F477992

General Info

Members Datasets Scaffolds Average Seq Length
731 319 1462 168

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0042502|Ga0501070_0042502_1314_1934
Length 206
Sequence VVRGSSPRGPWIGIGDRQAWQARGGVLKKRRLPFHEEEKMNADAKKTALRMIPYGIYVMTVDDGKGGIAAATVNWVTQTAFAPPLVVVGVKTDSGAYALVKNTKTFALNMLGKDQKGLAFTFFKPAQLADGKISGQAFRKGANGAPILDAASAAVECKVTAIIEQGDHHIVVGEVTEAHLAKPPAGRPDAAILEMKDLGDNVFYGG

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
128 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
219 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 2.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.92
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 26.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0042502 3300049586 Bacteria 3786
2 JGI25406J46586_10004491 3300003203 Bacteria 6492
3 Ga0058862_10001543 3300004803 Unclassified 1139
4 Ga0065714_10138008 3300005288 Unclassified 1193
5 Ga0065712_10000161 3300005290 Bacteria 38619
6 Ga0065712_10126453 3300005290 Unclassified 1601
7 Ga0065715_10002397 3300005293 Bacteria 8815
8 Ga0065715_10009377 3300005293 Bacteria 4817
9 Ga0065707_10247051 3300005295 Bacteria 1137
10 Ga0070658_10451423 3300005327 Bacteria 1108
11 Ga0070676_10004921 3300005328 Bacteria 7078
12 Ga0070683_100793715 3300005329 Bacteria 908
13 Ga0070690_100018565 3300005330 Bacteria 4203
14 Ga0070690_100320460 3300005330 Bacteria 1117
15 Ga0070670_100000611 3300005331 Bacteria 28002
16 Ga0070670_100156603 3300005331 Bacteria 1973
17 Ga0070677_10019792 3300005333 Unclassified 2443
18 Ga0068869_100066289 3300005334 Bacteria 2660
19 Ga0070666_10055281 3300005335 Bacteria 2679
20 Ga0070666_10284450 3300005335 Bacteria 1176
21 Ga0070680_100004460 3300005336 Bacteria 10542
22 Ga0070680_100031322 3300005336 Bacteria 4276
23 Ga0070680_100053500 3300005336 Bacteria 3295
24 Ga0070680_100401330 3300005336 Bacteria 1168
25 Ga0070680_100626282 3300005336 Bacteria 924
26 Ga0070680_100955265 3300005336 Unclassified 740
27 Ga0070680_101220327 3300005336 Unclassified 650
28 Ga0070682_100071064 3300005337 Bacteria 2227
29 Ga0068868_100030967 3300005338 Unclassified 4105
30 Ga0070660_100176581 3300005339 Unclassified 1727
31 Ga0070689_100079524 3300005340 Unclassified 2572
32 Ga0070689_100412826 3300005340 Unclassified 1143
33 Ga0070691_10044291 3300005341 Unclassified 2110
34 Ga0070691_10063895 3300005341 Unclassified 1775
35 Ga0070687_100222397 3300005343 Unclassified 1157
36 Ga0070661_100141453 3300005344 Unclassified 1814
37 Ga0070661_100260926 3300005344 Bacteria 1340
38 Ga0070692_10506603 3300005345 Unclassified 783
39 Ga0070692_10583690 3300005345 Bacteria 737
40 Ga0070669_100069079 3300005353 Unclassified 2609
41 Ga0070675_100133109 3300005354 Unclassified 2120
42 Ga0070671_100066312 3300005355 Bacteria 3008
43 Ga0070674_100078636 3300005356 Unclassified 2351
44 Ga0070674_101144265 3300005356 Unclassified 689
45 Ga0070673_100024014 3300005364 Bacteria 4462
46 Ga0070673_100151887 3300005364 Bacteria 1962
47 Ga0070673_101022766 3300005364 Bacteria 770
48 Ga0070688_100059766 3300005365 Bacteria 2405
49 Ga0070659_100037236 3300005366 Unclassified 3792
50 Ga0070659_100048394 3300005366 Unclassified 3340
51 Ga0070667_100137663 3300005367 Unclassified 2135
52 Ga0070667_101243362 3300005367 Unclassified 697
53 Ga0070667_101330650 3300005367 Bacteria 673
54 Ga0070709_10024351 3300005434 Bacteria 3562
55 Ga0070709_10115764 3300005434 Bacteria 1809
56 Ga0070714_100061561 3300005435 Bacteria 3224
57 Ga0070714_100218257 3300005435 Unclassified 1751
58 Ga0070714_100353028 3300005435 Bacteria 1381
59 Ga0070714_100359697 3300005435 Bacteria 1368
60 Ga0070714_100731373 3300005435 Unclassified 956
61 Ga0070713_100067769 3300005436 Bacteria 3006
62 Ga0070713_100077645 3300005436 Bacteria 2824
63 Ga0070713_100255294 3300005436 Bacteria 1600
64 Ga0070713_100494594 3300005436 Unclassified 1153
65 Ga0070710_10003156 3300005437 Bacteria 7812
66 Ga0070710_10023819 3300005437 Bacteria 3223
67 Ga0070710_10429871 3300005437 Unclassified 891
68 Ga0070711_100086788 3300005439 Bacteria 2244
69 Ga0070711_100317022 3300005439 Bacteria 1244
70 Ga0070711_100507767 3300005439 Unclassified 995
71 Ga0070711_100662776 3300005439 Bacteria 876
72 Ga0070705_100013941 3300005440 Bacteria 4123
73 Ga0070705_100220043 3300005440 Bacteria 1314
74 Ga0070700_100232771 3300005441 Unclassified 1312
75 Ga0070700_100332630 3300005441 Bacteria 1120
76 Ga0070700_100716931 3300005441 Unclassified 797
77 Ga0070694_100073149 3300005444 Bacteria 2367
78 Ga0070694_100295868 3300005444 Bacteria 1239
79 Ga0070694_100318608 3300005444 Bacteria 1196
80 Ga0070694_100632353 3300005444 Bacteria 865
81 Ga0070708_100254941 3300005445 Bacteria 1648
82 Ga0070663_100020480 3300005455 Unclassified 4381
83 Ga0070678_100039105 3300005456 Bacteria 3344
84 Ga0070678_100363666 3300005456 Unclassified 1247
85 Ga0070662_100179839 3300005457 Bacteria 1667
86 Ga0070662_100253171 3300005457 Unclassified 1416
87 Ga0070681_10003972 3300005458 Bacteria 13948
88 Ga0070681_10007797 3300005458 Bacteria 10469
89 Ga0070681_10009896 3300005458 Bacteria 9394
90 Ga0070681_10058222 3300005458 Bacteria 3844
91 Ga0070681_10082655 3300005458 Bacteria 3166
92 Ga0070681_10884854 3300005458 Unclassified 811
93 Ga0068867_100194627 3300005459 Unclassified 1620
94 Ga0068867_101010122 3300005459 Bacteria 755
95 Ga0070706_100275990 3300005467 Bacteria 1569
96 Ga0070706_100278809 3300005467 Bacteria 1560
97 Ga0070707_100728302 3300005468 Bacteria 955
98 Ga0070698_100501381 3300005471 Bacteria 1152
99 Ga0070698_101001900 3300005471 Unclassified 783
100 Ga0070699_100109530 3300005518 Bacteria 2424
101 Ga0070699_100552919 3300005518 Bacteria 1048
102 Ga0070699_100626976 3300005518 Unclassified 981
103 Ga0070679_100005562 3300005530 Bacteria 11680
104 Ga0070679_100058290 3300005530 Bacteria 3847
105 Ga0070679_100060576 3300005530 Bacteria 3772
106 Ga0070679_100148161 3300005530 Unclassified 2324
107 Ga0070684_100079334 3300005535 Unclassified 2902
108 Ga0070684_100091144 3300005535 Bacteria 2711
109 Ga0070697_100058232 3300005536 Bacteria 3144
110 Ga0070697_100391952 3300005536 Bacteria 1204
111 Ga0070697_100825737 3300005536 Bacteria 821
112 Ga0068853_100257246 3300005539 Bacteria 1604
113 Ga0070672_100001632 3300005543 Bacteria 13956
114 Ga0070686_100058156 3300005544 Unclassified 2487
115 Ga0070686_101205924 3300005544 Unclassified 629
116 Ga0070695_100014670 3300005545 Bacteria 4723
117 Ga0070695_100015040 3300005545 Unclassified 4669
118 Ga0070695_100578270 3300005545 Bacteria 879
119 Ga0070695_100698540 3300005545 Bacteria 805
120 Ga0070696_100022644 3300005546 Bacteria 4270
121 Ga0070696_100048551 3300005546 Bacteria 2947
122 Ga0070696_100119610 3300005546 Unclassified 1905
123 Ga0070696_100605329 3300005546 Bacteria 884
124 Ga0070693_100093605 3300005547 Unclassified 1816
125 Ga0070693_100215148 3300005547 Bacteria 1256
126 Ga0070665_100573665 3300005548 Bacteria 1141
127 Ga0070704_100150305 3300005549 Bacteria 1830
128 Ga0070704_100393339 3300005549 Bacteria 1181
129 Ga0070704_100878426 3300005549 Bacteria 805
130 Ga0068855_100053393 3300005563 Unclassified 4754
131 Ga0068855_100166268 3300005563 Bacteria 2500
132 Ga0068855_100384323 3300005563 Bacteria 1541
133 Ga0070664_100004308 3300005564 Bacteria 11443
134 Ga0070664_100065384 3300005564 Bacteria 3102
135 Ga0070664_100403057 3300005564 Unclassified 1251
136 Ga0070664_100429775 3300005564 Bacteria 1210
137 Ga0070664_101090314 3300005564 Bacteria 752
138 Ga0068857_100033080 3300005577 Bacteria 4572
139 Ga0068857_100135526 3300005577 Bacteria 2223
140 Ga0068857_100136648 3300005577 Bacteria 2213
141 Ga0068854_100231290 3300005578 Bacteria 1467
142 Ga0068856_100118477 3300005614 Bacteria 2648
143 Ga0068856_100310452 3300005614 Bacteria 1594
144 Ga0068856_100336259 3300005614 Bacteria 1528
145 Ga0068856_100985059 3300005614 Bacteria 861
146 Ga0070702_100071436 3300005615 Bacteria 2051
147 Ga0070702_101210255 3300005615 Bacteria 609
148 Ga0068852_100310188 3300005616 Bacteria 1529
149 Ga0068852_100391080 3300005616 Unclassified 1366
150 Ga0068859_100184316 3300005617 Bacteria 2171
151 Ga0068864_100332802 3300005618 Bacteria 1429
152 Ga0068864_101841082 3300005618 Bacteria 611
153 Ga0068866_10307708 3300005718 Bacteria 992
154 Ga0068866_10471687 3300005718 Bacteria 825
155 Ga0068866_10654110 3300005718 Unclassified 716
156 Ga0068863_100492708 3300005841 Unclassified 1206
157 Ga0068858_100019185 3300005842 Bacteria 6397
158 Ga0068860_100025336 3300005843 Bacteria 5724
159 Ga0068860_100121016 3300005843 Bacteria 2506
160 Ga0068860_100687900 3300005843 Bacteria 1032
161 Ga0068862_100221260 3300005844 Unclassified 1714
162 Ga0068862_100365561 3300005844 Bacteria 1342
163 Ga0081455_10000599 3300005937 Bacteria 46691
164 Ga0081455_10001044 3300005937 Bacteria 34911
165 Ga0081455_10174134 3300005937 Bacteria 1636
166 Ga0081455_10699393 3300005937 Bacteria 646
167 Ga0081539_10000025 3300005985 Bacteria 340255
168 Ga0070717_10010359 3300006028 Bacteria 7035
169 Ga0070717_10293721 3300006028 Bacteria 1443
170 Ga0070717_10295192 3300006028 Bacteria 1440
171 Ga0070712_100040351 3300006175 Bacteria 3200
172 Ga0070712_100101850 3300006175 Bacteria 2125
173 Ga0097621_100180093 3300006237 Bacteria 1826
174 Ga0097621_101184891 3300006237 Bacteria 719
175 Ga0068871_101715650 3300006358 Unclassified 596
176 Ga0075428_100628055 3300006844 Unclassified 1146
177 Ga0075428_100949669 3300006844 Bacteria 911
178 Ga0075430_100169054 3300006846 Unclassified 1819
179 Ga0075431_100152408 3300006847 Bacteria 2380
180 Ga0075431_100172680 3300006847 Bacteria 2221
181 Ga0075431_101931864 3300006847 Unclassified 546
182 Ga0075433_10002145 3300006852 Bacteria 14947
183 Ga0075433_10317763 3300006852 Bacteria 1378
184 Ga0075434_100002497 3300006871 Bacteria 16213
185 Ga0075434_100011393 3300006871 Bacteria 8387
186 Ga0075434_100032505 3300006871 Bacteria 5144
187 Ga0075434_100278054 3300006871 Unclassified 1694
188 Ga0075434_100402482 3300006871 Unclassified 1390
189 Ga0075434_100627766 3300006871 Bacteria 1093
190 Ga0075434_100853358 3300006871 Bacteria 926
191 Ga0075429_100531177 3300006880 Unclassified 1031
192 Ga0068865_100106399 3300006881 Bacteria 2062
193 Ga0075436_100073073 3300006914 Bacteria 2373
194 Ga0075436_100102792 3300006914 Bacteria 1991
195 Ga0075436_100268186 3300006914 Unclassified 1219
196 Ga0097620_100184307 3300006931 Bacteria 2171
197 Ga0075435_100036145 3300007076 Bacteria 3923
198 Ga0075435_100092823 3300007076 Bacteria 2493
199 Ga0075435_100548945 3300007076 Bacteria 1001
200 Ga0075435_100590542 3300007076 Unclassified 963
201 Ga0099794_10161018 3300007265 Bacteria 1142
202 Ga0099795_10006448 3300007788 Bacteria 3203
203 Ga0099795_10243722 3300007788 Bacteria 773
204 Ga0099795_10297466 3300007788 Bacteria 709
205 Ga0105240_10051632 3300009093 Bacteria 5172
206 Ga0105240_10088315 3300009093 Bacteria 3794
207 Ga0105240_10166179 3300009093 Bacteria 2617
208 Ga0105240_10631758 3300009093 Bacteria 1176
209 Ga0105240_11019637 3300009093 Bacteria 884
210 Ga0105240_11406011 3300009093 Unclassified 733
211 Ga0111539_10144128 3300009094 Unclassified 2789
212 Ga0111539_10173266 3300009094 Bacteria 2521
213 Ga0111539_10370602 3300009094 Bacteria 1667
214 Ga0111539_10553599 3300009094 Bacteria 1340
215 Ga0111539_10675735 3300009094 Bacteria 1202
216 Ga0111539_10943030 3300009094 Unclassified 1003
217 Ga0105245_10250673 3300009098 Unclassified 1720
218 Ga0105247_10786240 3300009101 Bacteria 725
219 Ga0114129_10663775 3300009147 Unclassified 1344
220 Ga0114129_11051180 3300009147 Bacteria 1022
221 Ga0105243_10215451 3300009148 Unclassified 1694
222 Ga0105241_10115820 3300009174 Unclassified 2152
223 Ga0105241_10698552 3300009174 Bacteria 926
224 Ga0105241_10893483 3300009174 Bacteria 824
225 Ga0105241_10919079 3300009174 Bacteria 814
226 Ga0105242_10480320 3300009176 Bacteria 1178
227 Ga0105248_10799879 3300009177 Unclassified 1064
228 Ga0105248_11183504 3300009177 Bacteria 864
229 Ga0105248_12619600 3300009177 Bacteria 575
230 Ga0105237_10218512 3300009545 Unclassified 1906
231 Ga0105237_10573009 3300009545 Bacteria 1136
232 Ga0105237_11084276 3300009545 Bacteria 808
233 Ga0105238_10293747 3300009551 Bacteria 1608
234 Ga0105238_10878401 3300009551 Unclassified 914
235 Ga0105249_10062669 3300009553 Bacteria 3414
236 Ga0105249_10280782 3300009553 Bacteria 1663
237 Ga0105249_11335165 3300009553 Bacteria 789
238 Ga0099796_10295784 3300010159 Bacteria 685
239 Ga0105239_10048921 3300010375 Unclassified 4635
240 Ga0105239_11119622 3300010375 Bacteria 906
241 Ga0105246_10013668 3300011119 Bacteria 5094
242 Ga0105246_10224919 3300011119 Bacteria 1473
243 Ga0105246_10453781 3300011119 Bacteria 1078
244 Ga0157373_10509118 3300013100 Unclassified 870
245 Ga0157371_10155064 3300013102 Bacteria 1634
246 Ga0157371_10167231 3300013102 Bacteria 1571
247 Ga0157370_10027321 3300013104 Bacteria 5627
248 Ga0157370_10032626 3300013104 Bacteria 5084
249 Ga0157370_10072332 3300013104 Bacteria 3254
250 Ga0157370_10181126 3300013104 Unclassified 1958
251 Ga0157370_10839159 3300013104 Bacteria 835
252 Ga0157369_10050418 3300013105 Bacteria 4509
253 Ga0157369_10228072 3300013105 Bacteria 1948
254 Ga0157369_10327632 3300013105 Bacteria 1592
255 Ga0157369_11516386 3300013105 Bacteria 682
256 Ga0157374_10207110 3300013296 Unclassified 1922
257 Ga0157378_10034425 3300013297 Unclassified 4480
258 Ga0157378_10047931 3300013297 Bacteria 3799
259 Ga0157378_10149185 3300013297 Bacteria 2177
260 Ga0157378_10330275 3300013297 Bacteria 1484
261 Ga0163162_10084341 3300013306 Bacteria 3252
262 Ga0163162_10470502 3300013306 Bacteria 1388
263 Ga0163162_10665743 3300013306 Bacteria 1164
264 Ga0163162_11045831 3300013306 Bacteria 924
265 Ga0163162_11192868 3300013306 Bacteria 864
266 Ga0163162_11435603 3300013306 Bacteria 785
267 Ga0157372_10177244 3300013307 Bacteria 2467
268 Ga0157372_11700776 3300013307 Bacteria 726
269 Ga0157375_10125124 3300013308 Bacteria 2685
270 Ga0163163_10052057 3300014325 Bacteria 4038
271 Ga0163163_10434344 3300014325 Unclassified 1372
272 Ga0163163_11032143 3300014325 Bacteria 885
273 Ga0157380_10875333 3300014326 Bacteria 922
274 Ga0182008_10016665 3300014497 Bacteria 3816
275 Ga0157377_10512966 3300014745 Bacteria 840
276 Ga0157379_10382838 3300014968 Bacteria 1291
277 Ga0157379_12138648 3300014968 Unclassified 555
278 Ga0157376_10054061 3300014969 Unclassified 3346
279 Ga0163161_10120194 3300017792 Bacteria 1973
280 Ga0163161_10660971 3300017792 Bacteria 867
281 Ga0197907_10981873 3300020069 Unclassified 1068
282 Ga0197907_11482104 3300020069 Bacteria 605
283 Ga0206356_11064732 3300020070 Bacteria 1184
284 Ga0206356_11089989 3300020070 Unclassified 1094
285 Ga0206355_1275391 3300020076 Bacteria 793
286 Ga0206352_10872377 3300020078 Bacteria 557
287 Ga0206350_10936941 3300020080 Bacteria 805
288 Ga0206350_11009195 3300020080 Bacteria 615
289 Ga0206353_10521041 3300020082 Bacteria 608
290 Ga0213873_10023397 3300021358 Bacteria 1472
291 Ga0213873_10025919 3300021358 Unclassified 1420
292 Ga0213872_10356609 3300021361 Unclassified 599
293 Ga0213874_10065388 3300021377 Bacteria 1149
294 Ga0213876_10098173 3300021384 Bacteria 1552
295 Ga0213876_10107961 3300021384 Bacteria 1477
296 Ga0213875_10001005 3300021388 Bacteria 20058
297 Ga0213875_10017557 3300021388 Bacteria 3454
298 Ga0213875_10232180 3300021388 Unclassified 869
299 Ga0213875_10328147 3300021388 Bacteria 726
300 Ga0213871_10064375 3300021441 Bacteria 1026
301 Ga0213871_10104635 3300021441 Bacteria 832
302 Ga0224712_10093610 3300022467 Unclassified 1263
303 Ga0224712_10323931 3300022467 Bacteria 724
304 Ga0224712_10423511 3300022467 Bacteria 637
305 Ga0224712_10479571 3300022467 Bacteria 599
306 Ga0224712_10576516 3300022467 Bacteria 548
307 Ga0207697_10030991 3300025315 Bacteria 2189
308 Ga0207697_10093693 3300025315 Unclassified 1274
309 Ga0207682_10053192 3300025893 Unclassified 1679
310 Ga0207692_10324812 3300025898 Bacteria 943
311 Ga0207692_10371836 3300025898 Bacteria 885
312 Ga0207642_10271696 3300025899 Bacteria 971
313 Ga0207642_10384775 3300025899 Unclassified 836
314 Ga0207688_10001647 3300025901 Bacteria 11800
315 Ga0207680_10210763 3300025903 Unclassified 1328
316 Ga0207680_11011930 3300025903 Unclassified 595
317 Ga0207647_10100540 3300025904 Bacteria 1716
318 Ga0207647_10271074 3300025904 Bacteria 970
319 Ga0207699_10067702 3300025906 Bacteria 2172
320 Ga0207699_10261732 3300025906 Unclassified 1196
321 Ga0207645_10000665 3300025907 Bacteria 28520
322 Ga0207705_10076065 3300025909 Unclassified 2440
323 Ga0207705_10907991 3300025909 Bacteria 682
324 Ga0207684_10083893 3300025910 Bacteria 2713
325 Ga0207684_10219399 3300025910 Bacteria 1641
326 Ga0207654_10397741 3300025911 Bacteria 957
327 Ga0207707_10009330 3300025912 Bacteria 8508
328 Ga0207707_10026955 3300025912 Bacteria 5022
329 Ga0207707_10103105 3300025912 Unclassified 2494
330 Ga0207707_10125490 3300025912 Bacteria 2245
331 Ga0207707_10149818 3300025912 Unclassified 2040
332 Ga0207707_10343489 3300025912 Bacteria 1287
333 Ga0207707_10462920 3300025912 Bacteria 1084
334 Ga0207707_10710419 3300025912 Unclassified 843
335 Ga0207695_10074547 3300025913 Bacteria 3455
336 Ga0207695_10384051 3300025913 Bacteria 1290
337 Ga0207695_10447013 3300025913 Bacteria 1176
338 Ga0207695_10518914 3300025913 Bacteria 1073
339 Ga0207695_11543845 3300025913 Bacteria 544
340 Ga0207671_10534312 3300025914 Unclassified 935
341 Ga0207693_10003546 3300025915 Bacteria 13329
342 Ga0207693_10248339 3300025915 Bacteria 1396
343 Ga0207693_11012413 3300025915 Bacteria 634
344 Ga0207663_10027943 3300025916 Bacteria 3295
345 Ga0207663_10061491 3300025916 Bacteria 2383
346 Ga0207663_10394356 3300025916 Unclassified 1057
347 Ga0207660_10026629 3300025917 Bacteria 3938
348 Ga0207660_10387159 3300025917 Unclassified 1124
349 Ga0207660_10531762 3300025917 Bacteria 955
350 Ga0207662_10285311 3300025918 Unclassified 1094
351 Ga0207657_10030265 3300025919 Unclassified 4915
352 Ga0207657_10468294 3300025919 Unclassified 988
353 Ga0207649_10051588 3300025920 Bacteria 2548
354 Ga0207649_10052250 3300025920 Bacteria 2535
355 Ga0207652_10009020 3300025921 Bacteria 8036
356 Ga0207652_10106988 3300025921 Bacteria 2476
357 Ga0207652_10129264 3300025921 Bacteria 2252
358 Ga0207652_10284636 3300025921 Bacteria 1491
359 Ga0207652_10288920 3300025921 Unclassified 1479
360 Ga0207646_10647840 3300025922 Bacteria 946
361 Ga0207646_10649514 3300025922 Bacteria 945
362 Ga0207681_10183742 3300025923 Unclassified 1594
363 Ga0207694_11250222 3300025924 Unclassified 628
364 Ga0207650_10004361 3300025925 Bacteria 9664
365 Ga0207650_10056046 3300025925 Bacteria 2928
366 Ga0207659_10384990 3300025926 Unclassified 1170
367 Ga0207687_10258293 3300025927 Bacteria 1388
368 Ga0207700_10024739 3300025928 Bacteria 4160
369 Ga0207700_10068486 3300025928 Bacteria 2721
370 Ga0207700_10156580 3300025928 Bacteria 1888
371 Ga0207700_10584865 3300025928 Bacteria 993
372 Ga0207700_10918264 3300025928 Bacteria 784
373 Ga0207700_11313970 3300025928 Bacteria 644
374 Ga0207664_10025166 3300025929 Bacteria 4479
375 Ga0207664_10181886 3300025929 Bacteria 1805
376 Ga0207664_11252778 3300025929 Bacteria 660
377 Ga0207644_10273826 3300025931 Unclassified 1353
378 Ga0207690_10315536 3300025932 Unclassified 1227
379 Ga0207706_10036452 3300025933 Bacteria 4368
380 Ga0207706_10283341 3300025933 Bacteria 1445
381 Ga0207670_10129128 3300025936 Bacteria 1849
382 Ga0207670_10282416 3300025936 Bacteria 1294
383 Ga0207670_10996614 3300025936 Bacteria 705
384 Ga0207669_10217907 3300025937 Bacteria 1398
385 Ga0207665_10165395 3300025939 Bacteria 1594
386 Ga0207665_10314774 3300025939 Bacteria 1173
387 Ga0207691_10001474 3300025940 Bacteria 23476
388 Ga0207691_10781204 3300025940 Bacteria 803
389 Ga0207689_10025031 3300025942 Bacteria 5003
390 Ga0207661_10256785 3300025944 Bacteria 1555
391 Ga0207661_10575607 3300025944 Unclassified 1033
392 Ga0207661_10886455 3300025944 Bacteria 822
393 Ga0207679_10011173 3300025945 Bacteria 5801
394 Ga0207679_10584700 3300025945 Bacteria 1005
395 Ga0207679_10976501 3300025945 Bacteria 776
396 Ga0207667_10103756 3300025949 Unclassified 2932
397 Ga0207667_10406281 3300025949 Bacteria 1386
398 Ga0207667_10689032 3300025949 Bacteria 1025
399 Ga0207667_11258541 3300025949 Bacteria 717
400 Ga0207651_10129010 3300025960 Bacteria 1932
401 Ga0207651_10208131 3300025960 Unclassified 1572
402 Ga0207651_10851478 3300025960 Bacteria 810
403 Ga0207712_10318624 3300025961 Unclassified 1282
404 Ga0207658_10441908 3300025986 Bacteria 1150
405 Ga0207677_10370862 3300026023 Unclassified 1205
406 Ga0207703_10381727 3300026035 Bacteria 1303
407 Ga0207639_10453363 3300026041 Unclassified 1165
408 Ga0207678_10035816 3300026067 Bacteria 4321
409 Ga0207708_10274914 3300026075 Unclassified 1363
410 Ga0207708_10603484 3300026075 Unclassified 930
411 Ga0207702_10033806 3300026078 Bacteria 4273
412 Ga0207702_10075627 3300026078 Unclassified 2909
413 Ga0207702_10317557 3300026078 Bacteria 1483
414 Ga0207702_10910955 3300026078 Bacteria 871
415 Ga0207648_10013103 3300026089 Bacteria 7731
416 Ga0207648_10231846 3300026089 Unclassified 1642
417 Ga0207676_10751783 3300026095 Unclassified 948
418 Ga0207674_10179458 3300026116 Bacteria 2069
419 Ga0207674_10269560 3300026116 Bacteria 1650
420 Ga0207674_10343608 3300026116 Unclassified 1443
421 Ga0207683_10001563 3300026121 Bacteria 20604
422 Ga0207683_10045547 3300026121 Bacteria 3836
423 Ga0207698_10576266 3300026142 Bacteria 1107
424 Ga0209984_1029552 3300027424 Bacteria 772
425 Ga0209179_1034269 3300027512 Bacteria 1052
426 Ga0210002_1000936 3300027617 Bacteria 4023
427 Ga0209971_1008182 3300027682 Unclassified 2481
428 Ga0209966_1003306 3300027695 Bacteria 2709
429 Ga0209974_10000574 3300027876 Bacteria 12277
430 Ga0268266_10679205 3300028379 Bacteria 992
431 Ga0268265_10668493 3300028380 Unclassified 1000
432 Ga0268264_10052164 3300028381 Bacteria 3410
433 Ga0268264_10344902 3300028381 Unclassified 1416
434 Ga0268264_11096370 3300028381 Bacteria 804
435 Ga0265338_10004828 3300028800 Bacteria 18005
436 Ga0265324_10087107 3300029957 Bacteria 1062
437 Ga0265325_10003410 3300031241 Bacteria 10388
438 Ga0265325_10346819 3300031241 Bacteria 656
439 Ga0265339_10000269 3300031249 Bacteria 41988
440 Ga0265313_10001274 3300031595 Bacteria 23880
441 Ga0265313_10362438 3300031595 Bacteria 573
442 Ga0265342_10038800 3300031712 Bacteria 2899
443 Ga0307405_10163208 3300031731 Bacteria 1581
444 Ga0316053_111185 3300032120 Bacteria 631
445 Ga0373926_0013111 3300035083 Bacteria 2808
446 Ga0373940_0032842 3300035088 Bacteria 1393
447 Ga0373944_0059953 3300035089 Unclassified 1219
448 Ga0373923_0192213 3300035111 Unclassified 941
449 Ga0373932_0051460 3300035112 Bacteria 1224
450 Ga0373932_0254474 3300035112 Bacteria 642
451 Ga0373936_0024625 3300035113 Bacteria 2351
452 Ga0373936_0184477 3300035113 Unclassified 916
453 Ga0373945_0067720 3300035116 Unclassified 1345
454 Ga0373953_0044310 3300035117 Unclassified 1778
455 Ga0373954_0046862 3300035118 Bacteria 2021
456 Ga0373954_0201795 3300035118 Unclassified 977
457 Ga0373956_0039984 3300035119 Unclassified 2079
458 Ga0373957_0029106 3300035120 Unclassified 2016
459 Ga0373943_0176668 3300035170 Bacteria 1171
460 Ga0373946_0145580 3300035171 Bacteria 1102
461 Ga0373955_0064515 3300035172 Unclassified 2030
462 Ga0373931_0083593 3300035691 Bacteria 1766
463 Ga0373931_0095945 3300035691 Bacteria 1660
464 Ga0373931_0234453 3300035691 Unclassified 1110
465 Ga0373931_0490566 3300035691 Bacteria 791
466 Ga0373931_0498105 3300035691 Unclassified 785
467 Ga0373931_0529672 3300035691 Bacteria 763
468 Ga0373935_0033347 3300035692 Bacteria 3203
469 Ga0373927_0194610 3300035695 Unclassified 1330
470 Ga0373933_0158293 3300035724 Unclassified 1437
471 Ga0373947_0020812 3300035725 Bacteria 3791
472 Ga0373947_0215193 3300035725 Unclassified 1261
473 Ga0373947_0285647 3300035725 Unclassified 1097
474 Ga0373947_0420661 3300035725 Bacteria 903
475 Ga0373937_0009912 3300036401 Bacteria 8307
476 Ga0373937_0012026 3300036401 Bacteria 7596
477 Ga0373937_0090950 3300036401 Bacteria 2827
478 Ga0373937_0106047 3300036401 Bacteria 2612
479 Ga0373937_0635677 3300036401 Unclassified 1012
480 Ga0373937_1478562 3300036401 Unclassified 627
481 Ga0373925_0027027 3300037068 Bacteria 4201
482 Ga0373925_0046734 3300037068 Bacteria 3220
483 Ga0373925_0324145 3300037068 Unclassified 1247
484 Ga0395899_0005717 3300037312 Bacteria 9651
485 Ga0395899_0006224 3300037312 Bacteria 9250
486 Ga0395899_0071003 3300037312 Bacteria 2548
487 Ga0395899_0503723 3300037312 Bacteria 785
488 Ga0395900_0005139 3300037418 Bacteria 13740
489 Ga0395900_0029412 3300037418 Bacteria 5636
490 Ga0395900_0031185 3300037418 Bacteria 5475
491 Ga0395900_0031609 3300037418 Bacteria 5441
492 Ga0395900_0032993 3300037418 Bacteria 5328
493 Ga0395900_1416257 3300037418 Unclassified 608
494 Ga0395898_0152652 3300037466 Bacteria 2209
495 Ga0395898_0272051 3300037466 Bacteria 1616
496 Ga0395898_0482362 3300037466 Unclassified 1179
497 Ga0436364_0185080 3300037853 Bacteria 45009
498 Ga0436364_0446735 3300037853 Bacteria 53239
499 Ga0436364_0987220 3300037853 Bacteria 1215
500 Ga0436364_1106406 3300037853 Bacteria 1452
501 Ga0436364_1119624 3300037853 Bacteria 872
502 Ga0436364_1378638 3300037853 Bacteria 1640
503 Ga0436364_1429863 3300037853 Bacteria 609
504 Ga0436364_1536912 3300037853 Bacteria 785
505 Ga0395901_0006392 3300038443 Bacteria 11938
506 Ga0395901_0018024 3300038443 Bacteria 7206
507 Ga0395901_0171512 3300038443 Bacteria 2276
508 Ga0395901_0505052 3300038443 Unclassified 1230
509 Ga0436365_0316452 3300039437 Bacteria 896
510 Ga0436365_0386354 3300039437 Bacteria 1107
511 Ga0436365_0427202 3300039437 Bacteria 2156
512 Ga0436365_0491202 3300039437 Bacteria 1906
513 Ga0436360_0094206 3300039438 Bacteria 2160
514 Ga0436360_0197578 3300039438 Bacteria 4971
515 Ga0436360_0353587 3300039438 Bacteria 953
516 Ga0436360_0409801 3300039438 Unclassified 1301
517 Ga0436360_0458025 3300039438 Bacteria 726
518 Ga0436360_0502023 3300039438 Bacteria 965
519 Ga0436360_0645967 3300039438 Bacteria 752
520 Ga0436360_0650613 3300039438 Bacteria 891
521 Ga0436360_0838073 3300039438 Bacteria 737
522 Ga0436360_0891236 3300039438 Bacteria 1761
523 Ga0436360_0946168 3300039438 Bacteria 802
524 Ga0436360_1098357 3300039438 Bacteria 2044
525 Ga0436360_1099895 3300039438 Bacteria 1332
526 Ga0436360_1288869 3300039438 Bacteria 565
527 Ga0436361_0032059 3300039447 Unclassified 1946
528 Ga0436361_0044284 3300039447 Unclassified 1349
529 Ga0436361_0054550 3300039447 Bacteria 885
530 Ga0436361_0057748 3300039447 Bacteria 1745
531 Ga0436361_0414279 3300039447 Bacteria 6141
532 Ga0436361_0716295 3300039447 Bacteria 1146
533 Ga0436361_0858019 3300039447 Bacteria 2085
534 Ga0436363_0032915 3300039450 Bacteria 687
535 Ga0436363_0546388 3300039450 Unclassified 2417
536 Ga0436363_0683246 3300039450 Bacteria 4951
537 Ga0436362_0110530 3300039453 Bacteria 617
538 Ga0436362_0130052 3300039453 Bacteria 2107
539 Ga0436362_0161717 3300039453 Bacteria 2045
540 Ga0436362_0753708 3300039453 Bacteria 707
541 Ga0436362_0768247 3300039453 Unclassified 869
542 Ga0436362_0881846 3300039453 Bacteria 578
543 Ga0436362_0938976 3300039453 Bacteria 2440
544 Ga0436362_1141627 3300039453 Bacteria 7257
545 Ga0436362_1303193 3300039453 Unclassified 678
546 Ga0451577_0969163 3300042876 Bacteria 764
547 Ga0451577_1542239 3300042876 Bacteria 587
548 Ga0466963_0315932 3300044694 Bacteria 1099
549 Ga0466963_0413175 3300044694 Bacteria 952
550 Ga0466964_0532540 3300044706 Bacteria 635
551 Ga0453684_0406030 3300044712 Bacteria 1525
552 Ga0453684_0912933 3300044712 Bacteria 940
553 Ga0466968_0424703 3300044735 Bacteria 654
554 Ga0466957_0140029 3300044842 Bacteria 1558
555 Ga0451576_0223428 3300045051 Bacteria 1966
556 Ga0451576_0600619 3300045051 Unclassified 1157
557 Ga0451576_0910682 3300045051 Bacteria 922
558 Ga0466967_0064938 3300045976 Bacteria 3247
559 Ga0466967_0522930 3300045976 Bacteria 1166
560 Ga0466967_0736598 3300045976 Unclassified 977
561 Ga0466967_1070005 3300045976 Bacteria 803
562 Ga0495629_0222556 3300046459 Bacteria 1302
563 Ga0495651_0551742 3300046462 Bacteria 732
564 Ga0495651_0638106 3300046462 Unclassified 669
565 Ga0495653_0174120 3300046463 Unclassified 1482
566 Ga0495580_0167594 3300046472 Bacteria 1519
567 Ga0495594_0206822 3300046499 Bacteria 1119
568 Ga0495618_0796074 3300046514 Unclassified 551
569 Ga0495628_0146500 3300046516 Unclassified 1800
570 Ga0495628_0310959 3300046516 Bacteria 1165
571 Ga0495644_0435729 3300046523 Unclassified 521
572 Ga0495652_0247445 3300046529 Unclassified 1323
573 Ga0495640_0130790 3300046533 Unclassified 1625
574 Ga0495640_0549739 3300046533 Bacteria 700
575 Ga0495634_0211550 3300046642 Bacteria 1200
576 Ga0495634_0617419 3300046642 Unclassified 628
577 Ga0495635_0098722 3300046663 Bacteria 1996
578 Ga0495635_0605464 3300046663 Bacteria 715
579 Ga0495599_0243488 3300046678 Bacteria 1096
580 Ga0495600_0315917 3300046809 Bacteria 983
581 Ga0495600_0414470 3300046809 Bacteria 837
582 Ga0495674_0703056 3300047319 Bacteria 793
583 Ga0495684_0092862 3300047471 Bacteria 2286
584 Ga0495684_0116653 3300047471 Bacteria 2013
585 Ga0495684_0341928 3300047471 Bacteria 1065
586 Ga0495602_0136395 3300048088 Bacteria 1949
587 Ga0496102_0087516 3300048905 Bacteria 2878
588 Ga0496103_0316000 3300048906 Unclassified 1005
589 Ga0496104_0264386 3300048907 Bacteria 1633
590 Ga0496108_0075389 3300048911 Bacteria 2850
591 Ga0496108_0789196 3300048911 Unclassified 820
592 Ga0496109_0516875 3300048912 Bacteria 1127
593 Ga0496109_0585581 3300048912 Bacteria 1051
594 Ga0496112_0001187 3300048915 Bacteria 19533
595 Ga0496112_0109097 3300048915 Bacteria 2738
596 Ga0496112_0171107 3300048915 Unclassified 2137
597 Ga0496112_1060535 3300048915 Bacteria 729
598 Ga0496113_0065479 3300048916 Unclassified 2751
599 Ga0496113_0072651 3300048916 Bacteria 2619
600 Ga0496113_0382740 3300048916 Unclassified 1129
601 Ga0496126_0801245 3300048929 Bacteria 723
602 Ga0501033_0207706 3300049570 Unclassified 1397
603 Ga0501033_0398220 3300049570 Bacteria 960
604 Ga0501034_0194528 3300049571 Unclassified 1989
605 Ga0501034_0359054 3300049571 Bacteria 1384
606 Ga0501034_1005852 3300049571 Bacteria 717
607 Ga0501036_0007120 3300049572 Bacteria 9102
608 Ga0501036_0358134 3300049572 Unclassified 1218
609 Ga0501036_0408047 3300049572 Bacteria 1133
610 Ga0501037_0083899 3300049573 Bacteria 2308
611 Ga0501038_0012324 3300049574 Bacteria 7810
612 Ga0501038_0029552 3300049574 Bacteria 4855
613 Ga0501038_0399460 3300049574 Bacteria 1063
614 Ga0501039_0020415 3300049575 Bacteria 5077
615 Ga0501039_0028248 3300049575 Bacteria 4317
616 Ga0501039_0107803 3300049575 Unclassified 2177
617 Ga0501040_0002063 3300049576 Bacteria 12955
618 Ga0501041_0020237 3300049577 Bacteria 3976
619 Ga0501041_0749992 3300049577 Unclassified 625
620 Ga0501042_0003182 3300049578 Bacteria 10243
621 Ga0501042_0519808 3300049578 Bacteria 865
622 Ga0501043_0081393 3300049579 Unclassified 2544
623 Ga0501043_0195222 3300049579 Bacteria 1573
624 Ga0501043_0347448 3300049579 Bacteria 1127
625 Ga0501043_0389870 3300049579 Bacteria 1053
626 Ga0501046_0022284 3300049580 Bacteria 5218
627 Ga0501046_0115750 3300049580 Bacteria 2044
628 Ga0501046_0375276 3300049580 Unclassified 1030
629 Ga0501047_0052388 3300049581 Bacteria 3945
630 Ga0501047_0091636 3300049581 Bacteria 2918
631 Ga0501047_0138309 3300049581 Bacteria 2315
632 Ga0501047_0247737 3300049581 Bacteria 1631
633 Ga0501047_0324030 3300049581 Bacteria 1380
634 Ga0501047_0574452 3300049581 Bacteria 950
635 Ga0501047_1072407 3300049581 Archaea 619
636 Ga0501048_0002751 3300049582 Bacteria 13415
637 Ga0501048_0035516 3300049582 Unclassified 3588
638 Ga0501048_0060544 3300049582 Bacteria 2683
639 Ga0501048_0205513 3300049582 Bacteria 1397
640 Ga0501048_0318539 3300049582 Bacteria 1108
641 Ga0501068_0498804 3300049584 Bacteria 790
642 Ga0501069_0003306 3300049585 Bacteria 8273
643 Ga0501069_0244570 3300049585 Bacteria 1046
644 Ga0501070_0008646 3300049586 Bacteria 8605
645 Ga0501070_0060438 3300049586 Bacteria 3141
646 Ga0501070_0109465 3300049586 Bacteria 2283
647 Ga0501070_0984550 3300049586 Unclassified 654
648 Ga0501071_0000158 3300049587 Bacteria 28869
649 Ga0501072_0001877 3300049588 Bacteria 15641
650 Ga0501072_0058288 3300049588 Bacteria 3044
651 Ga0501072_0127896 3300049588 Bacteria 2024
652 Ga0501073_0220833 3300049589 Bacteria 1309
653 Ga0501073_0727191 3300049589 Unclassified 685
654 Ga0501074_0066386 3300049590 Unclassified 2595
655 Ga0501074_0234010 3300049590 Bacteria 1308
656 Ga0501074_0426548 3300049590 Unclassified 940
657 Ga0501074_0456449 3300049590 Bacteria 906
658 Ga0501074_0505771 3300049590 Bacteria 856
659 Ga0501075_0000210 3300049591 Bacteria 31070
660 Ga0501075_0162425 3300049591 Bacteria 1704
661 Ga0501075_0579316 3300049591 Bacteria 856
662 Ga0501076_0000278 3300049592 Bacteria 31876
663 Ga0501076_1203403 3300049592 Bacteria 623
664 Ga0501077_0000232 3300049593 Bacteria 32893
665 Ga0501079_0034701 3300049741 Bacteria 3881
666 Ga0501079_0051431 3300049741 Unclassified 3181
667 Ga0501079_1085517 3300049741 Unclassified 631
668 Ga0501080_0008286 3300049742 Bacteria 9417
669 Ga0501080_0105003 3300049742 Bacteria 2619
670 Ga0501080_0193695 3300049742 Bacteria 1867
671 Ga0501080_0436443 3300049742 Bacteria 1175
672 Ga0501080_0953670 3300049742 Unclassified 746
673 Ga0501080_1025761 3300049742 Unclassified 715
674 Ga0501080_1162384 3300049742 Bacteria 665
675 Ga0501081_0000478 3300049743 Bacteria 22251
676 Ga0501081_0023101 3300049743 Bacteria 4166
677 Ga0501083_0027089 3300049744 Bacteria 3957
678 Ga0501083_0257509 3300049744 Unclassified 1135
679 Ga0501083_0368851 3300049744 Bacteria 934
680 Ga0501035_0060812 3300049822 Bacteria 3363
681 Ga0501035_0580516 3300049822 Bacteria 915
682 Ga0501044_0000173 3300049823 Bacteria 79909
683 Ga0501044_0144801 3300049823 Bacteria 2362
684 Ga0501044_0149263 3300049823 Bacteria 2321
685 Ga0501044_0244415 3300049823 Bacteria 1738
686 Ga0501044_1138017 3300049823 Unclassified 649
687 Ga0501044_1264886 3300049823 Bacteria 605
688 Ga0501045_0001482 3300049824 Bacteria 15604
689 nmdc:mga05p37_18943_c1 3300050507 Bacteria 8323
690 nmdc:mga06r32_1364579_c1 3300050510 Unclassified 651
691 nmdc:mga06r32_161069_c1 3300050510 Bacteria 2226
692 nmdc:mga06r32_409064_c1 3300050510 Unclassified 1338
693 nmdc:mga08y16_150188_c1 3300050511 Bacteria 2422
694 nmdc:mga08y16_688809_c1 3300050511 Unclassified 1023
695 nmdc:mga0n895_2250_c1 3300050512 Bacteria 14957
696 nmdc:mga0n895_2726_c1 3300050512 Bacteria 13932
697 nmdc:mga0n895_41842_c1 3300050512 Bacteria 4456
698 nmdc:mga0n895_756309_c1 3300050512 Unclassified 965
699 nmdc:mga0n895_780334_c1 3300050512 Bacteria 947
700 nmdc:mga0n895_91031_c1 3300050512 Unclassified 3052
701 nmdc:mga0rr50_107361_c1 3300050513 Bacteria 2204
702 nmdc:mga0rr50_550899_c1 3300050513 Unclassified 982
703 nmdc:mga08x19_179937_c1 3300050514 Bacteria 1443
704 nmdc:mga08x19_359377_c1 3300050514 Bacteria 1018
705 nmdc:mga08x19_5419_c2 3300050514 Bacteria 976
706 nmdc:mga0a205_26798_c1 3300050515 Bacteria 5500
707 nmdc:mga0a205_37865_c1 3300050515 Bacteria 4638
708 nmdc:mga0a205_684969_c1 3300050515 Unclassified 875
709 nmdc:mga0a205_77206_c2 3300050515 Bacteria 2266
710 Ga0495601_0011260 3300053077 Bacteria 5345
711 Ga0495601_0020713 3300053077 Bacteria 4018
712 Ga0495601_0337193 3300053077 Bacteria 981
713 Ga0495595_0002839 3300053084 Bacteria 6817
714 Ga0495619_0037089 3300053085 Bacteria 3175
715 Ga0495619_0042479 3300053085 Bacteria 2977
716 Ga0495619_0234534 3300053085 Unclassified 1271
717 Ga0495619_0239371 3300053085 Unclassified 1258
718 Ga0500595_118094 3300053119 Bacteria 751
719 Ga0501084_0069166 3300054114 Unclassified 2955
720 Ga0501084_0187041 3300054114 Unclassified 1748
721 Ga0501084_1006113 3300054114 Unclassified 700
722 Ga0587070_053073 3300059491 Unclassified 815
723 Ga0587085_109672 3300059506 Bacteria 593
724 Ga0587091_084522 3300059511 Bacteria 718
725 Ga0501082_0031459 3300060353 Bacteria 4576
726 Ga0501082_0234341 3300060353 Bacteria 1598
727 Ga0501082_0248420 3300060353 Bacteria 1548
728 Ga0530510_0002585 3300061734 Bacteria 12433
729 Ga0530510_0074024 3300061734 Bacteria 2473
730 Ga0530510_0367950 3300061734 Unclassified 1081
731 Ga0530510_0802319 3300061734 Unclassified 718
732 Ga0501070_0042502
733 JGI25406J46586_10004491
734 Ga0058862_10001543
735 Ga0065714_10138008
736 Ga0065712_10000161
737 Ga0065712_10126453
738 Ga0065715_10002397
739 Ga0065715_10009377
740 Ga0065707_10247051
741 Ga0070658_10451423
742 Ga0070676_10004921
743 Ga0070683_100793715
744 Ga0070690_100018565
745 Ga0070690_100320460
746 Ga0070670_100000611
747 Ga0070670_100156603
748 Ga0070677_10019792
749 Ga0068869_100066289
750 Ga0070666_10055281
751 Ga0070666_10284450
752 Ga0070680_100004460
753 Ga0070680_100031322
754 Ga0070680_100053500
755 Ga0070680_100401330
756 Ga0070680_100626282
757 Ga0070680_100955265
758 Ga0070680_101220327
759 Ga0070682_100071064
760 Ga0068868_100030967
761 Ga0070660_100176581
762 Ga0070689_100079524
763 Ga0070689_100412826
764 Ga0070691_10044291
765 Ga0070691_10063895
766 Ga0070687_100222397
767 Ga0070661_100141453
768 Ga0070661_100260926
769 Ga0070692_10506603
770 Ga0070692_10583690
771 Ga0070669_100069079
772 Ga0070675_100133109
773 Ga0070671_100066312
774 Ga0070674_100078636
775 Ga0070674_101144265
776 Ga0070673_100024014
777 Ga0070673_100151887
778 Ga0070673_101022766
779 Ga0070688_100059766
780 Ga0070659_100037236
781 Ga0070659_100048394
782 Ga0070667_100137663
783 Ga0070667_101243362
784 Ga0070667_101330650
785 Ga0070709_10024351
786 Ga0070709_10115764
787 Ga0070714_100061561
788 Ga0070714_100218257
789 Ga0070714_100353028
790 Ga0070714_100359697
791 Ga0070714_100731373
792 Ga0070713_100067769
793 Ga0070713_100077645
794 Ga0070713_100255294
795 Ga0070713_100494594
796 Ga0070710_10003156
797 Ga0070710_10023819
798 Ga0070710_10429871
799 Ga0070711_100086788
800 Ga0070711_100317022
801 Ga0070711_100507767
802 Ga0070711_100662776
803 Ga0070705_100013941
804 Ga0070705_100220043
805 Ga0070700_100232771
806 Ga0070700_100332630
807 Ga0070700_100716931
808 Ga0070694_100073149
809 Ga0070694_100295868
810 Ga0070694_100318608
811 Ga0070694_100632353
812 Ga0070708_100254941
813 Ga0070663_100020480
814 Ga0070678_100039105
815 Ga0070678_100363666
816 Ga0070662_100179839
817 Ga0070662_100253171
818 Ga0070681_10003972
819 Ga0070681_10007797
820 Ga0070681_10009896
821 Ga0070681_10058222
822 Ga0070681_10082655
823 Ga0070681_10884854
824 Ga0068867_100194627
825 Ga0068867_101010122
826 Ga0070706_100275990
827 Ga0070706_100278809
828 Ga0070707_100728302
829 Ga0070698_100501381
830 Ga0070698_101001900
831 Ga0070699_100109530
832 Ga0070699_100552919
833 Ga0070699_100626976
834 Ga0070679_100005562
835 Ga0070679_100058290
836 Ga0070679_100060576
837 Ga0070679_100148161
838 Ga0070684_100079334
839 Ga0070684_100091144
840 Ga0070697_100058232
841 Ga0070697_100391952
842 Ga0070697_100825737
843 Ga0068853_100257246
844 Ga0070672_100001632
845 Ga0070686_100058156
846 Ga0070686_101205924
847 Ga0070695_100014670
848 Ga0070695_100015040
849 Ga0070695_100578270
850 Ga0070695_100698540
851 Ga0070696_100022644
852 Ga0070696_100048551
853 Ga0070696_100119610
854 Ga0070696_100605329
855 Ga0070693_100093605
856 Ga0070693_100215148
857 Ga0070665_100573665
858 Ga0070704_100150305
859 Ga0070704_100393339
860 Ga0070704_100878426
861 Ga0068855_100053393
862 Ga0068855_100166268
863 Ga0068855_100384323
864 Ga0070664_100004308
865 Ga0070664_100065384
866 Ga0070664_100403057
867 Ga0070664_100429775
868 Ga0070664_101090314
869 Ga0068857_100033080
870 Ga0068857_100135526
871 Ga0068857_100136648
872 Ga0068854_100231290
873 Ga0068856_100118477
874 Ga0068856_100310452
875 Ga0068856_100336259
876 Ga0068856_100985059
877 Ga0070702_100071436
878 Ga0070702_101210255
879 Ga0068852_100310188
880 Ga0068852_100391080
881 Ga0068859_100184316
882 Ga0068864_100332802
883 Ga0068864_101841082
884 Ga0068866_10307708
885 Ga0068866_10471687
886 Ga0068866_10654110
887 Ga0068863_100492708
888 Ga0068858_100019185
889 Ga0068860_100025336
890 Ga0068860_100121016
891 Ga0068860_100687900
892 Ga0068862_100221260
893 Ga0068862_100365561
894 Ga0081455_10000599
895 Ga0081455_10001044
896 Ga0081455_10174134
897 Ga0081455_10699393
898 Ga0081539_10000025
899 Ga0070717_10010359
900 Ga0070717_10293721
901 Ga0070717_10295192
902 Ga0070712_100040351
903 Ga0070712_100101850
904 Ga0097621_100180093
905 Ga0097621_101184891
906 Ga0068871_101715650
907 Ga0075428_100628055
908 Ga0075428_100949669
909 Ga0075430_100169054
910 Ga0075431_100152408
911 Ga0075431_100172680
912 Ga0075431_101931864
913 Ga0075433_10002145
914 Ga0075433_10317763
915 Ga0075434_100002497
916 Ga0075434_100011393
917 Ga0075434_100032505
918 Ga0075434_100278054
919 Ga0075434_100402482
920 Ga0075434_100627766
921 Ga0075434_100853358
922 Ga0075429_100531177
923 Ga0068865_100106399
924 Ga0075436_100073073
925 Ga0075436_100102792
926 Ga0075436_100268186
927 Ga0097620_100184307
928 Ga0075435_100036145
929 Ga0075435_100092823
930 Ga0075435_100548945
931 Ga0075435_100590542
932 Ga0099794_10161018
933 Ga0099795_10006448
934 Ga0099795_10243722
935 Ga0099795_10297466
936 Ga0105240_10051632
937 Ga0105240_10088315
938 Ga0105240_10166179
939 Ga0105240_10631758
940 Ga0105240_11019637
941 Ga0105240_11406011
942 Ga0111539_10144128
943 Ga0111539_10173266
944 Ga0111539_10370602
945 Ga0111539_10553599
946 Ga0111539_10675735
947 Ga0111539_10943030
948 Ga0105245_10250673
949 Ga0105247_10786240
950 Ga0114129_10663775
951 Ga0114129_11051180
952 Ga0105243_10215451
953 Ga0105241_10115820
954 Ga0105241_10698552
955 Ga0105241_10893483
956 Ga0105241_10919079
957 Ga0105242_10480320
958 Ga0105248_10799879
959 Ga0105248_11183504
960 Ga0105248_12619600
961 Ga0105237_10218512
962 Ga0105237_10573009
963 Ga0105237_11084276
964 Ga0105238_10293747
965 Ga0105238_10878401
966 Ga0105249_10062669
967 Ga0105249_10280782
968 Ga0105249_11335165
969 Ga0099796_10295784
970 Ga0105239_10048921
971 Ga0105239_11119622
972 Ga0105246_10013668
973 Ga0105246_10224919
974 Ga0105246_10453781
975 Ga0157373_10509118
976 Ga0157371_10155064
977 Ga0157371_10167231
978 Ga0157370_10027321
979 Ga0157370_10032626
980 Ga0157370_10072332
981 Ga0157370_10181126
982 Ga0157370_10839159
983 Ga0157369_10050418
984 Ga0157369_10228072
985 Ga0157369_10327632
986 Ga0157369_11516386
987 Ga0157374_10207110
988 Ga0157378_10034425
989 Ga0157378_10047931
990 Ga0157378_10149185
991 Ga0157378_10330275
992 Ga0163162_10084341
993 Ga0163162_10470502
994 Ga0163162_10665743
995 Ga0163162_11045831
996 Ga0163162_11192868
997 Ga0163162_11435603
998 Ga0157372_10177244
999 Ga0157372_11700776
1000 Ga0157375_10125124
1001 Ga0163163_10052057
1002 Ga0163163_10434344
1003 Ga0163163_11032143
1004 Ga0157380_10875333
1005 Ga0182008_10016665
1006 Ga0157377_10512966
1007 Ga0157379_10382838
1008 Ga0157379_12138648
1009 Ga0157376_10054061
1010 Ga0163161_10120194
1011 Ga0163161_10660971
1012 Ga0197907_10981873
1013 Ga0197907_11482104
1014 Ga0206356_11064732
1015 Ga0206356_11089989
1016 Ga0206355_1275391
1017 Ga0206352_10872377
1018 Ga0206350_10936941
1019 Ga0206350_11009195
1020 Ga0206353_10521041
1021 Ga0213873_10023397
1022 Ga0213873_10025919
1023 Ga0213872_10356609
1024 Ga0213874_10065388
1025 Ga0213876_10098173
1026 Ga0213876_10107961
1027 Ga0213875_10001005
1028 Ga0213875_10017557
1029 Ga0213875_10232180
1030 Ga0213875_10328147
1031 Ga0213871_10064375
1032 Ga0213871_10104635
1033 Ga0224712_10093610
1034 Ga0224712_10323931
1035 Ga0224712_10423511
1036 Ga0224712_10479571
1037 Ga0224712_10576516
1038 Ga0207697_10030991
1039 Ga0207697_10093693
1040 Ga0207682_10053192
1041 Ga0207692_10324812
1042 Ga0207692_10371836
1043 Ga0207642_10271696
1044 Ga0207642_10384775
1045 Ga0207688_10001647
1046 Ga0207680_10210763
1047 Ga0207680_11011930
1048 Ga0207647_10100540
1049 Ga0207647_10271074
1050 Ga0207699_10067702
1051 Ga0207699_10261732
1052 Ga0207645_10000665
1053 Ga0207705_10076065
1054 Ga0207705_10907991
1055 Ga0207684_10083893
1056 Ga0207684_10219399
1057 Ga0207654_10397741
1058 Ga0207707_10009330
1059 Ga0207707_10026955
1060 Ga0207707_10103105
1061 Ga0207707_10125490
1062 Ga0207707_10149818
1063 Ga0207707_10343489
1064 Ga0207707_10462920
1065 Ga0207707_10710419
1066 Ga0207695_10074547
1067 Ga0207695_10384051
1068 Ga0207695_10447013
1069 Ga0207695_10518914
1070 Ga0207695_11543845
1071 Ga0207671_10534312
1072 Ga0207693_10003546
1073 Ga0207693_10248339
1074 Ga0207693_11012413
1075 Ga0207663_10027943
1076 Ga0207663_10061491
1077 Ga0207663_10394356
1078 Ga0207660_10026629
1079 Ga0207660_10387159
1080 Ga0207660_10531762
1081 Ga0207662_10285311
1082 Ga0207657_10030265
1083 Ga0207657_10468294
1084 Ga0207649_10051588
1085 Ga0207649_10052250
1086 Ga0207652_10009020
1087 Ga0207652_10106988
1088 Ga0207652_10129264
1089 Ga0207652_10284636
1090 Ga0207652_10288920
1091 Ga0207646_10647840
1092 Ga0207646_10649514
1093 Ga0207681_10183742
1094 Ga0207694_11250222
1095 Ga0207650_10004361
1096 Ga0207650_10056046
1097 Ga0207659_10384990
1098 Ga0207687_10258293
1099 Ga0207700_10024739
1100 Ga0207700_10068486
1101 Ga0207700_10156580
1102 Ga0207700_10584865
1103 Ga0207700_10918264
1104 Ga0207700_11313970
1105 Ga0207664_10025166
1106 Ga0207664_10181886
1107 Ga0207664_11252778
1108 Ga0207644_10273826
1109 Ga0207690_10315536
1110 Ga0207706_10036452
1111 Ga0207706_10283341
1112 Ga0207670_10129128
1113 Ga0207670_10282416
1114 Ga0207670_10996614
1115 Ga0207669_10217907
1116 Ga0207665_10165395
1117 Ga0207665_10314774
1118 Ga0207691_10001474
1119 Ga0207691_10781204
1120 Ga0207689_10025031
1121 Ga0207661_10256785
1122 Ga0207661_10575607
1123 Ga0207661_10886455
1124 Ga0207679_10011173
1125 Ga0207679_10584700
1126 Ga0207679_10976501
1127 Ga0207667_10103756
1128 Ga0207667_10406281
1129 Ga0207667_10689032
1130 Ga0207667_11258541
1131 Ga0207651_10129010
1132 Ga0207651_10208131
1133 Ga0207651_10851478
1134 Ga0207712_10318624
1135 Ga0207658_10441908
1136 Ga0207677_10370862
1137 Ga0207703_10381727
1138 Ga0207639_10453363
1139 Ga0207678_10035816
1140 Ga0207708_10274914
1141 Ga0207708_10603484
1142 Ga0207702_10033806
1143 Ga0207702_10075627
1144 Ga0207702_10317557
1145 Ga0207702_10910955
1146 Ga0207648_10013103
1147 Ga0207648_10231846
1148 Ga0207676_10751783
1149 Ga0207674_10179458
1150 Ga0207674_10269560
1151 Ga0207674_10343608
1152 Ga0207683_10001563
1153 Ga0207683_10045547
1154 Ga0207698_10576266
1155 Ga0209984_1029552
1156 Ga0209179_1034269
1157 Ga0210002_1000936
1158 Ga0209971_1008182
1159 Ga0209966_1003306
1160 Ga0209974_10000574
1161 Ga0268266_10679205
1162 Ga0268265_10668493
1163 Ga0268264_10052164
1164 Ga0268264_10344902
1165 Ga0268264_11096370
1166 Ga0265338_10004828
1167 Ga0265324_10087107
1168 Ga0265325_10003410
1169 Ga0265325_10346819
1170 Ga0265339_10000269
1171 Ga0265313_10001274
1172 Ga0265313_10362438
1173 Ga0265342_10038800
1174 Ga0307405_10163208
1175 Ga0316053_111185
1176 Ga0373926_0013111
1177 Ga0373940_0032842
1178 Ga0373944_0059953
1179 Ga0373923_0192213
1180 Ga0373932_0051460
1181 Ga0373932_0254474
1182 Ga0373936_0024625
1183 Ga0373936_0184477
1184 Ga0373945_0067720
1185 Ga0373953_0044310
1186 Ga0373954_0046862
1187 Ga0373954_0201795
1188 Ga0373956_0039984
1189 Ga0373957_0029106
1190 Ga0373943_0176668
1191 Ga0373946_0145580
1192 Ga0373955_0064515
1193 Ga0373931_0083593
1194 Ga0373931_0095945
1195 Ga0373931_0234453
1196 Ga0373931_0490566
1197 Ga0373931_0498105
1198 Ga0373931_0529672
1199 Ga0373935_0033347
1200 Ga0373927_0194610
1201 Ga0373933_0158293
1202 Ga0373947_0020812
1203 Ga0373947_0215193
1204 Ga0373947_0285647
1205 Ga0373947_0420661
1206 Ga0373937_0009912
1207 Ga0373937_0012026
1208 Ga0373937_0090950
1209 Ga0373937_0106047
1210 Ga0373937_0635677
1211 Ga0373937_1478562
1212 Ga0373925_0027027
1213 Ga0373925_0046734
1214 Ga0373925_0324145
1215 Ga0395899_0005717
1216 Ga0395899_0006224
1217 Ga0395899_0071003
1218 Ga0395899_0503723
1219 Ga0395900_0005139
1220 Ga0395900_0029412
1221 Ga0395900_0031185
1222 Ga0395900_0031609
1223 Ga0395900_0032993
1224 Ga0395900_1416257
1225 Ga0395898_0152652
1226 Ga0395898_0272051
1227 Ga0395898_0482362
1228 Ga0436364_0185080
1229 Ga0436364_0446735
1230 Ga0436364_0987220
1231 Ga0436364_1106406
1232 Ga0436364_1119624
1233 Ga0436364_1378638
1234 Ga0436364_1429863
1235 Ga0436364_1536912
1236 Ga0395901_0006392
1237 Ga0395901_0018024
1238 Ga0395901_0171512
1239 Ga0395901_0505052
1240 Ga0436365_0316452
1241 Ga0436365_0386354
1242 Ga0436365_0427202
1243 Ga0436365_0491202
1244 Ga0436360_0094206
1245 Ga0436360_0197578
1246 Ga0436360_0353587
1247 Ga0436360_0409801
1248 Ga0436360_0458025
1249 Ga0436360_0502023
1250 Ga0436360_0645967
1251 Ga0436360_0650613
1252 Ga0436360_0838073
1253 Ga0436360_0891236
1254 Ga0436360_0946168
1255 Ga0436360_1098357
1256 Ga0436360_1099895
1257 Ga0436360_1288869
1258 Ga0436361_0032059
1259 Ga0436361_0044284
1260 Ga0436361_0054550
1261 Ga0436361_0057748
1262 Ga0436361_0414279
1263 Ga0436361_0716295
1264 Ga0436361_0858019
1265 Ga0436363_0032915
1266 Ga0436363_0546388
1267 Ga0436363_0683246
1268 Ga0436362_0110530
1269 Ga0436362_0130052
1270 Ga0436362_0161717
1271 Ga0436362_0753708
1272 Ga0436362_0768247
1273 Ga0436362_0881846
1274 Ga0436362_0938976
1275 Ga0436362_1141627
1276 Ga0436362_1303193
1277 Ga0451577_0969163
1278 Ga0451577_1542239
1279 Ga0466963_0315932
1280 Ga0466963_0413175
1281 Ga0466964_0532540
1282 Ga0453684_0406030
1283 Ga0453684_0912933
1284 Ga0466968_0424703
1285 Ga0466957_0140029
1286 Ga0451576_0223428
1287 Ga0451576_0600619
1288 Ga0451576_0910682
1289 Ga0466967_0064938
1290 Ga0466967_0522930
1291 Ga0466967_0736598
1292 Ga0466967_1070005
1293 Ga0495629_0222556
1294 Ga0495651_0551742
1295 Ga0495651_0638106
1296 Ga0495653_0174120
1297 Ga0495580_0167594
1298 Ga0495594_0206822
1299 Ga0495618_0796074
1300 Ga0495628_0146500
1301 Ga0495628_0310959
1302 Ga0495644_0435729
1303 Ga0495652_0247445
1304 Ga0495640_0130790
1305 Ga0495640_0549739
1306 Ga0495634_0211550
1307 Ga0495634_0617419
1308 Ga0495635_0098722
1309 Ga0495635_0605464
1310 Ga0495599_0243488
1311 Ga0495600_0315917
1312 Ga0495600_0414470
1313 Ga0495674_0703056
1314 Ga0495684_0092862
1315 Ga0495684_0116653
1316 Ga0495684_0341928
1317 Ga0495602_0136395
1318 Ga0496102_0087516
1319 Ga0496103_0316000
1320 Ga0496104_0264386
1321 Ga0496108_0075389
1322 Ga0496108_0789196
1323 Ga0496109_0516875
1324 Ga0496109_0585581
1325 Ga0496112_0001187
1326 Ga0496112_0109097
1327 Ga0496112_0171107
1328 Ga0496112_1060535
1329 Ga0496113_0065479
1330 Ga0496113_0072651
1331 Ga0496113_0382740
1332 Ga0496126_0801245
1333 Ga0501033_0207706
1334 Ga0501033_0398220
1335 Ga0501034_0194528
1336 Ga0501034_0359054
1337 Ga0501034_1005852
1338 Ga0501036_0007120
1339 Ga0501036_0358134
1340 Ga0501036_0408047
1341 Ga0501037_0083899
1342 Ga0501038_0012324
1343 Ga0501038_0029552
1344 Ga0501038_0399460
1345 Ga0501039_0020415
1346 Ga0501039_0028248
1347 Ga0501039_0107803
1348 Ga0501040_0002063
1349 Ga0501041_0020237
1350 Ga0501041_0749992
1351 Ga0501042_0003182
1352 Ga0501042_0519808
1353 Ga0501043_0081393
1354 Ga0501043_0195222
1355 Ga0501043_0347448
1356 Ga0501043_0389870
1357 Ga0501046_0022284
1358 Ga0501046_0115750
1359 Ga0501046_0375276
1360 Ga0501047_0052388
1361 Ga0501047_0091636
1362 Ga0501047_0138309
1363 Ga0501047_0247737
1364 Ga0501047_0324030
1365 Ga0501047_0574452
1366 Ga0501047_1072407
1367 Ga0501048_0002751
1368 Ga0501048_0035516
1369 Ga0501048_0060544
1370 Ga0501048_0205513
1371 Ga0501048_0318539
1372 Ga0501068_0498804
1373 Ga0501069_0003306
1374 Ga0501069_0244570
1375 Ga0501070_0008646
1376 Ga0501070_0060438
1377 Ga0501070_0109465
1378 Ga0501070_0984550
1379 Ga0501071_0000158
1380 Ga0501072_0001877
1381 Ga0501072_0058288
1382 Ga0501072_0127896
1383 Ga0501073_0220833
1384 Ga0501073_0727191
1385 Ga0501074_0066386
1386 Ga0501074_0234010
1387 Ga0501074_0426548
1388 Ga0501074_0456449
1389 Ga0501074_0505771
1390 Ga0501075_0000210
1391 Ga0501075_0162425
1392 Ga0501075_0579316
1393 Ga0501076_0000278
1394 Ga0501076_1203403
1395 Ga0501077_0000232
1396 Ga0501079_0034701
1397 Ga0501079_0051431
1398 Ga0501079_1085517
1399 Ga0501080_0008286
1400 Ga0501080_0105003
1401 Ga0501080_0193695
1402 Ga0501080_0436443
1403 Ga0501080_0953670
1404 Ga0501080_1025761
1405 Ga0501080_1162384
1406 Ga0501081_0000478
1407 Ga0501081_0023101
1408 Ga0501083_0027089
1409 Ga0501083_0257509
1410 Ga0501083_0368851
1411 Ga0501035_0060812
1412 Ga0501035_0580516
1413 Ga0501044_0000173
1414 Ga0501044_0144801
1415 Ga0501044_0149263
1416 Ga0501044_0244415
1417 Ga0501044_1138017
1418 Ga0501044_1264886
1419 Ga0501045_0001482
1420 nmdc:mga05p37_18943_c1
1421 nmdc:mga06r32_1364579_c1
1422 nmdc:mga06r32_161069_c1
1423 nmdc:mga06r32_409064_c1
1424 nmdc:mga08y16_150188_c1
1425 nmdc:mga08y16_688809_c1
1426 nmdc:mga0n895_2250_c1
1427 nmdc:mga0n895_2726_c1
1428 nmdc:mga0n895_41842_c1
1429 nmdc:mga0n895_756309_c1
1430 nmdc:mga0n895_780334_c1
1431 nmdc:mga0n895_91031_c1
1432 nmdc:mga0rr50_107361_c1
1433 nmdc:mga0rr50_550899_c1
1434 nmdc:mga08x19_179937_c1
1435 nmdc:mga08x19_359377_c1
1436 nmdc:mga08x19_5419_c2
1437 nmdc:mga0a205_26798_c1
1438 nmdc:mga0a205_37865_c1
1439 nmdc:mga0a205_684969_c1
1440 nmdc:mga0a205_77206_c2
1441 Ga0495601_0011260
1442 Ga0495601_0020713
1443 Ga0495601_0337193
1444 Ga0495595_0002839
1445 Ga0495619_0037089
1446 Ga0495619_0042479
1447 Ga0495619_0234534
1448 Ga0495619_0239371
1449 Ga0500595_118094
1450 Ga0501084_0069166
1451 Ga0501084_0187041
1452 Ga0501084_1006113
1453 Ga0587070_053073
1454 Ga0587085_109672
1455 Ga0587091_084522
1456 Ga0501082_0031459
1457 Ga0501082_0234341
1458 Ga0501082_0248420
1459 Ga0530510_0002585
1460 Ga0530510_0074024
1461 Ga0530510_0367950
1462 Ga0530510_0802319

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

49

193

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wgb-assembly1.cif.gz_A crystal structure of a probable flavoprotein from thermus thermophilus hb8 0.881 1 143
3zoe-assembly1.cif.gz_A crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8648 13 143
3zoh-assembly1.cif.gz_D crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound 1-cyclohex-2-enone 0.8566 13 143
3zoe-assembly1.cif.gz_B crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8562 13 140
4f07-assembly5.cif.gz_J structure of the styrene monooxygenase flavin reductase (smob) from pseudomonas putida s12 0.8409 7 142
ID Description Score Start End Superfamily
1wgbA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8864 2 143 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8562 13 140 2.30.110.10
2d5mA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8407 14 142 2.30.110.10
4l82C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8288 1 143 2.30.110.10
4f07E00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.825 7 144 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2D8PIH3-F1-model_v4 Flavin reductase 0.9686 18 142 GO:0010181
GO:0042602
AF-A0A846DZL6-F1-model_v4 Flavin reductase family protein 0.9617 30 168 GO:0010181
GO:0042602
AF-A0A3C0EDY6-F1-model_v4 Flavin reductase 0.9538 29 168 GO:0010181
GO:0042602
AF-A0A3C0EDY6-F1-model_v4 Flavin reductase 0.9468 29 168 GO:0010181
GO:0042602
AF-A0A846DZL6-F1-model_v4 Flavin reductase family protein 0.9407 30 168 GO:0010181
GO:0042602

Map