625
378 Ga0400483_207839 3300039062 Bacteria 57162
379 Ga0400483_220742 3300039062 Bacteria 22099
380 Ga0400483_231265 3300039062 Bacteria 8305
381 Ga0400483_277319 3300039062 Bacteria 4884
382 Ga0400483_290131 3300039062 Bacteria 2743
383 Ga0400487_03892 3300039110 Bacteria 22882
384 Ga0400487_18868 3300039110 Bacteria 2101
385 Ga0400487_29167 3300039110 Bacteria 39851
386 Ga0400487_51021 3300039110 Bacteria 9608
387 Ga0400487_52265 3300039110 Bacteria 3072
388 Ga0400487_65585 3300039110 Bacteria 14264
389 Ga0436360_0090178 3300039438 Bacteria 14631
390 Ga0436361_0076543 3300039447 Bacteria 28188
391 Ga0436361_0613971 3300039447 Bacteria 4606
392 Ga0436363_0067581 3300039450 Bacteria 3843
393 Ga0436363_0134585 3300039450 Bacteria 4709
394 Ga0439466_0040906 3300041411 Bacteria 1548
395 Ga0439431_0009022 3300041997 Bacteria 2248
396 Ga0439435_0001816 3300042436 Bacteria 4070
397 Ga0451577_0103437 3300042876 Bacteria 2545
398 Ga0451577_0159596 3300042876 Bacteria 2030
399 Ga0451577_0168729 3300042876 Bacteria 1972
400 Ga0466972_0000315 3300044658 Bacteria 27891
401 Ga0466978_0024534 3300044671 Bacteria 3612
402 Ga0466965_0020796 3300044683 Bacteria 3157
403 Ga0466966_0001794 3300044684 Bacteria 13920
404 Ga0466961_0000077 3300044693 Bacteria 60661
405 Ga0466963_0055792 3300044694 Bacteria 2628
406 Ga0466964_0005530 3300044706 Bacteria 4692
407 Ga0453684_0001440 3300044712 Bacteria 67958
408 Ga0453684_0002255 3300044712 Bacteria 47769
409 Ga0453684_0009091 3300044712 Bacteria 17517
410 Ga0453684_0036100 3300044712 Bacteria 6818
411 Ga0453684_0064134 3300044712 Bacteria 4694
412 Ga0453684_0146745 3300044712 Bacteria 2809
413 Ga0453684_0162974 3300044712 Bacteria 2635
414 Ga0453684_0163469 3300044712 Bacteria 2630
415 Ga0466968_0010797 3300044735 Bacteria 3548
416 Ga0466970_0000966 3300044765 Bacteria 13833
417 Ga0466957_0061271 3300044842 Bacteria 2308
418 Ga0466960_0016794 3300044901 Bacteria 3181
419 Ga0466959_0001159 3300045049 Bacteria 15885
420 Ga0451576_0140892 3300045051 Bacteria 2514
421 Ga0451576_0175407 3300045051 Bacteria 2238
422 Ga0451576_0438949 3300045051 Bacteria 1370
423 Ga0466967_0048599 3300045976 Bacteria 3705
424 Ga0466967_0093011 3300045976 Bacteria 2743
425 Ga0466967_0285963 3300045976 Bacteria 1583
426 Ga0495603_0025772 3300046455 Bacteria 3555
427 Ga0495629_0014875 3300046459 Bacteria 5596
428 Ga0495629_0066848 3300046459 Bacteria 2509
429 Ga0495638_0091762 3300046460 Bacteria 1828
430 Ga0495651_0003203 3300046462 Bacteria 12577
431 Ga0495651_0029997 3300046462 Bacteria 4240
432 Ga0495651_0064149 3300046462 Bacteria 2807
433 Ga0495653_0000031 3300046463 Bacteria 137159
434 Ga0495653_0000247 3300046463 Bacteria 43201
435 Ga0495584_0033438 3300046491 Bacteria 2601
436 Ga0495607_0000104 3300046501 Bacteria 89641
437 Ga0495608_0000942 3300046511 Bacteria 20473
438 Ga0495608_0001598 3300046511 Bacteria 16216
439 Ga0495618_0011990 3300046514 Bacteria 5259
440 Ga0495628_0000527 3300046516 Bacteria 35033
441 Ga0495628_0070766 3300046516 Bacteria 2719
442 Ga0495630_0004023 3300046517 Bacteria 10291
443 Ga0495631_0082946 3300046518 Bacteria 1382
444 Ga0495632_0071423 3300046519 Bacteria 1667
445 Ga0495643_0051393 3300046522 Bacteria 2216
446 Ga0495663_0019195 3300046525 Bacteria 1954
447 Ga0495652_0000395 3300046529 Bacteria 51356
448 Ga0495652_0016596 3300046529 Bacteria 6583
449 Ga0495640_0036586 3300046533 Bacteria 3468
450 Ga0495586_0032096 3300046535 Bacteria 2816
451 Ga0495587_0000509 3300046536 Bacteria 27034
452 Ga0495587_0001461 3300046536 Bacteria 15745
453 Ga0495609_0070729 3300046538 Bacteria 1534
454 Ga0495597_0025469 3300046542 Bacteria 2723
455 Ga0495645_0006037 3300046543 Bacteria 8379
456 Ga0495633_0061937 3300046558 Bacteria 1751
457 Ga0495667_0001372 3300046559 Bacteria 16021
458 Ga0495667_0001555 3300046559 Bacteria 15232
459 Ga0495634_0040385 3300046642 Bacteria 3174
460 Ga0495625_0039367 3300046660 Bacteria 3453
461 Ga0495635_0000284 3300046663 Bacteria 32595
462 Ga0495635_0115932 3300046663 Bacteria 1828
463 Ga0495657_0000225 3300046675 Bacteria 51076
464 Ga0495599_0001089 3300046678 Bacteria 15301
465 Ga0495623_0000801 3300046679 Bacteria 21172
466 Ga0495623_0050660 3300046679 Bacteria 2629
467 Ga0495646_0027461 3300046680 Bacteria 3571
468 Ga0495658_0092776 3300046683 Bacteria 1791
469 Ga0495600_0000921 3300046809 Bacteria 15776
470 Ga0495600_0002498 3300046809 Bacteria 10556
471 Ga0495604_0000672 3300047317 Bacteria 28961
472 Ga0495604_0003153 3300047317 Bacteria 13176
473 Ga0495674_0002252 3300047319 Bacteria 18967
474 Ga0495674_0041662 3300047319 Bacteria 4100
475 Ga0495672_0043491 3300047320 Bacteria 2701
476 Ga0495680_0001790 3300047322 Bacteria 22731
477 Ga0495680_0003513 3300047322 Bacteria 15380
478 Ga0495675_0001009 3300047444 Bacteria 17143
479 Ga0495675_0173689 3300047444 Bacteria 1322
480 Ga0495681_0063988 3300047470 Bacteria 1686
481 Ga0495684_0001023 3300047471 Bacteria 22737
482 Ga0495602_0000550 3300048088 Bacteria 35034
483 Ga0495615_0000769 3300048090 Bacteria 4497
484 Ga0496102_0290586 3300048905 Bacteria 1541
485 Ga0496104_0005667 3300048907 Bacteria 10936
486 Ga0496104_0069237 3300048907 Bacteria 3354
487 Ga0496105_0010905 3300048908 Bacteria 7160
488 Ga0496105_0016562 3300048908 Bacteria 5886
489 Ga0496106_0046286 3300048909 Bacteria 3270
490 Ga0496106_0108103 3300048909 Bacteria 2163
491 Ga0496106_0132650 3300048909 Bacteria 1954
492 Ga0496108_0041541 3300048911 Bacteria 3839
493 Ga0496108_0044700 3300048911 Bacteria 3697
494 Ga0496109_0030700 3300048912 Bacteria 4817
495 Ga0496114_0037128 3300048917 Bacteria 4029
496 Ga0496114_0119924 3300048917 Bacteria 2262
497 Ga0496115_0209340 3300048918 Bacteria 1611
498 Ga0496116_0085145 3300048919 Bacteria 1944
499 Ga0496118_0021235 3300048921 Bacteria 5723
500 Ga0496118_0042628 3300048921 Bacteria 3578
501 Ga0496118_0064365 3300048921 Bacteria 2691
502 Ga0496122_0000014 3300048925 Bacteria 491410
503 Ga0496122_0000228 3300048925 Bacteria 125699
504 Ga0496122_0002661 3300048925 Bacteria 24907
505 Ga0496122_0039697 3300048925 Bacteria 3750
506 Ga0496123_0044367 3300048926 Bacteria 3041
507 Ga0496124_0056712 3300048927 Bacteria 3303
508 Ga0496124_0058619 3300048927 Bacteria 3237
509 Ga0496125_0000053 3300048928 Bacteria 279909
510 Ga0496125_0001009 3300048928 Bacteria 43801
511 Ga0496125_0045652 3300048928 Bacteria 3684
512 Ga0496125_0084699 3300048928 Bacteria 2406
513 Ga0496125_0091616 3300048928 Bacteria 2277
514 Ga0496126_0000019 3300048929 Bacteria 564723
515 Ga0496126_0000290 3300048929 Bacteria 106499
516 Ga0496126_0006527 3300048929 Bacteria 12985
517 Ga0496126_0055443 3300048929 Bacteria 3586
518 Ga0496126_0099427 3300048929 Bacteria 2548
519 Ga0496126_0112321 3300048929 Bacteria 2372
520 Ga0495682_0042307 3300049460 Bacteria 1669
521 Ga0501031_0029036 3300049568 Bacteria 3606
522 Ga0501031_0030909 3300049568 Bacteria 3493
523 Ga0501032_0006016 3300049569 Bacteria 8949
524 Ga0501032_0044301 3300049569 Bacteria 3012
525 Ga0501033_0039871 3300049570 Bacteria 3507
526 Ga0501033_0040282 3300049570 Bacteria 3488
527 Ga0501033_0197765 3300049570 Bacteria 1437
528 Ga0501034_0003072 3300049571 Bacteria 19259
529 Ga0501034_0003172 3300049571 Bacteria 18908
530 Ga0501034_0028078 3300049571 Bacteria 5723
531 Ga0501034_0040507 3300049571 Bacteria 4715
532 Ga0501034_0078084 3300049571 Bacteria 3315
533 Ga0501034_0150402 3300049571 Bacteria 2304
534 Ga0501034_0183865 3300049571 Bacteria 2054
535 Ga0501036_0005456 3300049572 Bacteria 10307
536 Ga0501036_0026380 3300049572 Bacteria 4904
537 Ga0501036_0055340 3300049572 Bacteria 3361
538 Ga0501036_0079117 3300049572 Bacteria 2781
539 Ga0501036_0179397 3300049572 Bacteria 1783
540 Ga0501037_0004723 3300049573 Bacteria 9900
541 Ga0501037_0040791 3300049573 Bacteria 3415
542 Ga0501038_0006892 3300049574 Bacteria 10496
543 Ga0501038_0008336 3300049574 Bacteria 9539
544 Ga0501038_0011400 3300049574 Bacteria 8113
545 Ga0501039_0005691 3300049575 Bacteria 9441
546 Ga0501039_0029367 3300049575 Bacteria 4234
547 Ga0501039_0083051 3300049575 Bacteria 2495
548 Ga0501039_0169607 3300049575 Bacteria 1716
549 Ga0501040_0029399 3300049576 Unclassified 3709
550 Ga0501040_0040661 3300049576 Bacteria 3164
551 Ga0501040_0047570 3300049576 Bacteria 2929
552 Ga0501043_0011018 3300049579 Bacteria 7083
553 Ga0501043_0038749 3300049579 Bacteria 3748
554 Ga0501043_0107330 3300049579 Bacteria 2192
555 Ga0501047_0010562 3300049581 Bacteria 8732
556 Ga0501047_0033440 3300049581 Bacteria 4964
557 Ga0501047_0082720 3300049581 Bacteria 3085
558 Ga0501047_0101248 3300049581 Bacteria 2760
559 Ga0501047_0269605 3300049581 Bacteria 1549
560 Ga0501067_0060560 3300049583 Bacteria 2095
561 Ga0501069_0034582 3300049585 Bacteria 2783
562 Ga0501070_0000314 3300049586 Bacteria 43877
563 Ga0501070_0021877 3300049586 Bacteria 5357
564 Ga0501070_0024769 3300049586 Bacteria 5033
565 Ga0501070_0072356 3300049586 Bacteria 2854
566 Ga0501071_0212745 3300049587 Bacteria 1454
567 Ga0501072_0022243 3300049588 Bacteria 4919
568 Ga0501072_0116498 3300049588 Bacteria 2128
569 Ga0501074_0016009 3300049590 Bacteria 5451
570 Ga0501075_0016556 3300049591 Bacteria 5314
571 Ga0501075_0109698 3300049591 Bacteria 2098
572 Ga0501079_0102721 3300049741 Bacteria 2217
573 Ga0501080_0052134 3300049742 Bacteria 3808
574 Ga0501035_0020962 3300049822 Bacteria 6006
575 Ga0501035_0024842 3300049822 Bacteria 5494
576 Ga0501035_0026270 3300049822 Bacteria 5328
577 Ga0501035_0028809 3300049822 Bacteria 5067
578 Ga0501044_0000237 3300049823 Bacteria 69482
579 Ga0501044_0000591 3300049823 Bacteria 44012
580 Ga0501044_0004014 3300049823 Bacteria 16494
581 Ga0501044_0108797 3300049823 Bacteria 2781
582 Ga0501044_0208080 3300049823 Bacteria 1912
583 Ga0501044_0303116 3300049823 Bacteria 1526
584 Ga0501045_0190213 3300049824 Bacteria 1530
585 nmdc:mga06z11_48320_c1 3300050494 Bacteria 2165
586 nmdc:mga06z11_93017_c1 3300050494 Bacteria 1641
587 nmdc:mga07m45_44132_c2 3300050496 Bacteria 2307
588 nmdc:mga05p37_23683_c1 3300050507 Bacteria 7454
589 nmdc:mga05p37_383102_c1 3300050507 Bacteria 1647
590 nmdc:mga05p37_480203_c1 3300050507 Bacteria 1432
591 nmdc:mga08y16_199434_c1 3300050511 Bacteria 2074
592 nmdc:mga0n895_67854_c1 3300050512 Bacteria 3532
593 Ga0495601_0023119 3300053077 Bacteria 3818
594 Ga0495601_0052183 3300053077 Bacteria 2581
595 Ga0495612_0000558 3300053078 Bacteria 14950
596 Ga0495612_0003441 3300053078 Bacteria 6563
597 Ga0495595_0000440 3300053084 Bacteria 15734
598 Ga0495619_0003910 3300053085 Bacteria 9571
599 Ga0495619_0047585 3300053085 Bacteria 2824
600 Ga0495619_0108531 3300053085 Bacteria 1894
601 Ga0495619_0153635 3300053085 Bacteria 1588
602 Ga0500647_0075014 3300053091 Bacteria 1623
603 Ga0500557_000056 3300053105 Bacteria 49363
604 Ga0500642_0000031 3300053130 Bacteria 114671
605 Ga0500622_0000550 3300053156 Bacteria 34405
606 Ga0500636_0060626 3300053177 Bacteria 2209
607 Ga0500625_028480 3300053729 Bacteria 2651
608 Ga0501082_0128108 3300060353 Bacteria 2202
609 Ga0530510_0100917 3300061734 Bacteria 2110

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0293341 Ga0316582_0293341_16_1080 317
2 3300005530 Ga0070679_100186156 Ga0070679_1001861562 322
3 3300005545 Ga0070695_100008648 Ga0070695_1000086484 322
4 3300049568 Ga0501031_0029036 Ga0501031_0029036_623_1924 326
5 3300049572 Ga0501036_0026380 Ga0501036_0026380_1952_3277 326
6 3300049574 Ga0501038_0008336 Ga0501038_0008336_1147_2469 326
7 3300049579 Ga0501043_0011018 Ga0501043_0011018_4243_5568 326
8 3300049822 Ga0501035_0026270 Ga0501035_0026270_3954_5279 326
9 3300049823 Ga0501044_0000237 Ga0501044_0000237_54610_55935 326
10 3300005471 Ga0070698_100211385 Ga0070698_1002113852 327
11 3300005546 Ga0070696_100012071 Ga0070696_1000120714 328
12 3300048905 Ga0496102_0290586 Ga0496102_0290586_45_1295 332
13 3300038443 Ga0395901_0175495 Ga0395901_0175495_1061_2158 334
14 3300005457 Ga0070662_100192448 Ga0070662_1001924481 337
15 3300048911 Ga0496108_0041541 Ga0496108_0041541_191_1468 337
16 3300048912 Ga0496109_0030700 Ga0496109_0030700_424_1701 337
17 3300048917 Ga0496114_0037128 Ga0496114_0037128_2440_3717 337
18 3300031251 Ga0265327_10080705 Ga0265327_100807051 338
19 3300009147 Ga0114129_10162572 Ga0114129_101625722 340
20 3300032139 Ga0316580_10009353 Ga0316580_100093532 340
21 3300050507 nmdc:mga05p37_480203_c1 nmdc:mga05p37_480203_c1_75_1304 340
22 3300005272 Ga0065703_1000113 Ga0065703_100011311 343
23 3300005289 Ga0065704_10010619 Ga0065704_100106191 343
24 3300005289 Ga0065704_10021508 Ga0065704_100215081 343
25 3300005339 Ga0070660_100042021 Ga0070660_1000420213 343
26 3300005353 Ga0070669_100001257 Ga0070669_1000012573 343
27 3300005455 Ga0070663_100017645 Ga0070663_1000176452 343
28 3300005548 Ga0070665_100000775 Ga0070665_10000077522 343
29 3300009036 Ga0105244_10052226 Ga0105244_100522261 343
30 3300009036 Ga0105244_10066657 Ga0105244_100666571 343
31 3300009148 Ga0105243_10000052 Ga0105243_1000005282 343
32 3300009553 Ga0105249_10045631 Ga0105249_100456313 343
33 3300013104 Ga0157370_10270193 Ga0157370_102701931 343
34 3300017792 Ga0163161_10014000 Ga0163161_100140004 343
35 3300017792 Ga0163161_10190193 Ga0163161_101901931 343
36 3300025728 Ga0207655_1000618 Ga0207655_10006184 343
37 3300025728 Ga0207655_1001345 Ga0207655_10013455 343
38 3300025735 Ga0207713_1011192 Ga0207713_10111922 343
39 3300025909 Ga0207705_10025894 Ga0207705_100258942 343
40 3300025919 Ga0207657_10009690 Ga0207657_100096907 343
41 3300025923 Ga0207681_10000529 Ga0207681_1000052914 343
42 3300025935 Ga0207709_10000016 Ga0207709_10000016220 343
43 3300025949 Ga0207667_10020974 Ga0207667_100209742 343
44 3300025960 Ga0207651_10029993 Ga0207651_100299931 343
45 3300041411 Ga0439466_0040906 Ga0439466_0040906_199_1476 343
46 3300046460 Ga0495638_0091762 Ga0495638_0091762_102_1379 343
47 3300046519 Ga0495632_0071423 Ga0495632_0071423_197_1474 343
48 3300046525 Ga0495663_0019195 Ga0495663_0019195_81_1358 343
49 3300046558 Ga0495633_0061937 Ga0495633_0061937_174_1451 343
50 3300047470 Ga0495681_0063988 Ga0495681_0063988_115_1392 343
51 3300049460 Ga0495682_0042307 Ga0495682_0042307_201_1478 343
52 3300003856 Ga0058692_1000007 Ga0058692_100000793 345
53 3300006177 Ga0075362_10016988 Ga0075362_100169882 345
54 3300009036 Ga0105244_10018416 Ga0105244_100184164 345
55 3300009093 Ga0105240_10004512 Ga0105240_100045125 345
56 3300009101 Ga0105247_10001174 Ga0105247_1000117419 345
57 3300025728 Ga0207655_1014647 Ga0207655_10146474 345
58 3300025900 Ga0207710_10000018 Ga0207710_1000001878 345
59 3300025913 Ga0207695_10012680 Ga0207695_100126808 345
60 3300027312 Ga0209371_1000024 Ga0209371_1000024260 345
61 3300030500 Ga0268256_1000026 Ga0268256_1000026260 345
62 3300035398 Ga0316574_0048209 Ga0316574_0048209_931_2250 347
63 3300036712 Ga0316584_0025258 Ga0316584_0025258_1093_2412 347
64 3300009094 Ga0111539_10294156 Ga0111539_102941562 349
65 3300027907 Ga0207428_10104598 Ga0207428_101045982 349
66 3300049586 Ga0501070_0021877 Ga0501070_0021877_1714_2919 349
67 3300050511 nmdc:mga08y16_199434_c1 nmdc:mga08y16_199434_c1_518_1795 349
68 3300009011 Ga0105251_10005783 Ga0105251_100057834 351
69 3300009036 Ga0105244_10010793 Ga0105244_100107934 351
70 3300009036 Ga0105244_10024684 Ga0105244_100246841 351
71 3300009092 Ga0105250_10004830 Ga0105250_100048304 351
72 3300009553 Ga0105249_10001245 Ga0105249_100012452 351
73 3300025728 Ga0207655_1000728 Ga0207655_100072818 351
74 3300025728 Ga0207655_1002977 Ga0207655_10029779 351
75 3300025961 Ga0207712_10002358 Ga0207712_1000235811 351
76 3300031728 Ga0316578_10050663 Ga0316578_100506632 351
77 3300046660 Ga0495625_0039367 Ga0495625_0039367_98_1375 351
78 3300048929 Ga0496126_0099427 Ga0496126_0099427_400_1677 351
79 3300005467 Ga0070706_100238815 Ga0070706_1002388152 352
80 3300025910 Ga0207684_10225722 Ga0207684_102257221 352
81 3300049583 Ga0501067_0060560 Ga0501067_0060560_871_2013 352
82 3300005288 Ga0065714_10067024 Ga0065714_100670241 353
83 3300006946 Ga0079104_1000025 Ga0079104_1000025131 354
84 3300009148 Ga0105243_10002241 Ga0105243_100022418 354
85 3300025935 Ga0207709_10000159 Ga0207709_1000015928 354
86 3300025935 Ga0207709_10000740 Ga0207709_100007408 354
87 3300025936 Ga0207670_10142855 Ga0207670_101428552 354
88 3300027111 Ga0209281_1000007 Ga0209281_100000791 354
89 3300038735 Ga0400485_02933 Ga0400485_02933_7643_8923 357
90 3300038742 Ga0400486_23147 Ga0400486_23147_50803_52083 357
91 3300039110 Ga0400487_52265 Ga0400487_52265_601_1881 357
92 3300031251 Ga0265327_10000270 Ga0265327_1000027038 358
93 3300046642 Ga0495634_0040385 Ga0495634_0040385_26_1249 359
94 3300047444 Ga0495675_0173689 Ga0495675_0173689_85_1308 359
95 3300042876 Ga0451577_0168729 Ga0451577_0168729_656_1819 361
96 3300044712 Ga0453684_0036100 Ga0453684_0036100_5225_6388 361
97 3300044712 Ga0453684_0162974 Ga0453684_0162974_742_1905 361
98 3300045051 Ga0451576_0438949 Ga0451576_0438949_150_1313 361
99 3300048927 Ga0496124_0056712 Ga0496124_0056712_1894_3210 362
100 3300005435 Ga0070714_100000078 Ga0070714_10000007845 363
101 3300025929 Ga0207664_10000043 Ga0207664_1000004388 363
102 3300031240 Ga0265320_10053549 Ga0265320_100535492 364
103 3300049576 Ga0501040_0029399 Ga0501040_0029399_41_1183 364
104 3300005347 Ga0070668_100007902 Ga0070668_1000079023 367
105 3300005563 Ga0068855_100025809 Ga0068855_1000258093 367
106 3300005719 Ga0068861_100000713 Ga0068861_1000007137 367
107 3300009553 Ga0105249_10004532 Ga0105249_100045326 367
108 3300025927 Ga0207687_10034830 Ga0207687_100348302 367
109 3300025933 Ga0207706_10009893 Ga0207706_100098933 367
110 3300025972 Ga0207668_10017184 Ga0207668_100171843 367
111 3300026118 Ga0207675_100001418 Ga0207675_10000141812 367
112 3300045051 Ga0451576_0175407 Ga0451576_0175407_113_1252 367
113 3300028654 Ga0265322_10004158 Ga0265322_100041582 369
114 3300031344 Ga0265316_10056814 Ga0265316_100568143 369
115 3300031712 Ga0265342_10101813 Ga0265342_101018132 369
116 3300046462 Ga0495651_0064149 Ga0495651_0064149_552_1838 369
117 3300006881 Ga0068865_100068733 Ga0068865_1000687331 370
118 3300017792 Ga0163161_10023009 Ga0163161_100230092 370
119 3300053085 Ga0495619_0108531 Ga0495619_0108531_203_1489 370
120 3300021361 Ga0213872_10000439 Ga0213872_100004394 371
121 3300039447 Ga0436361_0076543 Ga0436361_0076543_14761_16035 371
122 3300014325 Ga0163163_10199018 Ga0163163_101990182 373
123 3300031727 Ga0316576_10097988 Ga0316576_100979882 373
124 3300039062 Ga0400483_064632 Ga0400483_064632_29073_30344 373
125 3300039062 Ga0400483_185206 Ga0400483_185206_24406_25677 373
126 3300048925 Ga0496122_0039697 Ga0496122_0039697_2416_3666 373
127 3300014325 Ga0163163_10116161 Ga0163163_101161612 374
128 3300048925 Ga0496122_0002661 Ga0496122_0002661_16376_17773 374
129 3300048928 Ga0496125_0001009 Ga0496125_0001009_17920_19317 374
130 3300049571 Ga0501034_0150402 Ga0501034_0150402_97_1398 376
131 3300041997 Ga0439431_0009022 Ga0439431_0009022_693_2000 378
132 3300042876 Ga0451577_0103437 Ga0451577_0103437_1259_2437 378
133 3300014497 Ga0182008_10072653 Ga0182008_100726532 379
134 3300044712 Ga0453684_0146745 Ga0453684_0146745_1464_2642 380
135 iso_pu_bacteria 2574179768 2574431361 380
136 iso_pu_bacteria 2643221541 2643728649 380
137 iso_pu_bacteria 2643221580 2643910956 380
138 iso_pu_bacteria 2643221591 2643966671 380
139 iso_pu_bacteria 2643221606 2644042534 380
140 iso_pu_bacteria 2643221671 2644392113 380
141 iso_pu_bacteria 2721755523 2722882681 380
142 iso_pu_bacteria 2891633521 2891636998 380
143 iso_pu_bacteria 2916178963 2916179305 380
144 iso_pu_bacteria 8047673197 8047677106 380
145 3300005327 Ga0070658_10116729 Ga0070658_101167292 381
146 3300031665 Ga0316575_10006080 Ga0316575_100060801 381
147 iso_pu_bacteria 2513237095 2513652647 381
148 iso_pu_bacteria 2547132512 2548847539 381
149 iso_pu_bacteria 2643221629 2644164142 381
150 iso_pu_bacteria 2643221662 2644348193 381
151 iso_pu_bacteria 2816332527 2818243314 381
152 iso_pu_bacteria 2846540461 2846542935 381
153 iso_pu_bacteria 2885409591 2885415557 381
154 iso_pu_bacteria 2888378607 2888381793 381
155 iso_pu_bacteria 2889033259 2889034696 381
156 iso_pu_bacteria 2941515067 2941522548 381
157 3300028800 Ga0265338_10014863 Ga0265338_100148636 382
158 3300035398 Ga0316574_0031279 Ga0316574_0031279_532_1734 382
159 3300044712 Ga0453684_0064134 Ga0453684_0064134_587_1804 382
160 iso_pu_bacteria 2639762793 2640735989 382
161 iso_pu_bacteria 2643221614 2644086121 382
162 iso_pu_bacteria 2643221661 2644345212 382
163 iso_pu_bacteria 2643221665 2644364871 382
164 iso_pu_bacteria 2643221666 2644369486 382
165 iso_pu_bacteria 2739367655 2739611779 382
166 iso_pu_bacteria 2744054655 2745159755 382
167 iso_pu_bacteria 2773857761 2774390237 382
168 iso_pu_bacteria 2773857770 2774437910 382
169 iso_pu_bacteria 2811994881 2812370193 382
170 iso_pu_bacteria 2852103415 2852107900 382
171 iso_pu_bacteria 2881927736 2881931283 382
172 iso_pu_bacteria 2882806704 2882807553 382
173 iso_pu_bacteria 2887375801 2887380663 382
174 iso_pu_bacteria 2919182534 2919184593 382
175 iso_pu_bacteria 2919506607 2919507694 382
176 iso_pu_bacteria 2923519811 2923524285 382
177 iso_pu_bacteria 2928515477 2928517661 382
178 iso_pu_bacteria 2990196909 2990199567 382
179 iso_pu_bacteria 8033232454 8033234246 382
180 iso_pu_bacteria 8048746797 8048748524 382
181 iso_pu_bacteria 8055878733 8055882219 382
182 iso_pu_bacteria 8057101203 8057101303 382
183 3300027876 Ga0209974_10038284 Ga0209974_100382842 383
184 3300031727 Ga0316576_10044936 Ga0316576_100449362 383
185 3300031727 Ga0316576_10120411 Ga0316576_101204112 383
186 3300036647 Ga0316582_0031930 Ga0316582_0031930_1547_2758 383
187 3300036712 Ga0316584_0077443 Ga0316584_0077443_898_2109 383
188 3300048928 Ga0496125_0091616 Ga0496125_0091616_78_1352 383
189 3300049588 Ga0501072_0022243 Ga0501072_0022243_2417_3664 383
190 3300049590 Ga0501074_0016009 Ga0501074_0016009_41_1288 383
191 3300049591 Ga0501075_0016556 Ga0501075_0016556_4018_5265 383
192 iso_pu_bacteria 2537561728 2538426417 383
193 iso_pu_bacteria 2643221598 2644000123 383
194 iso_pu_bacteria 2855195626 2855198059 383
195 iso_pu_bacteria 2858466076 2858466616 383
196 iso_pu_bacteria 2871272651 2871273389 383
197 iso_pu_bacteria 2871282230 2871282968 383
198 iso_pu_bacteria 2881714928 2881715668 383
199 iso_pu_bacteria 2884791551 2884793350 383
200 iso_pu_bacteria 2896184354 2896185431 383
201 iso_pu_bacteria 2896253425 2896256656 383
202 iso_pu_bacteria 2900051742 2900054618 383
203 iso_pu_bacteria 8002392321 8002395415 383
204 3300003215 JGI25153J46596_10034954 JGI25153J46596_100349542 384
205 3300005366 Ga0070659_100021415 Ga0070659_1000214152 384
206 3300005468 Ga0070707_100321174 Ga0070707_1003211742 384
207 3300005546 Ga0070696_100071257 Ga0070696_1000712571 384
208 3300005548 Ga0070665_100029742 Ga0070665_1000297424 384
209 3300005563 Ga0068855_100243603 Ga0068855_1002436032 384
210 3300005614 Ga0068856_100019551 Ga0068856_1000195518 384
211 3300005618 Ga0068864_100005182 Ga0068864_1000051822 384
212 3300009147 Ga0114129_10417583 Ga0114129_104175832 384
213 3300014325 Ga0163163_10029608 Ga0163163_100296087 384
214 3300014968 Ga0157379_10123883 Ga0157379_101238832 384
215 3300025231 Ga0207427_103980 Ga0207427_1039802 384
216 3300025245 Ga0207425_1000397 Ga0207425_100039717 384
217 3300025261 Ga0209233_1000671 Ga0209233_10006717 384
218 3300025297 Ga0209758_1000895 Ga0209758_100089511 384
219 3300025909 Ga0207705_10003576 Ga0207705_100035766 384
220 3300025910 Ga0207684_10123273 Ga0207684_101232733 384
221 3300025914 Ga0207671_10000344 Ga0207671_1000034429 384
222 3300025919 Ga0207657_10031412 Ga0207657_100314123 384
223 3300025922 Ga0207646_10225627 Ga0207646_102256271 384
224 3300025928 Ga0207700_10252300 Ga0207700_102523001 384
225 3300025932 Ga0207690_10024458 Ga0207690_100244584 384
226 3300025949 Ga0207667_10188937 Ga0207667_101889372 384
227 3300026078 Ga0207702_10008462 Ga0207702_100084623 384
228 3300026088 Ga0207641_10032432 Ga0207641_100324323 384
229 3300026089 Ga0207648_10094077 Ga0207648_100940772 384
230 3300026095 Ga0207676_10176755 Ga0207676_101767552 384
231 3300026116 Ga0207674_10041247 Ga0207674_100412472 384
232 3300026142 Ga0207698_10011496 Ga0207698_100114963 384
233 3300028379 Ga0268266_10000167 Ga0268266_100001676 384
234 3300031727 Ga0316576_10003878 Ga0316576_100038785 384
235 3300031727 Ga0316576_10064800 Ga0316576_100648001 384
236 3300031731 Ga0307405_10030034 Ga0307405_100300344 384
237 3300031733 Ga0316577_10049859 Ga0316577_100498592 384
238 3300031824 Ga0307413_10040290 Ga0307413_100402902 384
239 3300032004 Ga0307414_10085841 Ga0307414_100858412 384
240 3300032133 Ga0316583_10008253 Ga0316583_100082531 384
241 3300032139 Ga0316580_10012702 Ga0316580_100127021 384
242 3300032168 Ga0316593_10010856 Ga0316593_100108562 384
243 3300035398 Ga0316574_0011205 Ga0316574_0011205_3442_4713 384
244 3300035398 Ga0316574_0056360 Ga0316574_0056360_518_1789 384
245 3300036647 Ga0316582_0053319 Ga0316582_0053319_216_1487 384
246 3300036712 Ga0316584_0116588 Ga0316584_0116588_245_1516 384
247 3300037312 Ga0395899_0030484 Ga0395899_0030484_2271_3542 384
248 3300037418 Ga0395900_0004697 Ga0395900_0004697_7084_8355 384
249 3300037418 Ga0395900_0005946 Ga0395900_0005946_8390_9661 384
250 3300037418 Ga0395900_0269586 Ga0395900_0269586_304_1575 384
251 3300037466 Ga0395898_0004262 Ga0395898_0004262_8568_9839 384
252 3300037466 Ga0395898_0187932 Ga0395898_0187932_88_1359 384
253 3300037471 Ga0395905_0005717 Ga0395905_0005717_1851_3122 384
254 3300037588 Ga0316581_0037502 Ga0316581_0037502_59_1330 384
255 3300038443 Ga0395901_0010019 Ga0395901_0010019_2057_3328 384
256 3300038443 Ga0395901_0010623 Ga0395901_0010623_5724_6995 384
257 3300039062 Ga0400483_125974 Ga0400483_125974_12747_14018 384
258 3300039062 Ga0400483_164273 Ga0400483_164273_14335_15606 384
259 3300042876 Ga0451577_0159596 Ga0451577_0159596_379_1650 384
260 3300044684 Ga0466966_0001794 Ga0466966_0001794_8868_10139 384
261 3300044706 Ga0466964_0005530 Ga0466964_0005530_155_1426 384
262 3300044712 Ga0453684_0001440 Ga0453684_0001440_15062_16333 384
263 3300045051 Ga0451576_0140892 Ga0451576_0140892_241_1512 384
264 3300045976 Ga0466967_0093011 Ga0466967_0093011_1318_2589 384
265 3300046463 Ga0495653_0000031 Ga0495653_0000031_6066_7337 384
266 3300048909 Ga0496106_0046286 Ga0496106_0046286_30_1301 384
267 3300048917 Ga0496114_0119924 Ga0496114_0119924_670_1941 384
268 3300048919 Ga0496116_0085145 Ga0496116_0085145_333_1604 384
269 3300048927 Ga0496124_0058619 Ga0496124_0058619_494_1765 384
270 3300048928 Ga0496125_0000053 Ga0496125_0000053_59408_60679 384
271 3300048928 Ga0496125_0045652 Ga0496125_0045652_790_2061 384
272 3300048929 Ga0496126_0006527 Ga0496126_0006527_6575_7846 384
273 3300048929 Ga0496126_0055443 Ga0496126_0055443_1368_2639 384
274 3300049571 Ga0501034_0003072 Ga0501034_0003072_4540_5811 384
275 3300049581 Ga0501047_0101248 Ga0501047_0101248_1026_2297 384
276 3300049586 Ga0501070_0072356 Ga0501070_0072356_1092_2363 384
277 3300049742 Ga0501080_0052134 Ga0501080_0052134_1877_3148 384
278 3300049822 Ga0501035_0020962 Ga0501035_0020962_2060_3331 384
279 3300049823 Ga0501044_0000591 Ga0501044_0000591_21620_22891 384
280 3300050507 nmdc:mga05p37_383102_c1 nmdc:mga05p37_383102_c1_191_1417 384
281 iso_pu_bacteria 2916699645 2916700964 384
282 iso_pu_bacteria 2919497567 2919499323 384
283 iso_pu_bacteria 2984568884 2984571735 384
284 3300005329 Ga0070683_100091994 Ga0070683_1000919942 385
285 3300005331 Ga0070670_100027424 Ga0070670_1000274242 385
286 3300005355 Ga0070671_100008880 Ga0070671_1000088809 385
287 3300005355 Ga0070671_100018621 Ga0070671_1000186214 385
288 3300005365 Ga0070688_100004753 Ga0070688_1000047534 385
289 3300005535 Ga0070684_100032832 Ga0070684_1000328322 385
290 3300005543 Ga0070672_100126396 Ga0070672_1001263961 385
291 3300005548 Ga0070665_100225212 Ga0070665_1002252121 385
292 3300005842 Ga0068858_100050063 Ga0068858_1000500632 385
293 3300005937 Ga0081455_10002227 Ga0081455_1000222715 385
294 3300006042 Ga0075368_10006645 Ga0075368_100066453 385
295 3300006195 Ga0075366_10009674 Ga0075366_100096745 385
296 3300006358 Ga0068871_100156000 Ga0068871_1001560002 385
297 3300006847 Ga0075431_100070172 Ga0075431_1000701722 385
298 3300006852 Ga0075433_10117913 Ga0075433_101179132 385
299 3300006871 Ga0075434_100121544 Ga0075434_1001215442 385
300 3300006880 Ga0075429_100195890 Ga0075429_1001958902 385
301 3300006881 Ga0068865_100003899 Ga0068865_1000038994 385
302 3300009101 Ga0105247_10022894 Ga0105247_100228942 385
303 3300009147 Ga0114129_10002871 Ga0114129_1000287114 385
304 3300009147 Ga0114129_10006545 Ga0114129_1000654511 385
305 3300009147 Ga0114129_10076521 Ga0114129_100765212 385
306 3300009174 Ga0105241_10011730 Ga0105241_100117303 385
307 3300009176 Ga0105242_10002974 Ga0105242_100029743 385
308 3300009177 Ga0105248_10005809 Ga0105248_1000580912 385
309 3300009177 Ga0105248_10108953 Ga0105248_101089533 385
310 3300009545 Ga0105237_10009505 Ga0105237_100095056 385
311 3300009551 Ga0105238_10025536 Ga0105238_100255363 385
312 3300011119 Ga0105246_10004633 Ga0105246_100046336 385
313 3300013104 Ga0157370_10023150 Ga0157370_100231502 385
314 3300013306 Ga0163162_10325356 Ga0163162_103253561 385
315 3300014325 Ga0163163_10127978 Ga0163163_101279782 385
316 3300014968 Ga0157379_10161028 Ga0157379_101610282 385
317 3300014969 Ga0157376_10022301 Ga0157376_100223014 385
318 3300021377 Ga0213874_10011758 Ga0213874_100117582 385
319 3300021388 Ga0213875_10005448 Ga0213875_100054484 385
320 3300024225 Ga0224572_1007930 Ga0224572_10079302 385
321 3300025315 Ga0207697_10006065 Ga0207697_100060653 385
322 3300025911 Ga0207654_10015252 Ga0207654_100152523 385
323 3300025916 Ga0207663_10048982 Ga0207663_100489822 385
324 3300025925 Ga0207650_10016512 Ga0207650_100165122 385
325 3300025931 Ga0207644_10003286 Ga0207644_100032862 385
326 3300025933 Ga0207706_10047508 Ga0207706_100475083 385
327 3300025933 Ga0207706_10058895 Ga0207706_100588953 385
328 3300025938 Ga0207704_10003562 Ga0207704_100035624 385
329 3300025944 Ga0207661_10043720 Ga0207661_100437202 385
330 3300025944 Ga0207661_10158501 Ga0207661_101585012 385
331 3300025960 Ga0207651_10102889 Ga0207651_101028892 385
332 3300025981 Ga0207640_10028238 Ga0207640_100282382 385
333 3300025986 Ga0207658_10174784 Ga0207658_101747842 385
334 3300026035 Ga0207703_10044617 Ga0207703_100446173 385
335 3300026067 Ga0207678_10007777 Ga0207678_100077779 385
336 3300026089 Ga0207648_10260180 Ga0207648_102601802 385
337 3300028379 Ga0268266_10093792 Ga0268266_100937922 385
338 3300028800 Ga0265338_10005109 Ga0265338_1000510912 385
339 3300031238 Ga0265332_10000021 Ga0265332_10000021137 385
340 3300031241 Ga0265325_10012739 Ga0265325_100127391 385
341 3300031249 Ga0265339_10000128 Ga0265339_1000012818 385
342 3300031595 Ga0265313_10000246 Ga0265313_1000024626 385
343 3300031712 Ga0265342_10083993 Ga0265342_100839932 385
344 3300031727 Ga0316576_10049679 Ga0316576_100496793 385
345 3300031727 Ga0316576_10108845 Ga0316576_101088452 385
346 3300031727 Ga0316576_10111539 Ga0316576_101115391 385
347 3300031901 Ga0307406_10056494 Ga0307406_100564942 385
348 3300032002 Ga0307416_100117152 Ga0307416_1001171522 385
349 3300032005 Ga0307411_10156481 Ga0307411_101564812 385
350 3300032168 Ga0316593_10005976 Ga0316593_100059762 385
351 3300032168 Ga0316593_10050484 Ga0316593_100504841 385
352 3300035118 Ga0373954_0014915 Ga0373954_0014915_1820_3127 385
353 3300035170 Ga0373943_0024442 Ga0373943_0024442_1431_2735 385
354 3300035172 Ga0373955_0044783 Ga0373955_0044783_35_1342 385
355 3300035398 Ga0316574_0007711 Ga0316574_0007711_4512_5786 385
356 3300035398 Ga0316574_0042223 Ga0316574_0042223_1086_2360 385
357 3300035692 Ga0373935_0028567 Ga0373935_0028567_886_2190 385
358 3300035692 Ga0373935_0133431 Ga0373935_0133431_29_1336 385
359 3300035724 Ga0373933_0005988 Ga0373933_0005988_4926_6233 385
360 3300036401 Ga0373937_0000652 Ga0373937_0000652_18069_19376 385
361 3300036647 Ga0316582_0024509 Ga0316582_0024509_847_2121 385
362 3300036712 Ga0316584_0094592 Ga0316584_0094592_88_1362 385
363 3300037853 Ga0436364_0295817 Ga0436364_0295817_1267_2571 385
364 3300039438 Ga0436360_0090178 Ga0436360_0090178_3936_5240 385
365 3300039447 Ga0436361_0613971 Ga0436361_0613971_561_1865 385
366 3300039450 Ga0436363_0067581 Ga0436363_0067581_182_1486 385
367 3300044694 Ga0466963_0055792 Ga0466963_0055792_302_1576 385
368 3300046459 Ga0495629_0014875 Ga0495629_0014875_2723_4030 385
369 3300046459 Ga0495629_0066848 Ga0495629_0066848_151_1455 385
370 3300046462 Ga0495651_0029997 Ga0495651_0029997_2614_3921 385
371 3300046511 Ga0495608_0001598 Ga0495608_0001598_3390_4697 385
372 3300046514 Ga0495618_0011990 Ga0495618_0011990_2610_3917 385
373 3300046516 Ga0495628_0070766 Ga0495628_0070766_780_2087 385
374 3300046518 Ga0495631_0082946 Ga0495631_0082946_69_1343 385
375 3300046522 Ga0495643_0051393 Ga0495643_0051393_143_1444 385
376 3300046529 Ga0495652_0016596 Ga0495652_0016596_2143_3450 385
377 3300046536 Ga0495587_0001461 Ga0495587_0001461_11340_12647 385
378 3300046538 Ga0495609_0070729 Ga0495609_0070729_44_1318 385
379 3300046542 Ga0495597_0025469 Ga0495597_0025469_406_1707 385
380 3300046559 Ga0495667_0001555 Ga0495667_0001555_3654_4961 385
381 3300046663 Ga0495635_0115932 Ga0495635_0115932_77_1384 385
382 3300046678 Ga0495599_0001089 Ga0495599_0001089_2556_3863 385
383 3300046679 Ga0495623_0050660 Ga0495623_0050660_988_2295 385
384 3300046680 Ga0495646_0027461 Ga0495646_0027461_988_2295 385
385 3300046683 Ga0495658_0092776 Ga0495658_0092776_14_1336 385
386 3300046809 Ga0495600_0002498 Ga0495600_0002498_6149_7456 385
387 3300047317 Ga0495604_0003153 Ga0495604_0003153_378_1685 385
388 3300047319 Ga0495674_0041662 Ga0495674_0041662_1140_2447 385
389 3300047322 Ga0495680_0001790 Ga0495680_0001790_11392_12699 385
390 3300048907 Ga0496104_0005667 Ga0496104_0005667_4587_5891 385
391 3300048907 Ga0496104_0069237 Ga0496104_0069237_798_2099 385
392 3300048908 Ga0496105_0010905 Ga0496105_0010905_3439_4743 385
393 3300048908 Ga0496105_0016562 Ga0496105_0016562_3142_4443 385
394 3300048909 Ga0496106_0108103 Ga0496106_0108103_377_1681 385
395 3300048909 Ga0496106_0132650 Ga0496106_0132650_226_1527 385
396 3300048911 Ga0496108_0044700 Ga0496108_0044700_783_2084 385
397 3300048918 Ga0496115_0209340 Ga0496115_0209340_30_1331 385
398 3300048921 Ga0496118_0042628 Ga0496118_0042628_199_1500 385
399 3300048921 Ga0496118_0064365 Ga0496118_0064365_1145_2428 385
400 3300048925 Ga0496122_0000228 Ga0496122_0000228_106992_108275 385
401 3300048929 Ga0496126_0000290 Ga0496126_0000290_87829_89112 385
402 3300049568 Ga0501031_0030909 Ga0501031_0030909_2135_3409 385
403 3300049569 Ga0501032_0006016 Ga0501032_0006016_4510_5784 385
404 3300049570 Ga0501033_0039871 Ga0501033_0039871_1594_2874 385
405 3300049570 Ga0501033_0197765 Ga0501033_0197765_50_1348 385
406 3300049571 Ga0501034_0040507 Ga0501034_0040507_2492_3766 385
407 3300049571 Ga0501034_0078084 Ga0501034_0078084_2005_3279 385
408 3300049572 Ga0501036_0005456 Ga0501036_0005456_6038_7312 385
409 3300049572 Ga0501036_0179397 Ga0501036_0179397_143_1375 385
410 3300049574 Ga0501038_0006892 Ga0501038_0006892_1174_2448 385
411 3300049575 Ga0501039_0029367 Ga0501039_0029367_1174_2448 385
412 3300049575 Ga0501039_0169607 Ga0501039_0169607_25_1257 385
413 3300049576 Ga0501040_0047570 Ga0501040_0047570_1272_2504 385
414 3300049579 Ga0501043_0107330 Ga0501043_0107330_827_2101 385
415 3300049581 Ga0501047_0082720 Ga0501047_0082720_1313_2587 385
416 3300049586 Ga0501070_0024769 Ga0501070_0024769_3057_4331 385
417 3300049587 Ga0501071_0212745 Ga0501071_0212745_162_1436 385
418 3300049591 Ga0501075_0109698 Ga0501075_0109698_242_1474 385
419 3300049741 Ga0501079_0102721 Ga0501079_0102721_346_1575 385
420 3300049822 Ga0501035_0024842 Ga0501035_0024842_3400_4674 385
421 3300049823 Ga0501044_0108797 Ga0501044_0108797_670_1944 385
422 3300049824 Ga0501045_0190213 Ga0501045_0190213_168_1397 385
423 3300050494 nmdc:mga06z11_48320_c1 nmdc:mga06z11_48320_c1_216_1490 385
424 3300050494 nmdc:mga06z11_93017_c1 nmdc:mga06z11_93017_c1_41_1342 385
425 3300050496 nmdc:mga07m45_44132_c2 nmdc:mga07m45_44132_c2_358_1659 385
426 3300050507 nmdc:mga05p37_23683_c1 nmdc:mga05p37_23683_c1_1537_2832 385
427 3300050512 nmdc:mga0n895_67854_c1 nmdc:mga0n895_67854_c1_1025_2323 385
428 3300053077 Ga0495601_0052183 Ga0495601_0052183_301_1608 385
429 3300053078 Ga0495612_0003441 Ga0495612_0003441_3129_4436 385
430 3300053084 Ga0495595_0000440 Ga0495595_0000440_11390_12697 385
431 3300053085 Ga0495619_0047585 Ga0495619_0047585_1140_2447 385
432 3300053085 Ga0495619_0153635 Ga0495619_0153635_198_1499 385
433 3300053091 Ga0500647_0075014 Ga0500647_0075014_24_1298 385
434 3300053105 Ga0500557_000056 Ga0500557_000056_23057_24331 385
435 3300053130 Ga0500642_0000031 Ga0500642_0000031_1104_2378 385
436 3300053177 Ga0500636_0060626 Ga0500636_0060626_318_1592 385
437 3300053729 Ga0500625_028480 Ga0500625_028480_918_2192 385
438 3300060353 Ga0501082_0128108 Ga0501082_0128108_755_1984 385
439 iso_pu_bacteria 2747842501 2748016738 385
440 iso_pu_bacteria 2765235840 2765580215 385
441 iso_pu_bacteria 2852684882 2852686797 385
442 iso_pu_bacteria 2883068021 2883072041 385
443 iso_pu_bacteria 2896085136 2896089324 385
444 iso_pu_bacteria 2896109856 2896111352 385
445 iso_pu_bacteria 8021622325 8021625141 385
446 iso_pu_bacteria 8021626552 8021629460 385
447 iso_pu_bacteria 8021648035 8021650548 385
448 3300013100 Ga0157373_10022866 Ga0157373_100228661 386
449 3300020069 Ga0197907_10402444 Ga0197907_104024441 386
450 3300031727 Ga0316576_10012947 Ga0316576_100129475 386
451 3300031728 Ga0316578_10041198 Ga0316578_100411982 386
452 3300038725 Ga0400484_36359 Ga0400484_36359_5011_6288 386
453 3300038725 Ga0400484_37737 Ga0400484_37737_1246_2523 386
454 3300038725 Ga0400484_42782 Ga0400484_42782_5122_6399 386
455 3300038726 Ga0400490_09879 Ga0400490_09879_5490_6767 386
456 3300038727 Ga0400491_14515 Ga0400491_14515_84_1361 386
457 3300038741 Ga0400488_05672 Ga0400488_05672_2636_3913 386
458 3300038741 Ga0400488_08497 Ga0400488_08497_3290_4567 386
459 3300038741 Ga0400488_22293 Ga0400488_22293_287_1564 386
460 3300038741 Ga0400488_24757 Ga0400488_24757_13379_14656 386
461 3300038741 Ga0400488_26284 Ga0400488_26284_5388_6665 386
462 3300038741 Ga0400488_27595 Ga0400488_27595_1026_2303 386
463 3300038741 Ga0400488_42681 Ga0400488_42681_2783_4060 386
464 3300038742 Ga0400486_23232 Ga0400486_23232_257074_258351 386
465 3300039062 Ga0400483_039692 Ga0400483_039692_15716_16993 386
466 3300039062 Ga0400483_074051 Ga0400483_074051_112_1389 386
467 3300039062 Ga0400483_101010 Ga0400483_101010_2527_3804 386
468 3300039062 Ga0400483_143205 Ga0400483_143205_3223_4500 386
469 3300039062 Ga0400483_167010 Ga0400483_167010_2005_3282 386
470 3300039062 Ga0400483_179661 Ga0400483_179661_2583_3860 386
471 3300039062 Ga0400483_207839 Ga0400483_207839_14003_15280 386
472 3300039062 Ga0400483_220742 Ga0400483_220742_9366_10643 386
473 3300039062 Ga0400483_231265 Ga0400483_231265_6675_7952 386
474 3300039062 Ga0400483_277319 Ga0400483_277319_1550_2827 386
475 3300039110 Ga0400487_29167 Ga0400487_29167_24056_25333 386
476 3300039110 Ga0400487_51021 Ga0400487_51021_1118_2395 386
477 3300039110 Ga0400487_65585 Ga0400487_65585_963_2240 386
478 3300048928 Ga0496125_0084699 Ga0496125_0084699_743_2020 386
479 3300049573 Ga0501037_0040791 Ga0501037_0040791_1137_2423 386
480 3300049581 Ga0501047_0269605 Ga0501047_0269605_79_1365 386
481 iso_pu_bacteria 2818991460 2819678264 386
482 iso_pu_bacteria 2929177148 2929181029 386
483 iso_pu_bacteria 2945977869 2945983430 386
484 iso_pu_bacteria 2946013367 2946017179 386
485 3300005577 Ga0068857_100053747 Ga0068857_1000537472 387
486 3300026116 Ga0207674_10024473 Ga0207674_100244732 387
487 3300026116 Ga0207674_10125108 Ga0207674_101251082 387
488 3300031691 Ga0316579_10017893 Ga0316579_100178933 387
489 3300031733 Ga0316577_10073580 Ga0316577_100735802 387
490 3300032168 Ga0316593_10002050 Ga0316593_100020503 387
491 3300036712 Ga0316584_0046843 Ga0316584_0046843_1634_2914 387
492 3300037418 Ga0395900_0013612 Ga0395900_0013612_3572_4852 387
493 3300037588 Ga0316581_0036438 Ga0316581_0036438_34_1314 387
494 3300039062 Ga0400483_020538 Ga0400483_020538_1095_2375 387
495 3300039450 Ga0436363_0134585 Ga0436363_0134585_1892_3217 387
496 3300045976 Ga0466967_0285963 Ga0466967_0285963_20_1312 387
497 3300049571 Ga0501034_0028078 Ga0501034_0028078_4263_5543 387
498 3300049585 Ga0501069_0034582 Ga0501069_0034582_275_1582 387
499 3300049586 Ga0501070_0000314 Ga0501070_0000314_39581_40888 387
500 3300053156 Ga0500622_0000550 Ga0500622_0000550_15245_16549 387
501 iso_pu_bacteria 8055225921 8055228308 387
502 3300003323 rootH1_10010008 rootH1_1001000811 388
503 3300005355 Ga0070671_100056945 Ga0070671_1000569452 388
504 3300005435 Ga0070714_100049291 Ga0070714_1000492912 388
505 3300005436 Ga0070713_100000415 Ga0070713_10000041517 388
506 3300005459 Ga0068867_100042617 Ga0068867_1000426172 388
507 3300005614 Ga0068856_100316975 Ga0068856_1003169751 388
508 3300005616 Ga0068852_100044457 Ga0068852_1000444574 388
509 3300006028 Ga0070717_10007752 Ga0070717_100077526 388
510 3300006175 Ga0070712_100006225 Ga0070712_1000062253 388
511 3300013308 Ga0157375_10119476 Ga0157375_101194762 388
512 3300021388 Ga0213875_10014710 Ga0213875_100147103 388
513 3300025928 Ga0207700_10000115 Ga0207700_1000011521 388
514 3300025940 Ga0207691_10056953 Ga0207691_100569532 388
515 3300025945 Ga0207679_10048082 Ga0207679_100480823 388
516 3300026078 Ga0207702_10222019 Ga0207702_102220192 388
517 3300026089 Ga0207648_10118790 Ga0207648_101187902 388
518 3300026121 Ga0207683_10008000 Ga0207683_100080006 388
519 3300031249 Ga0265339_10001796 Ga0265339_1000179612 388
520 3300031911 Ga0307412_10008741 Ga0307412_100087416 388
521 3300035111 Ga0373923_0001939 Ga0373923_0001939_3540_4886 388
522 3300035117 Ga0373953_0004269 Ga0373953_0004269_973_2319 388
523 3300035119 Ga0373956_0000522 Ga0373956_0000522_11546_12892 388
524 3300035172 Ga0373955_0002506 Ga0373955_0002506_4977_6323 388
525 3300035410 Ga0373924_0062347 Ga0373924_0062347_38_1384 388
526 3300035724 Ga0373933_0001691 Ga0373933_0001691_9291_10637 388
527 3300036401 Ga0373937_0002173 Ga0373937_0002173_10840_12186 388
528 3300044712 Ga0453684_0002255 Ga0453684_0002255_13013_14296 388
529 3300044712 Ga0453684_0163469 Ga0453684_0163469_1186_2466 388
530 3300046462 Ga0495651_0003203 Ga0495651_0003203_10195_11541 388
531 3300046463 Ga0495653_0000247 Ga0495653_0000247_17638_18984 388
532 3300046511 Ga0495608_0000942 Ga0495608_0000942_7605_8951 388
533 3300046516 Ga0495628_0000527 Ga0495628_0000527_21191_22537 388
534 3300046517 Ga0495630_0004023 Ga0495630_0004023_7114_8460 388
535 3300046529 Ga0495652_0000395 Ga0495652_0000395_41524_42870 388
536 3300046533 Ga0495640_0036586 Ga0495640_0036586_712_2058 388
537 3300046535 Ga0495586_0032096 Ga0495586_0032096_646_1992 388
538 3300046536 Ga0495587_0000509 Ga0495587_0000509_12416_13762 388
539 3300046543 Ga0495645_0006037 Ga0495645_0006037_4159_5505 388
540 3300046559 Ga0495667_0001372 Ga0495667_0001372_3061_4407 388
541 3300046663 Ga0495635_0000284 Ga0495635_0000284_9635_10981 388
542 3300046675 Ga0495657_0000225 Ga0495657_0000225_13274_14620 388
543 3300046679 Ga0495623_0000801 Ga0495623_0000801_17638_18984 388
544 3300046809 Ga0495600_0000921 Ga0495600_0000921_9245_10591 388
545 3300047317 Ga0495604_0000672 Ga0495604_0000672_11954_13300 388
546 3300047319 Ga0495674_0002252 Ga0495674_0002252_9410_10756 388
547 3300047320 Ga0495672_0043491 Ga0495672_0043491_1307_2617 388
548 3300047322 Ga0495680_0003513 Ga0495680_0003513_1464_2810 388
549 3300047444 Ga0495675_0001009 Ga0495675_0001009_9928_11274 388
550 3300047471 Ga0495684_0001023 Ga0495684_0001023_12416_13762 388
551 3300048088 Ga0495602_0000550 Ga0495602_0000550_31496_32842 388
552 3300048921 Ga0496118_0021235 Ga0496118_0021235_515_1810 388
553 3300048929 Ga0496126_0112321 Ga0496126_0112321_680_1972 388
554 3300049572 Ga0501036_0055340 Ga0501036_0055340_1581_2819 388
555 3300049575 Ga0501039_0083051 Ga0501039_0083051_402_1640 388
556 3300049576 Ga0501040_0040661 Ga0501040_0040661_986_2224 388
557 3300049579 Ga0501043_0038749 Ga0501043_0038749_690_1976 388
558 3300049581 Ga0501047_0033440 Ga0501047_0033440_1914_3200 388
559 3300049588 Ga0501072_0116498 Ga0501072_0116498_187_1425 388
560 3300049823 Ga0501044_0004014 Ga0501044_0004014_14740_16026 388
561 3300053077 Ga0495601_0023119 Ga0495601_0023119_2274_3620 388
562 3300053078 Ga0495612_0000558 Ga0495612_0000558_93_1439 388
563 3300053085 Ga0495619_0003910 Ga0495619_0003910_2220_3566 388
564 3300061734 Ga0530510_0100917 Ga0530510_0100917_195_1433 388
565 iso_pu_bacteria 2599185292 2599903571 388
566 iso_pu_bacteria 2643221569 2643860062 388
567 iso_pu_bacteria 2738543031 2739350891 388
568 3300003781 Ga0055536_1004214 Ga0055536_10042143 389
569 3300005290 Ga0065712_10103577 Ga0065712_101035771 389
570 3300005441 Ga0070700_100096697 Ga0070700_1000966972 389
571 3300005445 Ga0070708_100057538 Ga0070708_1000575383 389
572 3300005445 Ga0070708_100151326 Ga0070708_1001513261 389
573 3300005614 Ga0068856_100034788 Ga0068856_1000347884 389
574 3300009148 Ga0105243_10167058 Ga0105243_101670582 389
575 3300013297 Ga0157378_10005272 Ga0157378_100052727 389
576 3300013307 Ga0157372_10220781 Ga0157372_102207812 389
577 3300025292 Ga0209676_1000037 Ga0209676_1000037247 389
578 3300039062 Ga0400483_063981 Ga0400483_063981_379_1716 389
579 3300039062 Ga0400483_186846 Ga0400483_186846_1234_2571 389
580 3300049569 Ga0501032_0044301 Ga0501032_0044301_1189_2511 389
581 3300049570 Ga0501033_0040282 Ga0501033_0040282_907_2229 389
582 3300049571 Ga0501034_0003172 Ga0501034_0003172_10184_11506 389
583 3300049571 Ga0501034_0183865 Ga0501034_0183865_713_2026 389
584 3300049572 Ga0501036_0079117 Ga0501036_0079117_1378_2700 389
585 3300049573 Ga0501037_0004723 Ga0501037_0004723_7672_8994 389
586 3300049574 Ga0501038_0011400 Ga0501038_0011400_1748_3070 389
587 3300049575 Ga0501039_0005691 Ga0501039_0005691_1923_3245 389
588 3300049581 Ga0501047_0010562 Ga0501047_0010562_2683_4005 389
589 3300049822 Ga0501035_0028809 Ga0501035_0028809_1923_3245 389
590 3300049823 Ga0501044_0303116 Ga0501044_0303116_33_1355 389
591 iso_pu_bacteria 2857576091 2857579967 389
592 3300009093 Ga0105240_10003726 Ga0105240_100037264 390
593 3300009551 Ga0105238_10092019 Ga0105238_100920192 390
594 3300013100 Ga0157373_10045228 Ga0157373_100452282 390
595 3300014497 Ga0182008_10015110 Ga0182008_100151103 390
596 3300021388 Ga0213875_10029488 Ga0213875_100294882 390
597 3300025904 Ga0207647_10092512 Ga0207647_100925121 390
598 3300025932 Ga0207690_10041588 Ga0207690_100415882 390
599 3300037853 Ga0436364_0304718 Ga0436364_0304718_1930_3240 390
600 3300039110 Ga0400487_03892 Ga0400487_03892_7404_8693 390
601 3300039110 Ga0400487_18868 Ga0400487_18868_667_1956 390
602 3300046501 Ga0495607_0000104 Ga0495607_0000104_24569_25870 390
603 3300048925 Ga0496122_0000014 Ga0496122_0000014_413993_415333 390
604 3300048926 Ga0496123_0044367 Ga0496123_0044367_1243_2583 390
605 3300048929 Ga0496126_0000019 Ga0496126_0000019_413993_415333 390
606 3300038726 Ga0400490_18457 Ga0400490_18457_1607_2953 391
607 3300044658 Ga0466972_0000315 Ga0466972_0000315_9672_10979 391
608 3300044671 Ga0466978_0024534 Ga0466978_0024534_1491_2798 391
609 3300044683 Ga0466965_0020796 Ga0466965_0020796_1755_3062 391
610 3300044693 Ga0466961_0000077 Ga0466961_0000077_38875_40182 391
611 3300044735 Ga0466968_0010797 Ga0466968_0010797_1441_2748 391
612 3300044765 Ga0466970_0000966 Ga0466970_0000966_7396_8703 391
613 3300044842 Ga0466957_0061271 Ga0466957_0061271_783_2090 391
614 3300044901 Ga0466960_0016794 Ga0466960_0016794_690_1997 391
615 3300045049 Ga0466959_0001159 Ga0466959_0001159_7381_8688 391
616 3300045976 Ga0466967_0048599 Ga0466967_0048599_246_1553 391
617 iso_pu_bacteria 2551306352 2552748409 391
618 iso_pu_bacteria 2904479285 2904480340 391
619 3300009545 Ga0105237_10000166 Ga0105237_1000016633 392
620 3300010375 Ga0105239_10001740 Ga0105239_1000174024 392
621 3300039062 Ga0400483_197539 Ga0400483_197539_6008_7303 392
622 3300039062 Ga0400483_290131 Ga0400483_290131_728_2023 392
623 3300005331 Ga0070670_100136274 Ga0070670_1001362742 393
624 3300005340 Ga0070689_100051454 Ga0070689_1000514543 393
625 3300005353 Ga0070669_100094168 Ga0070669_1000941682 393
626 3300005353 Ga0070669_100181506 Ga0070669_1001815061 393
627 3300005365 Ga0070688_100071329 Ga0070688_1000713292 393
628 3300005455 Ga0070663_100149775 Ga0070663_1001497752 393
629 3300005456 Ga0070678_100023144 Ga0070678_1000231442 393
630 3300005617 Ga0068859_100120900 Ga0068859_1001209003 393
631 3300005719 Ga0068861_100084991 Ga0068861_1000849912 393
632 3300005840 Ga0068870_10052727 Ga0068870_100527272 393
633 3300006931 Ga0097620_100120903 Ga0097620_1001209033 393
634 3300009101 Ga0105247_10117856 Ga0105247_101178562 393
635 3300009553 Ga0105249_10069629 Ga0105249_100696292 393
636 3300025893 Ga0207682_10007635 Ga0207682_100076353 393
637 3300025899 Ga0207642_10036256 Ga0207642_100362562 393
638 3300025901 Ga0207688_10122867 Ga0207688_101228671 393
639 3300025904 Ga0207647_10004440 Ga0207647_100044405 393
640 3300025907 Ga0207645_10110563 Ga0207645_101105632 393
641 3300025908 Ga0207643_10066407 Ga0207643_100664072 393
642 3300025921 Ga0207652_10037774 Ga0207652_100377742 393
643 3300025923 Ga0207681_10073627 Ga0207681_100736272 393
644 3300025926 Ga0207659_10102976 Ga0207659_101029762 393
645 3300025937 Ga0207669_10037663 Ga0207669_100376632 393
646 3300025940 Ga0207691_10001523 Ga0207691_1000152320 393
647 3300025941 Ga0207711_10122930 Ga0207711_101229302 393
648 3300025949 Ga0207667_10145706 Ga0207667_101457062 393
649 3300025972 Ga0207668_10091542 Ga0207668_100915422 393
650 3300026041 Ga0207639_10110356 Ga0207639_101103562 393
651 3300026089 Ga0207648_10066827 Ga0207648_100668273 393
652 3300026118 Ga0207675_100108470 Ga0207675_1001084702 393
653 3300026121 Ga0207683_10064101 Ga0207683_100641012 393
654 3300042436 Ga0439435_0001816 Ga0439435_0001816_787_2076 393
655 3300046455 Ga0495603_0025772 Ga0495603_0025772_1644_2975 393
656 3300046491 Ga0495584_0033438 Ga0495584_0033438_1131_2462 393
657 3300048090 Ga0495615_0000769 Ga0495615_0000769_2562_3851 393
658 3300049823 Ga0501044_0208080 Ga0501044_0208080_237_1637 393
659 iso_pu_bacteria 2791355199 2793078988 393
660 iso_pu_bacteria 2879110137 2879116219 393
661 iso_pu_bacteria 2941507105 2941514568 393
662 iso_pu_bacteria 2941523033 2941530428 393
663 3300044712 Ga0453684_0009091 Ga0453684_0009091_4143_5336 396
664 iso_pu_bacteria 2512047086 2512529682 396
665 iso_pu_bacteria 2512875026 2512970072 396
666 iso_pu_bacteria 2513237089 2513602675 396
667 iso_pu_bacteria 2513237156 2513987045 396
668 iso_pu_bacteria 2513237160 2514005568 396
669 iso_pu_bacteria 2582581316 2585333197 396
670 iso_pu_bacteria 2643221618 2644105833 396
671 iso_pu_bacteria 2643221655 2644310445 396
672 iso_pu_bacteria 2643221659 2644334770 396
673 iso_pu_bacteria 2643221698 2644545036 396
674 iso_pu_bacteria 2643221712 2644612547 396
675 iso_pu_bacteria 2802428858 2802716495 396
676 iso_pu_bacteria 2802428859 2802722466 396
677 iso_pu_bacteria 2802428860 2802734246 396
678 iso_pu_bacteria 2802428861 2802735785 396
679 iso_pu_bacteria 2802428862 2802741642 396
680 iso_pu_bacteria 2842482326 2842486503 396
681 iso_pu_bacteria 2844163670 2844165527 396
682 iso_pu_bacteria 2915980308 2915983516 396
683 iso_pu_bacteria 2916061851 2916064646 396
684 iso_pu_bacteria 2937029754 2937032728 396
685 iso_pu_bacteria 2937036028 2937041024 396
686 iso_pu_bacteria 2937078374 2937082166 396
687 iso_pu_bacteria 2937084907 2937090263 396
688 iso_pu_bacteria 2941499720 2941506094 396
689 iso_pu_bacteria 2957375807 2957378746 396
690 iso_pu_bacteria 2957437181 2957438567 396
691 iso_pu_bacteria 2960591022 2960594846 396
692 iso_pu_bacteria 2960631154 2960631220 396
693 iso_pu_bacteria 2960680706 2960682959 396
694 iso_pu_bacteria 2960693952 2960699514 396
695 iso_pu_bacteria 2967686174 2967688714 396
696 iso_pu_bacteria 2967728569 2967731299 396
697 iso_pu_bacteria 2970122695 2970125446 396
698 iso_pu_bacteria 2970143518 2970146683 396
699 iso_pu_bacteria 2977530762 2977534016 396
700 iso_pu_bacteria 2977544691 2977546753 396
701 iso_pu_bacteria 8003999396 8004005001 396
702 iso_pu_bacteria 2946033335 2946036660 398
703 iso_pu_bacteria 2643221637 2644207556 399
704 iso_pu_bacteria 2643221718 2644651305 399
705 iso_pu_bacteria 2643221723 2644671967 399
706 3300003214 JGI25165J46597_1002291 JGI25165J46597_10022917 400
707 3300006946 Ga0079104_1005194 Ga0079104_10051943 400
708 3300022739 Ga0228711_1000009 Ga0228711_1000009104 400
709 3300022740 Ga0228710_1000011 Ga0228710_1000011102 400
710 3300025233 Ga0209437_100042 Ga0209437_10004244 400
711 3300025261 Ga0209233_1000103 Ga0209233_100010344 400
712 3300027111 Ga0209281_1000132 Ga0209281_100013271 400
713 3300027666 Ga0209282_1000018 Ga0209282_100001871 400
714 3300031967 Ga0315914_1000332 Ga0315914_100033229 400
715 3300033430 Ga0315913_1000072 Ga0315913_100007230 400
716 3300033464 Ga0315915_1000006 Ga0315915_1000006232 400
717 3300037471 Ga0395905_0003994 Ga0395905_0003994_462_1664 400
718 3300002739 JGI25158J39367_1003467 JGI25158J39367_10034672 403
719 3300002987 JGI25159J45721_1000049 JGI25159J45721_100004940 403
720 3300003354 JGI25160J50197_1000147 JGI25160J50197_100014723 403
721 3300003374 JGI25161J50226_1000592 JGI25161J50226_10005927 403
722 3300003781 Ga0055536_1000741 Ga0055536_100074115 403
723 3300003794 Ga0055531_10001435 Ga0055531_100014357 403
724 3300004625 Ga0055543_1000129 Ga0055543_100012942 403
725 3300005262 Ga0065165_1000477 Ga0065165_100047723 403
726 3300025284 Ga0209130_1000234 Ga0209130_100023439 403
727 3300025294 Ga0209025_1000337 Ga0209025_100033745 403
728 3300025295 Ga0209564_1000117 Ga0209564_100011787 403
729 3300025298 Ga0209050_1003742 Ga0209050_10037427 403
730 3300025299 Ga0209256_1000352 Ga0209256_100035245 403
731 3300025302 Ga0207426_1000410 Ga0207426_100041039 403
732 3300025303 Ga0209051_1010989 Ga0209051_10109893 403
733 3300025304 Ga0209257_1001129 Ga0209257_100112920 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

47

464

0.98

PF00266

Aminotran_5

Aminotransferase class-V

129

263

0.88

PF00155

Aminotran_1_2

Aminotransferase class I and II

85

266

0.85

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

84

237

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l0o-assembly3.cif.gz_G-3 structure determination of cystathionine gamma-synthase from helicobacter pylori 0.968 9 397
4l0o-assembly2.cif.gz_E structure determination of cystathionine gamma-synthase from helicobacter pylori 0.9671 9 397
3acz-assembly1.cif.gz_B crystal structure of entamoeba histolytica methionine gamma-lyase 1 0.9645 8 396
5e4z-assembly1.cif.gz_A crystal structure of methionine gamma-lyase from citrobacter freundii with c115a substitution 0.9635 7 399
3qi6-assembly1.cif.gz_C crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 0.9634 9 396
ID Description Score Start End Superfamily
1n8pD02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9695 267 399 3.90.1150.10
3ndnB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9688 266 396 3.90.1150.10
af_O13326_295_429_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9636 268 398 3.90.1150.10
af_Q4DUG8_270_407_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9621 266 397 3.90.1150.10
2nmpB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9616 267 400 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A6I3U932-F1-model_v4 Bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (EC 2.5.1.49) 0.9832 64 155 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A544VQ81-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9822 70 206 GO:0003962
GO:0004123
GO:0005737
GO:0008483
GO:0009086
GO:0019343
GO:0019346
GO:0030170
AF-A0A848VQE9-F1-model_v4 O-succinylhomoserine sulfhydrylase 0.979 247 399 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269
AF-A0A7V2W9G7-F1-model_v4 O-succinylhomoserine sulfhydrylase 0.979 250 396 GO:0005737
GO:0016846
GO:0019346
GO:0030170
AF-R8BUP8-F1-model_v4 Putative homocysteine synthase protein 0.9788 55 399 GO:0003961
GO:0004124
GO:0005737
GO:0006535
GO:0019346
GO:0030170
GO:0071269

Feature Viewer

pLDDT pTM Quality
92.87 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map