F477992
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 319 | 1462 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0042502|Ga0501070_0042502_1314_1934 |
| Length | 206 |
| Sequence | VVRGSSPRGPWIGIGDRQAWQARGGVLKKRRLPFHEEEKMNADAKKTALRMIPYGIYVMTVDDGKGGIAAATVNWVTQTAFAPPLVVVGVKTDSGAYALVKNTKTFALNMLGKDQKGLAFTFFKPAQLADGKISGQAFRKGANGAPILDAASAAVECKVTAIIEQGDHHIVVGEVTEAHLAKPPAGRPDAAILEMKDLGDNVFYGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 128 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 216 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 227 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 235 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 242 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 243 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 244 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 274 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.4 |
| Metatranscriptomes | 2.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 1.92 |
| Rhizosphere | 94.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501070_0042502 | 3300049586 | Bacteria | 3786 |
| 2 | JGI25406J46586_10004491 | 3300003203 | Bacteria | 6492 |
| 3 | Ga0058862_10001543 | 3300004803 | Unclassified | 1139 |
| 4 | Ga0065714_10138008 | 3300005288 | Unclassified | 1193 |
| 5 | Ga0065712_10000161 | 3300005290 | Bacteria | 38619 |
| 6 | Ga0065712_10126453 | 3300005290 | Unclassified | 1601 |
| 7 | Ga0065715_10002397 | 3300005293 | Bacteria | 8815 |
| 8 | Ga0065715_10009377 | 3300005293 | Bacteria | 4817 |
| 9 | Ga0065707_10247051 | 3300005295 | Bacteria | 1137 |
| 10 | Ga0070658_10451423 | 3300005327 | Bacteria | 1108 |
| 11 | Ga0070676_10004921 | 3300005328 | Bacteria | 7078 |
| 12 | Ga0070683_100793715 | 3300005329 | Bacteria | 908 |
| 13 | Ga0070690_100018565 | 3300005330 | Bacteria | 4203 |
| 14 | Ga0070690_100320460 | 3300005330 | Bacteria | 1117 |
| 15 | Ga0070670_100000611 | 3300005331 | Bacteria | 28002 |
| 16 | Ga0070670_100156603 | 3300005331 | Bacteria | 1973 |
| 17 | Ga0070677_10019792 | 3300005333 | Unclassified | 2443 |
| 18 | Ga0068869_100066289 | 3300005334 | Bacteria | 2660 |
| 19 | Ga0070666_10055281 | 3300005335 | Bacteria | 2679 |
| 20 | Ga0070666_10284450 | 3300005335 | Bacteria | 1176 |
| 21 | Ga0070680_100004460 | 3300005336 | Bacteria | 10542 |
| 22 | Ga0070680_100031322 | 3300005336 | Bacteria | 4276 |
| 23 | Ga0070680_100053500 | 3300005336 | Bacteria | 3295 |
| 24 | Ga0070680_100401330 | 3300005336 | Bacteria | 1168 |
| 25 | Ga0070680_100626282 | 3300005336 | Bacteria | 924 |
| 26 | Ga0070680_100955265 | 3300005336 | Unclassified | 740 |
| 27 | Ga0070680_101220327 | 3300005336 | Unclassified | 650 |
| 28 | Ga0070682_100071064 | 3300005337 | Bacteria | 2227 |
| 29 | Ga0068868_100030967 | 3300005338 | Unclassified | 4105 |
| 30 | Ga0070660_100176581 | 3300005339 | Unclassified | 1727 |
| 31 | Ga0070689_100079524 | 3300005340 | Unclassified | 2572 |
| 32 | Ga0070689_100412826 | 3300005340 | Unclassified | 1143 |
| 33 | Ga0070691_10044291 | 3300005341 | Unclassified | 2110 |
| 34 | Ga0070691_10063895 | 3300005341 | Unclassified | 1775 |
| 35 | Ga0070687_100222397 | 3300005343 | Unclassified | 1157 |
| 36 | Ga0070661_100141453 | 3300005344 | Unclassified | 1814 |
| 37 | Ga0070661_100260926 | 3300005344 | Bacteria | 1340 |
| 38 | Ga0070692_10506603 | 3300005345 | Unclassified | 783 |
| 39 | Ga0070692_10583690 | 3300005345 | Bacteria | 737 |
| 40 | Ga0070669_100069079 | 3300005353 | Unclassified | 2609 |
| 41 | Ga0070675_100133109 | 3300005354 | Unclassified | 2120 |
| 42 | Ga0070671_100066312 | 3300005355 | Bacteria | 3008 |
| 43 | Ga0070674_100078636 | 3300005356 | Unclassified | 2351 |
| 44 | Ga0070674_101144265 | 3300005356 | Unclassified | 689 |
| 45 | Ga0070673_100024014 | 3300005364 | Bacteria | 4462 |
| 46 | Ga0070673_100151887 | 3300005364 | Bacteria | 1962 |
| 47 | Ga0070673_101022766 | 3300005364 | Bacteria | 770 |
| 48 | Ga0070688_100059766 | 3300005365 | Bacteria | 2405 |
| 49 | Ga0070659_100037236 | 3300005366 | Unclassified | 3792 |
| 50 | Ga0070659_100048394 | 3300005366 | Unclassified | 3340 |
| 51 | Ga0070667_100137663 | 3300005367 | Unclassified | 2135 |
| 52 | Ga0070667_101243362 | 3300005367 | Unclassified | 697 |
| 53 | Ga0070667_101330650 | 3300005367 | Bacteria | 673 |
| 54 | Ga0070709_10024351 | 3300005434 | Bacteria | 3562 |
| 55 | Ga0070709_10115764 | 3300005434 | Bacteria | 1809 |
| 56 | Ga0070714_100061561 | 3300005435 | Bacteria | 3224 |
| 57 | Ga0070714_100218257 | 3300005435 | Unclassified | 1751 |
| 58 | Ga0070714_100353028 | 3300005435 | Bacteria | 1381 |
| 59 | Ga0070714_100359697 | 3300005435 | Bacteria | 1368 |
| 60 | Ga0070714_100731373 | 3300005435 | Unclassified | 956 |
| 61 | Ga0070713_100067769 | 3300005436 | Bacteria | 3006 |
| 62 | Ga0070713_100077645 | 3300005436 | Bacteria | 2824 |
| 63 | Ga0070713_100255294 | 3300005436 | Bacteria | 1600 |
| 64 | Ga0070713_100494594 | 3300005436 | Unclassified | 1153 |
| 65 | Ga0070710_10003156 | 3300005437 | Bacteria | 7812 |
| 66 | Ga0070710_10023819 | 3300005437 | Bacteria | 3223 |
| 67 | Ga0070710_10429871 | 3300005437 | Unclassified | 891 |
| 68 | Ga0070711_100086788 | 3300005439 | Bacteria | 2244 |
| 69 | Ga0070711_100317022 | 3300005439 | Bacteria | 1244 |
| 70 | Ga0070711_100507767 | 3300005439 | Unclassified | 995 |
| 71 | Ga0070711_100662776 | 3300005439 | Bacteria | 876 |
| 72 | Ga0070705_100013941 | 3300005440 | Bacteria | 4123 |
| 73 | Ga0070705_100220043 | 3300005440 | Bacteria | 1314 |
| 74 | Ga0070700_100232771 | 3300005441 | Unclassified | 1312 |
| 75 | Ga0070700_100332630 | 3300005441 | Bacteria | 1120 |
| 76 | Ga0070700_100716931 | 3300005441 | Unclassified | 797 |
| 77 | Ga0070694_100073149 | 3300005444 | Bacteria | 2367 |
| 78 | Ga0070694_100295868 | 3300005444 | Bacteria | 1239 |
| 79 | Ga0070694_100318608 | 3300005444 | Bacteria | 1196 |
| 80 | Ga0070694_100632353 | 3300005444 | Bacteria | 865 |
| 81 | Ga0070708_100254941 | 3300005445 | Bacteria | 1648 |
| 82 | Ga0070663_100020480 | 3300005455 | Unclassified | 4381 |
| 83 | Ga0070678_100039105 | 3300005456 | Bacteria | 3344 |
| 84 | Ga0070678_100363666 | 3300005456 | Unclassified | 1247 |
| 85 | Ga0070662_100179839 | 3300005457 | Bacteria | 1667 |
| 86 | Ga0070662_100253171 | 3300005457 | Unclassified | 1416 |
| 87 | Ga0070681_10003972 | 3300005458 | Bacteria | 13948 |
| 88 | Ga0070681_10007797 | 3300005458 | Bacteria | 10469 |
| 89 | Ga0070681_10009896 | 3300005458 | Bacteria | 9394 |
| 90 | Ga0070681_10058222 | 3300005458 | Bacteria | 3844 |
| 91 | Ga0070681_10082655 | 3300005458 | Bacteria | 3166 |
| 92 | Ga0070681_10884854 | 3300005458 | Unclassified | 811 |
| 93 | Ga0068867_100194627 | 3300005459 | Unclassified | 1620 |
| 94 | Ga0068867_101010122 | 3300005459 | Bacteria | 755 |
| 95 | Ga0070706_100275990 | 3300005467 | Bacteria | 1569 |
| 96 | Ga0070706_100278809 | 3300005467 | Bacteria | 1560 |
| 97 | Ga0070707_100728302 | 3300005468 | Bacteria | 955 |
| 98 | Ga0070698_100501381 | 3300005471 | Bacteria | 1152 |
| 99 | Ga0070698_101001900 | 3300005471 | Unclassified | 783 |
| 100 | Ga0070699_100109530 | 3300005518 | Bacteria | 2424 |
| 101 | Ga0070699_100552919 | 3300005518 | Bacteria | 1048 |
| 102 | Ga0070699_100626976 | 3300005518 | Unclassified | 981 |
| 103 | Ga0070679_100005562 | 3300005530 | Bacteria | 11680 |
| 104 | Ga0070679_100058290 | 3300005530 | Bacteria | 3847 |
| 105 | Ga0070679_100060576 | 3300005530 | Bacteria | 3772 |
| 106 | Ga0070679_100148161 | 3300005530 | Unclassified | 2324 |
| 107 | Ga0070684_100079334 | 3300005535 | Unclassified | 2902 |
| 108 | Ga0070684_100091144 | 3300005535 | Bacteria | 2711 |
| 109 | Ga0070697_100058232 | 3300005536 | Bacteria | 3144 |
| 110 | Ga0070697_100391952 | 3300005536 | Bacteria | 1204 |
| 111 | Ga0070697_100825737 | 3300005536 | Bacteria | 821 |
| 112 | Ga0068853_100257246 | 3300005539 | Bacteria | 1604 |
| 113 | Ga0070672_100001632 | 3300005543 | Bacteria | 13956 |
| 114 | Ga0070686_100058156 | 3300005544 | Unclassified | 2487 |
| 115 | Ga0070686_101205924 | 3300005544 | Unclassified | 629 |
| 116 | Ga0070695_100014670 | 3300005545 | Bacteria | 4723 |
| 117 | Ga0070695_100015040 | 3300005545 | Unclassified | 4669 |
| 118 | Ga0070695_100578270 | 3300005545 | Bacteria | 879 |
| 119 | Ga0070695_100698540 | 3300005545 | Bacteria | 805 |
| 120 | Ga0070696_100022644 | 3300005546 | Bacteria | 4270 |
| 121 | Ga0070696_100048551 | 3300005546 | Bacteria | 2947 |
| 122 | Ga0070696_100119610 | 3300005546 | Unclassified | 1905 |
| 123 | Ga0070696_100605329 | 3300005546 | Bacteria | 884 |
| 124 | Ga0070693_100093605 | 3300005547 | Unclassified | 1816 |
| 125 | Ga0070693_100215148 | 3300005547 | Bacteria | 1256 |
| 126 | Ga0070665_100573665 | 3300005548 | Bacteria | 1141 |
| 127 | Ga0070704_100150305 | 3300005549 | Bacteria | 1830 |
| 128 | Ga0070704_100393339 | 3300005549 | Bacteria | 1181 |
| 129 | Ga0070704_100878426 | 3300005549 | Bacteria | 805 |
| 130 | Ga0068855_100053393 | 3300005563 | Unclassified | 4754 |
| 131 | Ga0068855_100166268 | 3300005563 | Bacteria | 2500 |
| 132 | Ga0068855_100384323 | 3300005563 | Bacteria | 1541 |
| 133 | Ga0070664_100004308 | 3300005564 | Bacteria | 11443 |
| 134 | Ga0070664_100065384 | 3300005564 | Bacteria | 3102 |
| 135 | Ga0070664_100403057 | 3300005564 | Unclassified | 1251 |
| 136 | Ga0070664_100429775 | 3300005564 | Bacteria | 1210 |
| 137 | Ga0070664_101090314 | 3300005564 | Bacteria | 752 |
| 138 | Ga0068857_100033080 | 3300005577 | Bacteria | 4572 |
| 139 | Ga0068857_100135526 | 3300005577 | Bacteria | 2223 |
| 140 | Ga0068857_100136648 | 3300005577 | Bacteria | 2213 |
| 141 | Ga0068854_100231290 | 3300005578 | Bacteria | 1467 |
| 142 | Ga0068856_100118477 | 3300005614 | Bacteria | 2648 |
| 143 | Ga0068856_100310452 | 3300005614 | Bacteria | 1594 |
| 144 | Ga0068856_100336259 | 3300005614 | Bacteria | 1528 |
| 145 | Ga0068856_100985059 | 3300005614 | Bacteria | 861 |
| 146 | Ga0070702_100071436 | 3300005615 | Bacteria | 2051 |
| 147 | Ga0070702_101210255 | 3300005615 | Bacteria | 609 |
| 148 | Ga0068852_100310188 | 3300005616 | Bacteria | 1529 |
| 149 | Ga0068852_100391080 | 3300005616 | Unclassified | 1366 |
| 150 | Ga0068859_100184316 | 3300005617 | Bacteria | 2171 |
| 151 | Ga0068864_100332802 | 3300005618 | Bacteria | 1429 |
| 152 | Ga0068864_101841082 | 3300005618 | Bacteria | 611 |
| 153 | Ga0068866_10307708 | 3300005718 | Bacteria | 992 |
| 154 | Ga0068866_10471687 | 3300005718 | Bacteria | 825 |
| 155 | Ga0068866_10654110 | 3300005718 | Unclassified | 716 |
| 156 | Ga0068863_100492708 | 3300005841 | Unclassified | 1206 |
| 157 | Ga0068858_100019185 | 3300005842 | Bacteria | 6397 |
| 158 | Ga0068860_100025336 | 3300005843 | Bacteria | 5724 |
| 159 | Ga0068860_100121016 | 3300005843 | Bacteria | 2506 |
| 160 | Ga0068860_100687900 | 3300005843 | Bacteria | 1032 |
| 161 | Ga0068862_100221260 | 3300005844 | Unclassified | 1714 |
| 162 | Ga0068862_100365561 | 3300005844 | Bacteria | 1342 |
| 163 | Ga0081455_10000599 | 3300005937 | Bacteria | 46691 |
| 164 | Ga0081455_10001044 | 3300005937 | Bacteria | 34911 |
| 165 | Ga0081455_10174134 | 3300005937 | Bacteria | 1636 |
| 166 | Ga0081455_10699393 | 3300005937 | Bacteria | 646 |
| 167 | Ga0081539_10000025 | 3300005985 | Bacteria | 340255 |
| 168 | Ga0070717_10010359 | 3300006028 | Bacteria | 7035 |
| 169 | Ga0070717_10293721 | 3300006028 | Bacteria | 1443 |
| 170 | Ga0070717_10295192 | 3300006028 | Bacteria | 1440 |
| 171 | Ga0070712_100040351 | 3300006175 | Bacteria | 3200 |
| 172 | Ga0070712_100101850 | 3300006175 | Bacteria | 2125 |
| 173 | Ga0097621_100180093 | 3300006237 | Bacteria | 1826 |
| 174 | Ga0097621_101184891 | 3300006237 | Bacteria | 719 |
| 175 | Ga0068871_101715650 | 3300006358 | Unclassified | 596 |
| 176 | Ga0075428_100628055 | 3300006844 | Unclassified | 1146 |
| 177 | Ga0075428_100949669 | 3300006844 | Bacteria | 911 |
| 178 | Ga0075430_100169054 | 3300006846 | Unclassified | 1819 |
| 179 | Ga0075431_100152408 | 3300006847 | Bacteria | 2380 |
| 180 | Ga0075431_100172680 | 3300006847 | Bacteria | 2221 |
| 181 | Ga0075431_101931864 | 3300006847 | Unclassified | 546 |
| 182 | Ga0075433_10002145 | 3300006852 | Bacteria | 14947 |
| 183 | Ga0075433_10317763 | 3300006852 | Bacteria | 1378 |
| 184 | Ga0075434_100002497 | 3300006871 | Bacteria | 16213 |
| 185 | Ga0075434_100011393 | 3300006871 | Bacteria | 8387 |
| 186 | Ga0075434_100032505 | 3300006871 | Bacteria | 5144 |
| 187 | Ga0075434_100278054 | 3300006871 | Unclassified | 1694 |
| 188 | Ga0075434_100402482 | 3300006871 | Unclassified | 1390 |
| 189 | Ga0075434_100627766 | 3300006871 | Bacteria | 1093 |
| 190 | Ga0075434_100853358 | 3300006871 | Bacteria | 926 |
| 191 | Ga0075429_100531177 | 3300006880 | Unclassified | 1031 |
| 192 | Ga0068865_100106399 | 3300006881 | Bacteria | 2062 |
| 193 | Ga0075436_100073073 | 3300006914 | Bacteria | 2373 |
| 194 | Ga0075436_100102792 | 3300006914 | Bacteria | 1991 |
| 195 | Ga0075436_100268186 | 3300006914 | Unclassified | 1219 |
| 196 | Ga0097620_100184307 | 3300006931 | Bacteria | 2171 |
| 197 | Ga0075435_100036145 | 3300007076 | Bacteria | 3923 |
| 198 | Ga0075435_100092823 | 3300007076 | Bacteria | 2493 |
| 199 | Ga0075435_100548945 | 3300007076 | Bacteria | 1001 |
| 200 | Ga0075435_100590542 | 3300007076 | Unclassified | 963 |
| 201 | Ga0099794_10161018 | 3300007265 | Bacteria | 1142 |
| 202 | Ga0099795_10006448 | 3300007788 | Bacteria | 3203 |
| 203 | Ga0099795_10243722 | 3300007788 | Bacteria | 773 |
| 204 | Ga0099795_10297466 | 3300007788 | Bacteria | 709 |
| 205 | Ga0105240_10051632 | 3300009093 | Bacteria | 5172 |
| 206 | Ga0105240_10088315 | 3300009093 | Bacteria | 3794 |
| 207 | Ga0105240_10166179 | 3300009093 | Bacteria | 2617 |
| 208 | Ga0105240_10631758 | 3300009093 | Bacteria | 1176 |
| 209 | Ga0105240_11019637 | 3300009093 | Bacteria | 884 |
| 210 | Ga0105240_11406011 | 3300009093 | Unclassified | 733 |
| 211 | Ga0111539_10144128 | 3300009094 | Unclassified | 2789 |
| 212 | Ga0111539_10173266 | 3300009094 | Bacteria | 2521 |
| 213 | Ga0111539_10370602 | 3300009094 | Bacteria | 1667 |
| 214 | Ga0111539_10553599 | 3300009094 | Bacteria | 1340 |
| 215 | Ga0111539_10675735 | 3300009094 | Bacteria | 1202 |
| 216 | Ga0111539_10943030 | 3300009094 | Unclassified | 1003 |
| 217 | Ga0105245_10250673 | 3300009098 | Unclassified | 1720 |
| 218 | Ga0105247_10786240 | 3300009101 | Bacteria | 725 |
| 219 | Ga0114129_10663775 | 3300009147 | Unclassified | 1344 |
| 220 | Ga0114129_11051180 | 3300009147 | Bacteria | 1022 |
| 221 | Ga0105243_10215451 | 3300009148 | Unclassified | 1694 |
| 222 | Ga0105241_10115820 | 3300009174 | Unclassified | 2152 |
| 223 | Ga0105241_10698552 | 3300009174 | Bacteria | 926 |
| 224 | Ga0105241_10893483 | 3300009174 | Bacteria | 824 |
| 225 | Ga0105241_10919079 | 3300009174 | Bacteria | 814 |
| 226 | Ga0105242_10480320 | 3300009176 | Bacteria | 1178 |
| 227 | Ga0105248_10799879 | 3300009177 | Unclassified | 1064 |
| 228 | Ga0105248_11183504 | 3300009177 | Bacteria | 864 |
| 229 | Ga0105248_12619600 | 3300009177 | Bacteria | 575 |
| 230 | Ga0105237_10218512 | 3300009545 | Unclassified | 1906 |
| 231 | Ga0105237_10573009 | 3300009545 | Bacteria | 1136 |
| 232 | Ga0105237_11084276 | 3300009545 | Bacteria | 808 |
| 233 | Ga0105238_10293747 | 3300009551 | Bacteria | 1608 |
| 234 | Ga0105238_10878401 | 3300009551 | Unclassified | 914 |
| 235 | Ga0105249_10062669 | 3300009553 | Bacteria | 3414 |
| 236 | Ga0105249_10280782 | 3300009553 | Bacteria | 1663 |
| 237 | Ga0105249_11335165 | 3300009553 | Bacteria | 789 |
| 238 | Ga0099796_10295784 | 3300010159 | Bacteria | 685 |
| 239 | Ga0105239_10048921 | 3300010375 | Unclassified | 4635 |
| 240 | Ga0105239_11119622 | 3300010375 | Bacteria | 906 |
| 241 | Ga0105246_10013668 | 3300011119 | Bacteria | 5094 |
| 242 | Ga0105246_10224919 | 3300011119 | Bacteria | 1473 |
| 243 | Ga0105246_10453781 | 3300011119 | Bacteria | 1078 |
| 244 | Ga0157373_10509118 | 3300013100 | Unclassified | 870 |
| 245 | Ga0157371_10155064 | 3300013102 | Bacteria | 1634 |
| 246 | Ga0157371_10167231 | 3300013102 | Bacteria | 1571 |
| 247 | Ga0157370_10027321 | 3300013104 | Bacteria | 5627 |
| 248 | Ga0157370_10032626 | 3300013104 | Bacteria | 5084 |
| 249 | Ga0157370_10072332 | 3300013104 | Bacteria | 3254 |
| 250 | Ga0157370_10181126 | 3300013104 | Unclassified | 1958 |
| 251 | Ga0157370_10839159 | 3300013104 | Bacteria | 835 |
| 252 | Ga0157369_10050418 | 3300013105 | Bacteria | 4509 |
| 253 | Ga0157369_10228072 | 3300013105 | Bacteria | 1948 |
| 254 | Ga0157369_10327632 | 3300013105 | Bacteria | 1592 |
| 255 | Ga0157369_11516386 | 3300013105 | Bacteria | 682 |
| 256 | Ga0157374_10207110 | 3300013296 | Unclassified | 1922 |
| 257 | Ga0157378_10034425 | 3300013297 | Unclassified | 4480 |
| 258 | Ga0157378_10047931 | 3300013297 | Bacteria | 3799 |
| 259 | Ga0157378_10149185 | 3300013297 | Bacteria | 2177 |
| 260 | Ga0157378_10330275 | 3300013297 | Bacteria | 1484 |
| 261 | Ga0163162_10084341 | 3300013306 | Bacteria | 3252 |
| 262 | Ga0163162_10470502 | 3300013306 | Bacteria | 1388 |
| 263 | Ga0163162_10665743 | 3300013306 | Bacteria | 1164 |
| 264 | Ga0163162_11045831 | 3300013306 | Bacteria | 924 |
| 265 | Ga0163162_11192868 | 3300013306 | Bacteria | 864 |
| 266 | Ga0163162_11435603 | 3300013306 | Bacteria | 785 |
| 267 | Ga0157372_10177244 | 3300013307 | Bacteria | 2467 |
| 268 | Ga0157372_11700776 | 3300013307 | Bacteria | 726 |
| 269 | Ga0157375_10125124 | 3300013308 | Bacteria | 2685 |
| 270 | Ga0163163_10052057 | 3300014325 | Bacteria | 4038 |
| 271 | Ga0163163_10434344 | 3300014325 | Unclassified | 1372 |
| 272 | Ga0163163_11032143 | 3300014325 | Bacteria | 885 |
| 273 | Ga0157380_10875333 | 3300014326 | Bacteria | 922 |
| 274 | Ga0182008_10016665 | 3300014497 | Bacteria | 3816 |
| 275 | Ga0157377_10512966 | 3300014745 | Bacteria | 840 |
| 276 | Ga0157379_10382838 | 3300014968 | Bacteria | 1291 |
| 277 | Ga0157379_12138648 | 3300014968 | Unclassified | 555 |
| 278 | Ga0157376_10054061 | 3300014969 | Unclassified | 3346 |
| 279 | Ga0163161_10120194 | 3300017792 | Bacteria | 1973 |
| 280 | Ga0163161_10660971 | 3300017792 | Bacteria | 867 |
| 281 | Ga0197907_10981873 | 3300020069 | Unclassified | 1068 |
| 282 | Ga0197907_11482104 | 3300020069 | Bacteria | 605 |
| 283 | Ga0206356_11064732 | 3300020070 | Bacteria | 1184 |
| 284 | Ga0206356_11089989 | 3300020070 | Unclassified | 1094 |
| 285 | Ga0206355_1275391 | 3300020076 | Bacteria | 793 |
| 286 | Ga0206352_10872377 | 3300020078 | Bacteria | 557 |
| 287 | Ga0206350_10936941 | 3300020080 | Bacteria | 805 |
| 288 | Ga0206350_11009195 | 3300020080 | Bacteria | 615 |
| 289 | Ga0206353_10521041 | 3300020082 | Bacteria | 608 |
| 290 | Ga0213873_10023397 | 3300021358 | Bacteria | 1472 |
| 291 | Ga0213873_10025919 | 3300021358 | Unclassified | 1420 |
| 292 | Ga0213872_10356609 | 3300021361 | Unclassified | 599 |
| 293 | Ga0213874_10065388 | 3300021377 | Bacteria | 1149 |
| 294 | Ga0213876_10098173 | 3300021384 | Bacteria | 1552 |
| 295 | Ga0213876_10107961 | 3300021384 | Bacteria | 1477 |
| 296 | Ga0213875_10001005 | 3300021388 | Bacteria | 20058 |
| 297 | Ga0213875_10017557 | 3300021388 | Bacteria | 3454 |
| 298 | Ga0213875_10232180 | 3300021388 | Unclassified | 869 |
| 299 | Ga0213875_10328147 | 3300021388 | Bacteria | 726 |
| 300 | Ga0213871_10064375 | 3300021441 | Bacteria | 1026 |
| 301 | Ga0213871_10104635 | 3300021441 | Bacteria | 832 |
| 302 | Ga0224712_10093610 | 3300022467 | Unclassified | 1263 |
| 303 | Ga0224712_10323931 | 3300022467 | Bacteria | 724 |
| 304 | Ga0224712_10423511 | 3300022467 | Bacteria | 637 |
| 305 | Ga0224712_10479571 | 3300022467 | Bacteria | 599 |
| 306 | Ga0224712_10576516 | 3300022467 | Bacteria | 548 |
| 307 | Ga0207697_10030991 | 3300025315 | Bacteria | 2189 |
| 308 | Ga0207697_10093693 | 3300025315 | Unclassified | 1274 |
| 309 | Ga0207682_10053192 | 3300025893 | Unclassified | 1679 |
| 310 | Ga0207692_10324812 | 3300025898 | Bacteria | 943 |
| 311 | Ga0207692_10371836 | 3300025898 | Bacteria | 885 |
| 312 | Ga0207642_10271696 | 3300025899 | Bacteria | 971 |
| 313 | Ga0207642_10384775 | 3300025899 | Unclassified | 836 |
| 314 | Ga0207688_10001647 | 3300025901 | Bacteria | 11800 |
| 315 | Ga0207680_10210763 | 3300025903 | Unclassified | 1328 |
| 316 | Ga0207680_11011930 | 3300025903 | Unclassified | 595 |
| 317 | Ga0207647_10100540 | 3300025904 | Bacteria | 1716 |
| 318 | Ga0207647_10271074 | 3300025904 | Bacteria | 970 |
| 319 | Ga0207699_10067702 | 3300025906 | Bacteria | 2172 |
| 320 | Ga0207699_10261732 | 3300025906 | Unclassified | 1196 |
| 321 | Ga0207645_10000665 | 3300025907 | Bacteria | 28520 |
| 322 | Ga0207705_10076065 | 3300025909 | Unclassified | 2440 |
| 323 | Ga0207705_10907991 | 3300025909 | Bacteria | 682 |
| 324 | Ga0207684_10083893 | 3300025910 | Bacteria | 2713 |
| 325 | Ga0207684_10219399 | 3300025910 | Bacteria | 1641 |
| 326 | Ga0207654_10397741 | 3300025911 | Bacteria | 957 |
| 327 | Ga0207707_10009330 | 3300025912 | Bacteria | 8508 |
| 328 | Ga0207707_10026955 | 3300025912 | Bacteria | 5022 |
| 329 | Ga0207707_10103105 | 3300025912 | Unclassified | 2494 |
| 330 | Ga0207707_10125490 | 3300025912 | Bacteria | 2245 |
| 331 | Ga0207707_10149818 | 3300025912 | Unclassified | 2040 |
| 332 | Ga0207707_10343489 | 3300025912 | Bacteria | 1287 |
| 333 | Ga0207707_10462920 | 3300025912 | Bacteria | 1084 |
| 334 | Ga0207707_10710419 | 3300025912 | Unclassified | 843 |
| 335 | Ga0207695_10074547 | 3300025913 | Bacteria | 3455 |
| 336 | Ga0207695_10384051 | 3300025913 | Bacteria | 1290 |
| 337 | Ga0207695_10447013 | 3300025913 | Bacteria | 1176 |
| 338 | Ga0207695_10518914 | 3300025913 | Bacteria | 1073 |
| 339 | Ga0207695_11543845 | 3300025913 | Bacteria | 544 |
| 340 | Ga0207671_10534312 | 3300025914 | Unclassified | 935 |
| 341 | Ga0207693_10003546 | 3300025915 | Bacteria | 13329 |
| 342 | Ga0207693_10248339 | 3300025915 | Bacteria | 1396 |
| 343 | Ga0207693_11012413 | 3300025915 | Bacteria | 634 |
| 344 | Ga0207663_10027943 | 3300025916 | Bacteria | 3295 |
| 345 | Ga0207663_10061491 | 3300025916 | Bacteria | 2383 |
| 346 | Ga0207663_10394356 | 3300025916 | Unclassified | 1057 |
| 347 | Ga0207660_10026629 | 3300025917 | Bacteria | 3938 |
| 348 | Ga0207660_10387159 | 3300025917 | Unclassified | 1124 |
| 349 | Ga0207660_10531762 | 3300025917 | Bacteria | 955 |
| 350 | Ga0207662_10285311 | 3300025918 | Unclassified | 1094 |
| 351 | Ga0207657_10030265 | 3300025919 | Unclassified | 4915 |
| 352 | Ga0207657_10468294 | 3300025919 | Unclassified | 988 |
| 353 | Ga0207649_10051588 | 3300025920 | Bacteria | 2548 |
| 354 | Ga0207649_10052250 | 3300025920 | Bacteria | 2535 |
| 355 | Ga0207652_10009020 | 3300025921 | Bacteria | 8036 |
| 356 | Ga0207652_10106988 | 3300025921 | Bacteria | 2476 |
| 357 | Ga0207652_10129264 | 3300025921 | Bacteria | 2252 |
| 358 | Ga0207652_10284636 | 3300025921 | Bacteria | 1491 |
| 359 | Ga0207652_10288920 | 3300025921 | Unclassified | 1479 |
| 360 | Ga0207646_10647840 | 3300025922 | Bacteria | 946 |
| 361 | Ga0207646_10649514 | 3300025922 | Bacteria | 945 |
| 362 | Ga0207681_10183742 | 3300025923 | Unclassified | 1594 |
| 363 | Ga0207694_11250222 | 3300025924 | Unclassified | 628 |
| 364 | Ga0207650_10004361 | 3300025925 | Bacteria | 9664 |
| 365 | Ga0207650_10056046 | 3300025925 | Bacteria | 2928 |
| 366 | Ga0207659_10384990 | 3300025926 | Unclassified | 1170 |
| 367 | Ga0207687_10258293 | 3300025927 | Bacteria | 1388 |
| 368 | Ga0207700_10024739 | 3300025928 | Bacteria | 4160 |
| 369 | Ga0207700_10068486 | 3300025928 | Bacteria | 2721 |
| 370 | Ga0207700_10156580 | 3300025928 | Bacteria | 1888 |
| 371 | Ga0207700_10584865 | 3300025928 | Bacteria | 993 |
| 372 | Ga0207700_10918264 | 3300025928 | Bacteria | 784 |
| 373 | Ga0207700_11313970 | 3300025928 | Bacteria | 644 |
| 374 | Ga0207664_10025166 | 3300025929 | Bacteria | 4479 |
| 375 | Ga0207664_10181886 | 3300025929 | Bacteria | 1805 |
| 376 | Ga0207664_11252778 | 3300025929 | Bacteria | 660 |
| 377 | Ga0207644_10273826 | 3300025931 | Unclassified | 1353 |
| 378 | Ga0207690_10315536 | 3300025932 | Unclassified | 1227 |
| 379 | Ga0207706_10036452 | 3300025933 | Bacteria | 4368 |
| 380 | Ga0207706_10283341 | 3300025933 | Bacteria | 1445 |
| 381 | Ga0207670_10129128 | 3300025936 | Bacteria | 1849 |
| 382 | Ga0207670_10282416 | 3300025936 | Bacteria | 1294 |
| 383 | Ga0207670_10996614 | 3300025936 | Bacteria | 705 |
| 384 | Ga0207669_10217907 | 3300025937 | Bacteria | 1398 |
| 385 | Ga0207665_10165395 | 3300025939 | Bacteria | 1594 |
| 386 | Ga0207665_10314774 | 3300025939 | Bacteria | 1173 |
| 387 | Ga0207691_10001474 | 3300025940 | Bacteria | 23476 |
| 388 | Ga0207691_10781204 | 3300025940 | Bacteria | 803 |
| 389 | Ga0207689_10025031 | 3300025942 | Bacteria | 5003 |
| 390 | Ga0207661_10256785 | 3300025944 | Bacteria | 1555 |
| 391 | Ga0207661_10575607 | 3300025944 | Unclassified | 1033 |
| 392 | Ga0207661_10886455 | 3300025944 | Bacteria | 822 |
| 393 | Ga0207679_10011173 | 3300025945 | Bacteria | 5801 |
| 394 | Ga0207679_10584700 | 3300025945 | Bacteria | 1005 |
| 395 | Ga0207679_10976501 | 3300025945 | Bacteria | 776 |
| 396 | Ga0207667_10103756 | 3300025949 | Unclassified | 2932 |
| 397 | Ga0207667_10406281 | 3300025949 | Bacteria | 1386 |
| 398 | Ga0207667_10689032 | 3300025949 | Bacteria | 1025 |
| 399 | Ga0207667_11258541 | 3300025949 | Bacteria | 717 |
| 400 | Ga0207651_10129010 | 3300025960 | Bacteria | 1932 |
| 401 | Ga0207651_10208131 | 3300025960 | Unclassified | 1572 |
| 402 | Ga0207651_10851478 | 3300025960 | Bacteria | 810 |
| 403 | Ga0207712_10318624 | 3300025961 | Unclassified | 1282 |
| 404 | Ga0207658_10441908 | 3300025986 | Bacteria | 1150 |
| 405 | Ga0207677_10370862 | 3300026023 | Unclassified | 1205 |
| 406 | Ga0207703_10381727 | 3300026035 | Bacteria | 1303 |
| 407 | Ga0207639_10453363 | 3300026041 | Unclassified | 1165 |
| 408 | Ga0207678_10035816 | 3300026067 | Bacteria | 4321 |
| 409 | Ga0207708_10274914 | 3300026075 | Unclassified | 1363 |
| 410 | Ga0207708_10603484 | 3300026075 | Unclassified | 930 |
| 411 | Ga0207702_10033806 | 3300026078 | Bacteria | 4273 |
| 412 | Ga0207702_10075627 | 3300026078 | Unclassified | 2909 |
| 413 | Ga0207702_10317557 | 3300026078 | Bacteria | 1483 |
| 414 | Ga0207702_10910955 | 3300026078 | Bacteria | 871 |
| 415 | Ga0207648_10013103 | 3300026089 | Bacteria | 7731 |
| 416 | Ga0207648_10231846 | 3300026089 | Unclassified | 1642 |
| 417 | Ga0207676_10751783 | 3300026095 | Unclassified | 948 |
| 418 | Ga0207674_10179458 | 3300026116 | Bacteria | 2069 |
| 419 | Ga0207674_10269560 | 3300026116 | Bacteria | 1650 |
| 420 | Ga0207674_10343608 | 3300026116 | Unclassified | 1443 |
| 421 | Ga0207683_10001563 | 3300026121 | Bacteria | 20604 |
| 422 | Ga0207683_10045547 | 3300026121 | Bacteria | 3836 |
| 423 | Ga0207698_10576266 | 3300026142 | Bacteria | 1107 |
| 424 | Ga0209984_1029552 | 3300027424 | Bacteria | 772 |
| 425 | Ga0209179_1034269 | 3300027512 | Bacteria | 1052 |
| 426 | Ga0210002_1000936 | 3300027617 | Bacteria | 4023 |
| 427 | Ga0209971_1008182 | 3300027682 | Unclassified | 2481 |
| 428 | Ga0209966_1003306 | 3300027695 | Bacteria | 2709 |
| 429 | Ga0209974_10000574 | 3300027876 | Bacteria | 12277 |
| 430 | Ga0268266_10679205 | 3300028379 | Bacteria | 992 |
| 431 | Ga0268265_10668493 | 3300028380 | Unclassified | 1000 |
| 432 | Ga0268264_10052164 | 3300028381 | Bacteria | 3410 |
| 433 | Ga0268264_10344902 | 3300028381 | Unclassified | 1416 |
| 434 | Ga0268264_11096370 | 3300028381 | Bacteria | 804 |
| 435 | Ga0265338_10004828 | 3300028800 | Bacteria | 18005 |
| 436 | Ga0265324_10087107 | 3300029957 | Bacteria | 1062 |
| 437 | Ga0265325_10003410 | 3300031241 | Bacteria | 10388 |
| 438 | Ga0265325_10346819 | 3300031241 | Bacteria | 656 |
| 439 | Ga0265339_10000269 | 3300031249 | Bacteria | 41988 |
| 440 | Ga0265313_10001274 | 3300031595 | Bacteria | 23880 |
| 441 | Ga0265313_10362438 | 3300031595 | Bacteria | 573 |
| 442 | Ga0265342_10038800 | 3300031712 | Bacteria | 2899 |
| 443 | Ga0307405_10163208 | 3300031731 | Bacteria | 1581 |
| 444 | Ga0316053_111185 | 3300032120 | Bacteria | 631 |
| 445 | Ga0373926_0013111 | 3300035083 | Bacteria | 2808 |
| 446 | Ga0373940_0032842 | 3300035088 | Bacteria | 1393 |
| 447 | Ga0373944_0059953 | 3300035089 | Unclassified | 1219 |
| 448 | Ga0373923_0192213 | 3300035111 | Unclassified | 941 |
| 449 | Ga0373932_0051460 | 3300035112 | Bacteria | 1224 |
| 450 | Ga0373932_0254474 | 3300035112 | Bacteria | 642 |
| 451 | Ga0373936_0024625 | 3300035113 | Bacteria | 2351 |
| 452 | Ga0373936_0184477 | 3300035113 | Unclassified | 916 |
| 453 | Ga0373945_0067720 | 3300035116 | Unclassified | 1345 |
| 454 | Ga0373953_0044310 | 3300035117 | Unclassified | 1778 |
| 455 | Ga0373954_0046862 | 3300035118 | Bacteria | 2021 |
| 456 | Ga0373954_0201795 | 3300035118 | Unclassified | 977 |
| 457 | Ga0373956_0039984 | 3300035119 | Unclassified | 2079 |
| 458 | Ga0373957_0029106 | 3300035120 | Unclassified | 2016 |
| 459 | Ga0373943_0176668 | 3300035170 | Bacteria | 1171 |
| 460 | Ga0373946_0145580 | 3300035171 | Bacteria | 1102 |
| 461 | Ga0373955_0064515 | 3300035172 | Unclassified | 2030 |
| 462 | Ga0373931_0083593 | 3300035691 | Bacteria | 1766 |
| 463 | Ga0373931_0095945 | 3300035691 | Bacteria | 1660 |
| 464 | Ga0373931_0234453 | 3300035691 | Unclassified | 1110 |
| 465 | Ga0373931_0490566 | 3300035691 | Bacteria | 791 |
| 466 | Ga0373931_0498105 | 3300035691 | Unclassified | 785 |
| 467 | Ga0373931_0529672 | 3300035691 | Bacteria | 763 |
| 468 | Ga0373935_0033347 | 3300035692 | Bacteria | 3203 |
| 469 | Ga0373927_0194610 | 3300035695 | Unclassified | 1330 |
| 470 | Ga0373933_0158293 | 3300035724 | Unclassified | 1437 |
| 471 | Ga0373947_0020812 | 3300035725 | Bacteria | 3791 |
| 472 | Ga0373947_0215193 | 3300035725 | Unclassified | 1261 |
| 473 | Ga0373947_0285647 | 3300035725 | Unclassified | 1097 |
| 474 | Ga0373947_0420661 | 3300035725 | Bacteria | 903 |
| 475 | Ga0373937_0009912 | 3300036401 | Bacteria | 8307 |
| 476 | Ga0373937_0012026 | 3300036401 | Bacteria | 7596 |
| 477 | Ga0373937_0090950 | 3300036401 | Bacteria | 2827 |
| 478 | Ga0373937_0106047 | 3300036401 | Bacteria | 2612 |
| 479 | Ga0373937_0635677 | 3300036401 | Unclassified | 1012 |
| 480 | Ga0373937_1478562 | 3300036401 | Unclassified | 627 |
| 481 | Ga0373925_0027027 | 3300037068 | Bacteria | 4201 |
| 482 | Ga0373925_0046734 | 3300037068 | Bacteria | 3220 |
| 483 | Ga0373925_0324145 | 3300037068 | Unclassified | 1247 |
| 484 | Ga0395899_0005717 | 3300037312 | Bacteria | 9651 |
| 485 | Ga0395899_0006224 | 3300037312 | Bacteria | 9250 |
| 486 | Ga0395899_0071003 | 3300037312 | Bacteria | 2548 |
| 487 | Ga0395899_0503723 | 3300037312 | Bacteria | 785 |
| 488 | Ga0395900_0005139 | 3300037418 | Bacteria | 13740 |
| 489 | Ga0395900_0029412 | 3300037418 | Bacteria | 5636 |
| 490 | Ga0395900_0031185 | 3300037418 | Bacteria | 5475 |
| 491 | Ga0395900_0031609 | 3300037418 | Bacteria | 5441 |
| 492 | Ga0395900_0032993 | 3300037418 | Bacteria | 5328 |
| 493 | Ga0395900_1416257 | 3300037418 | Unclassified | 608 |
| 494 | Ga0395898_0152652 | 3300037466 | Bacteria | 2209 |
| 495 | Ga0395898_0272051 | 3300037466 | Bacteria | 1616 |
| 496 | Ga0395898_0482362 | 3300037466 | Unclassified | 1179 |
| 497 | Ga0436364_0185080 | 3300037853 | Bacteria | 45009 |
| 498 | Ga0436364_0446735 | 3300037853 | Bacteria | 53239 |
| 499 | Ga0436364_0987220 | 3300037853 | Bacteria | 1215 |
| 500 | Ga0436364_1106406 | 3300037853 | Bacteria | 1452 |
| 501 | Ga0436364_1119624 | 3300037853 | Bacteria | 872 |
| 502 | Ga0436364_1378638 | 3300037853 | Bacteria | 1640 |
| 503 | Ga0436364_1429863 | 3300037853 | Bacteria | 609 |
| 504 | Ga0436364_1536912 | 3300037853 | Bacteria | 785 |
| 505 | Ga0395901_0006392 | 3300038443 | Bacteria | 11938 |
| 506 | Ga0395901_0018024 | 3300038443 | Bacteria | 7206 |
| 507 | Ga0395901_0171512 | 3300038443 | Bacteria | 2276 |
| 508 | Ga0395901_0505052 | 3300038443 | Unclassified | 1230 |
| 509 | Ga0436365_0316452 | 3300039437 | Bacteria | 896 |
| 510 | Ga0436365_0386354 | 3300039437 | Bacteria | 1107 |
| 511 | Ga0436365_0427202 | 3300039437 | Bacteria | 2156 |
| 512 | Ga0436365_0491202 | 3300039437 | Bacteria | 1906 |
| 513 | Ga0436360_0094206 | 3300039438 | Bacteria | 2160 |
| 514 | Ga0436360_0197578 | 3300039438 | Bacteria | 4971 |
| 515 | Ga0436360_0353587 | 3300039438 | Bacteria | 953 |
| 516 | Ga0436360_0409801 | 3300039438 | Unclassified | 1301 |
| 517 | Ga0436360_0458025 | 3300039438 | Bacteria | 726 |
| 518 | Ga0436360_0502023 | 3300039438 | Bacteria | 965 |
| 519 | Ga0436360_0645967 | 3300039438 | Bacteria | 752 |
| 520 | Ga0436360_0650613 | 3300039438 | Bacteria | 891 |
| 521 | Ga0436360_0838073 | 3300039438 | Bacteria | 737 |
| 522 | Ga0436360_0891236 | 3300039438 | Bacteria | 1761 |
| 523 | Ga0436360_0946168 | 3300039438 | Bacteria | 802 |
| 524 | Ga0436360_1098357 | 3300039438 | Bacteria | 2044 |
| 525 | Ga0436360_1099895 | 3300039438 | Bacteria | 1332 |
| 526 | Ga0436360_1288869 | 3300039438 | Bacteria | 565 |
| 527 | Ga0436361_0032059 | 3300039447 | Unclassified | 1946 |
| 528 | Ga0436361_0044284 | 3300039447 | Unclassified | 1349 |
| 529 | Ga0436361_0054550 | 3300039447 | Bacteria | 885 |
| 530 | Ga0436361_0057748 | 3300039447 | Bacteria | 1745 |
| 531 | Ga0436361_0414279 | 3300039447 | Bacteria | 6141 |
| 532 | Ga0436361_0716295 | 3300039447 | Bacteria | 1146 |
| 533 | Ga0436361_0858019 | 3300039447 | Bacteria | 2085 |
| 534 | Ga0436363_0032915 | 3300039450 | Bacteria | 687 |
| 535 | Ga0436363_0546388 | 3300039450 | Unclassified | 2417 |
| 536 | Ga0436363_0683246 | 3300039450 | Bacteria | 4951 |
| 537 | Ga0436362_0110530 | 3300039453 | Bacteria | 617 |
| 538 | Ga0436362_0130052 | 3300039453 | Bacteria | 2107 |
| 539 | Ga0436362_0161717 | 3300039453 | Bacteria | 2045 |
| 540 | Ga0436362_0753708 | 3300039453 | Bacteria | 707 |
| 541 | Ga0436362_0768247 | 3300039453 | Unclassified | 869 |
| 542 | Ga0436362_0881846 | 3300039453 | Bacteria | 578 |
| 543 | Ga0436362_0938976 | 3300039453 | Bacteria | 2440 |
| 544 | Ga0436362_1141627 | 3300039453 | Bacteria | 7257 |
| 545 | Ga0436362_1303193 | 3300039453 | Unclassified | 678 |
| 546 | Ga0451577_0969163 | 3300042876 | Bacteria | 764 |
| 547 | Ga0451577_1542239 | 3300042876 | Bacteria | 587 |
| 548 | Ga0466963_0315932 | 3300044694 | Bacteria | 1099 |
| 549 | Ga0466963_0413175 | 3300044694 | Bacteria | 952 |
| 550 | Ga0466964_0532540 | 3300044706 | Bacteria | 635 |
| 551 | Ga0453684_0406030 | 3300044712 | Bacteria | 1525 |
| 552 | Ga0453684_0912933 | 3300044712 | Bacteria | 940 |
| 553 | Ga0466968_0424703 | 3300044735 | Bacteria | 654 |
| 554 | Ga0466957_0140029 | 3300044842 | Bacteria | 1558 |
| 555 | Ga0451576_0223428 | 3300045051 | Bacteria | 1966 |
| 556 | Ga0451576_0600619 | 3300045051 | Unclassified | 1157 |
| 557 | Ga0451576_0910682 | 3300045051 | Bacteria | 922 |
| 558 | Ga0466967_0064938 | 3300045976 | Bacteria | 3247 |
| 559 | Ga0466967_0522930 | 3300045976 | Bacteria | 1166 |
| 560 | Ga0466967_0736598 | 3300045976 | Unclassified | 977 |
| 561 | Ga0466967_1070005 | 3300045976 | Bacteria | 803 |
| 562 | Ga0495629_0222556 | 3300046459 | Bacteria | 1302 |
| 563 | Ga0495651_0551742 | 3300046462 | Bacteria | 732 |
| 564 | Ga0495651_0638106 | 3300046462 | Unclassified | 669 |
| 565 | Ga0495653_0174120 | 3300046463 | Unclassified | 1482 |
| 566 | Ga0495580_0167594 | 3300046472 | Bacteria | 1519 |
| 567 | Ga0495594_0206822 | 3300046499 | Bacteria | 1119 |
| 568 | Ga0495618_0796074 | 3300046514 | Unclassified | 551 |
| 569 | Ga0495628_0146500 | 3300046516 | Unclassified | 1800 |
| 570 | Ga0495628_0310959 | 3300046516 | Bacteria | 1165 |
| 571 | Ga0495644_0435729 | 3300046523 | Unclassified | 521 |
| 572 | Ga0495652_0247445 | 3300046529 | Unclassified | 1323 |
| 573 | Ga0495640_0130790 | 3300046533 | Unclassified | 1625 |
| 574 | Ga0495640_0549739 | 3300046533 | Bacteria | 700 |
| 575 | Ga0495634_0211550 | 3300046642 | Bacteria | 1200 |
| 576 | Ga0495634_0617419 | 3300046642 | Unclassified | 628 |
| 577 | Ga0495635_0098722 | 3300046663 | Bacteria | 1996 |
| 578 | Ga0495635_0605464 | 3300046663 | Bacteria | 715 |
| 579 | Ga0495599_0243488 | 3300046678 | Bacteria | 1096 |
| 580 | Ga0495600_0315917 | 3300046809 | Bacteria | 983 |
| 581 | Ga0495600_0414470 | 3300046809 | Bacteria | 837 |
| 582 | Ga0495674_0703056 | 3300047319 | Bacteria | 793 |
| 583 | Ga0495684_0092862 | 3300047471 | Bacteria | 2286 |
| 584 | Ga0495684_0116653 | 3300047471 | Bacteria | 2013 |
| 585 | Ga0495684_0341928 | 3300047471 | Bacteria | 1065 |
| 586 | Ga0495602_0136395 | 3300048088 | Bacteria | 1949 |
| 587 | Ga0496102_0087516 | 3300048905 | Bacteria | 2878 |
| 588 | Ga0496103_0316000 | 3300048906 | Unclassified | 1005 |
| 589 | Ga0496104_0264386 | 3300048907 | Bacteria | 1633 |
| 590 | Ga0496108_0075389 | 3300048911 | Bacteria | 2850 |
| 591 | Ga0496108_0789196 | 3300048911 | Unclassified | 820 |
| 592 | Ga0496109_0516875 | 3300048912 | Bacteria | 1127 |
| 593 | Ga0496109_0585581 | 3300048912 | Bacteria | 1051 |
| 594 | Ga0496112_0001187 | 3300048915 | Bacteria | 19533 |
| 595 | Ga0496112_0109097 | 3300048915 | Bacteria | 2738 |
| 596 | Ga0496112_0171107 | 3300048915 | Unclassified | 2137 |
| 597 | Ga0496112_1060535 | 3300048915 | Bacteria | 729 |
| 598 | Ga0496113_0065479 | 3300048916 | Unclassified | 2751 |
| 599 | Ga0496113_0072651 | 3300048916 | Bacteria | 2619 |
| 600 | Ga0496113_0382740 | 3300048916 | Unclassified | 1129 |
| 601 | Ga0496126_0801245 | 3300048929 | Bacteria | 723 |
| 602 | Ga0501033_0207706 | 3300049570 | Unclassified | 1397 |
| 603 | Ga0501033_0398220 | 3300049570 | Bacteria | 960 |
| 604 | Ga0501034_0194528 | 3300049571 | Unclassified | 1989 |
| 605 | Ga0501034_0359054 | 3300049571 | Bacteria | 1384 |
| 606 | Ga0501034_1005852 | 3300049571 | Bacteria | 717 |
| 607 | Ga0501036_0007120 | 3300049572 | Bacteria | 9102 |
| 608 | Ga0501036_0358134 | 3300049572 | Unclassified | 1218 |
| 609 | Ga0501036_0408047 | 3300049572 | Bacteria | 1133 |
| 610 | Ga0501037_0083899 | 3300049573 | Bacteria | 2308 |
| 611 | Ga0501038_0012324 | 3300049574 | Bacteria | 7810 |
| 612 | Ga0501038_0029552 | 3300049574 | Bacteria | 4855 |
| 613 | Ga0501038_0399460 | 3300049574 | Bacteria | 1063 |
| 614 | Ga0501039_0020415 | 3300049575 | Bacteria | 5077 |
| 615 | Ga0501039_0028248 | 3300049575 | Bacteria | 4317 |
| 616 | Ga0501039_0107803 | 3300049575 | Unclassified | 2177 |
| 617 | Ga0501040_0002063 | 3300049576 | Bacteria | 12955 |
| 618 | Ga0501041_0020237 | 3300049577 | Bacteria | 3976 |
| 619 | Ga0501041_0749992 | 3300049577 | Unclassified | 625 |
| 620 | Ga0501042_0003182 | 3300049578 | Bacteria | 10243 |
| 621 | Ga0501042_0519808 | 3300049578 | Bacteria | 865 |
| 622 | Ga0501043_0081393 | 3300049579 | Unclassified | 2544 |
| 623 | Ga0501043_0195222 | 3300049579 | Bacteria | 1573 |
| 624 | Ga0501043_0347448 | 3300049579 | Bacteria | 1127 |
| 625 | Ga0501043_0389870 | 3300049579 | Bacteria | 1053 |
| 626 | Ga0501046_0022284 | 3300049580 | Bacteria | 5218 |
| 627 | Ga0501046_0115750 | 3300049580 | Bacteria | 2044 |
| 628 | Ga0501046_0375276 | 3300049580 | Unclassified | 1030 |
| 629 | Ga0501047_0052388 | 3300049581 | Bacteria | 3945 |
| 630 | Ga0501047_0091636 | 3300049581 | Bacteria | 2918 |
| 631 | Ga0501047_0138309 | 3300049581 | Bacteria | 2315 |
| 632 | Ga0501047_0247737 | 3300049581 | Bacteria | 1631 |
| 633 | Ga0501047_0324030 | 3300049581 | Bacteria | 1380 |
| 634 | Ga0501047_0574452 | 3300049581 | Bacteria | 950 |
| 635 | Ga0501047_1072407 | 3300049581 | Archaea | 619 |
| 636 | Ga0501048_0002751 | 3300049582 | Bacteria | 13415 |
| 637 | Ga0501048_0035516 | 3300049582 | Unclassified | 3588 |
| 638 | Ga0501048_0060544 | 3300049582 | Bacteria | 2683 |
| 639 | Ga0501048_0205513 | 3300049582 | Bacteria | 1397 |
| 640 | Ga0501048_0318539 | 3300049582 | Bacteria | 1108 |
| 641 | Ga0501068_0498804 | 3300049584 | Bacteria | 790 |
| 642 | Ga0501069_0003306 | 3300049585 | Bacteria | 8273 |
| 643 | Ga0501069_0244570 | 3300049585 | Bacteria | 1046 |
| 644 | Ga0501070_0008646 | 3300049586 | Bacteria | 8605 |
| 645 | Ga0501070_0060438 | 3300049586 | Bacteria | 3141 |
| 646 | Ga0501070_0109465 | 3300049586 | Bacteria | 2283 |
| 647 | Ga0501070_0984550 | 3300049586 | Unclassified | 654 |
| 648 | Ga0501071_0000158 | 3300049587 | Bacteria | 28869 |
| 649 | Ga0501072_0001877 | 3300049588 | Bacteria | 15641 |
| 650 | Ga0501072_0058288 | 3300049588 | Bacteria | 3044 |
| 651 | Ga0501072_0127896 | 3300049588 | Bacteria | 2024 |
| 652 | Ga0501073_0220833 | 3300049589 | Bacteria | 1309 |
| 653 | Ga0501073_0727191 | 3300049589 | Unclassified | 685 |
| 654 | Ga0501074_0066386 | 3300049590 | Unclassified | 2595 |
| 655 | Ga0501074_0234010 | 3300049590 | Bacteria | 1308 |
| 656 | Ga0501074_0426548 | 3300049590 | Unclassified | 940 |
| 657 | Ga0501074_0456449 | 3300049590 | Bacteria | 906 |
| 658 | Ga0501074_0505771 | 3300049590 | Bacteria | 856 |
| 659 | Ga0501075_0000210 | 3300049591 | Bacteria | 31070 |
| 660 | Ga0501075_0162425 | 3300049591 | Bacteria | 1704 |
| 661 | Ga0501075_0579316 | 3300049591 | Bacteria | 856 |
| 662 | Ga0501076_0000278 | 3300049592 | Bacteria | 31876 |
| 663 | Ga0501076_1203403 | 3300049592 | Bacteria | 623 |
| 664 | Ga0501077_0000232 | 3300049593 | Bacteria | 32893 |
| 665 | Ga0501079_0034701 | 3300049741 | Bacteria | 3881 |
| 666 | Ga0501079_0051431 | 3300049741 | Unclassified | 3181 |
| 667 | Ga0501079_1085517 | 3300049741 | Unclassified | 631 |
| 668 | Ga0501080_0008286 | 3300049742 | Bacteria | 9417 |
| 669 | Ga0501080_0105003 | 3300049742 | Bacteria | 2619 |
| 670 | Ga0501080_0193695 | 3300049742 | Bacteria | 1867 |
| 671 | Ga0501080_0436443 | 3300049742 | Bacteria | 1175 |
| 672 | Ga0501080_0953670 | 3300049742 | Unclassified | 746 |
| 673 | Ga0501080_1025761 | 3300049742 | Unclassified | 715 |
| 674 | Ga0501080_1162384 | 3300049742 | Bacteria | 665 |
| 675 | Ga0501081_0000478 | 3300049743 | Bacteria | 22251 |
| 676 | Ga0501081_0023101 | 3300049743 | Bacteria | 4166 |
| 677 | Ga0501083_0027089 | 3300049744 | Bacteria | 3957 |
| 678 | Ga0501083_0257509 | 3300049744 | Unclassified | 1135 |
| 679 | Ga0501083_0368851 | 3300049744 | Bacteria | 934 |
| 680 | Ga0501035_0060812 | 3300049822 | Bacteria | 3363 |
| 681 | Ga0501035_0580516 | 3300049822 | Bacteria | 915 |
| 682 | Ga0501044_0000173 | 3300049823 | Bacteria | 79909 |
| 683 | Ga0501044_0144801 | 3300049823 | Bacteria | 2362 |
| 684 | Ga0501044_0149263 | 3300049823 | Bacteria | 2321 |
| 685 | Ga0501044_0244415 | 3300049823 | Bacteria | 1738 |
| 686 | Ga0501044_1138017 | 3300049823 | Unclassified | 649 |
| 687 | Ga0501044_1264886 | 3300049823 | Bacteria | 605 |
| 688 | Ga0501045_0001482 | 3300049824 | Bacteria | 15604 |
| 689 | nmdc:mga05p37_18943_c1 | 3300050507 | Bacteria | 8323 |
| 690 | nmdc:mga06r32_1364579_c1 | 3300050510 | Unclassified | 651 |
| 691 | nmdc:mga06r32_161069_c1 | 3300050510 | Bacteria | 2226 |
| 692 | nmdc:mga06r32_409064_c1 | 3300050510 | Unclassified | 1338 |
| 693 | nmdc:mga08y16_150188_c1 | 3300050511 | Bacteria | 2422 |
| 694 | nmdc:mga08y16_688809_c1 | 3300050511 | Unclassified | 1023 |
| 695 | nmdc:mga0n895_2250_c1 | 3300050512 | Bacteria | 14957 |
| 696 | nmdc:mga0n895_2726_c1 | 3300050512 | Bacteria | 13932 |
| 697 | nmdc:mga0n895_41842_c1 | 3300050512 | Bacteria | 4456 |
| 698 | nmdc:mga0n895_756309_c1 | 3300050512 | Unclassified | 965 |
| 699 | nmdc:mga0n895_780334_c1 | 3300050512 | Bacteria | 947 |
| 700 | nmdc:mga0n895_91031_c1 | 3300050512 | Unclassified | 3052 |
| 701 | nmdc:mga0rr50_107361_c1 | 3300050513 | Bacteria | 2204 |
| 702 | nmdc:mga0rr50_550899_c1 | 3300050513 | Unclassified | 982 |
| 703 | nmdc:mga08x19_179937_c1 | 3300050514 | Bacteria | 1443 |
| 704 | nmdc:mga08x19_359377_c1 | 3300050514 | Bacteria | 1018 |
| 705 | nmdc:mga08x19_5419_c2 | 3300050514 | Bacteria | 976 |
| 706 | nmdc:mga0a205_26798_c1 | 3300050515 | Bacteria | 5500 |
| 707 | nmdc:mga0a205_37865_c1 | 3300050515 | Bacteria | 4638 |
| 708 | nmdc:mga0a205_684969_c1 | 3300050515 | Unclassified | 875 |
| 709 | nmdc:mga0a205_77206_c2 | 3300050515 | Bacteria | 2266 |
| 710 | Ga0495601_0011260 | 3300053077 | Bacteria | 5345 |
| 711 | Ga0495601_0020713 | 3300053077 | Bacteria | 4018 |
| 712 | Ga0495601_0337193 | 3300053077 | Bacteria | 981 |
| 713 | Ga0495595_0002839 | 3300053084 | Bacteria | 6817 |
| 714 | Ga0495619_0037089 | 3300053085 | Bacteria | 3175 |
| 715 | Ga0495619_0042479 | 3300053085 | Bacteria | 2977 |
| 716 | Ga0495619_0234534 | 3300053085 | Unclassified | 1271 |
| 717 | Ga0495619_0239371 | 3300053085 | Unclassified | 1258 |
| 718 | Ga0500595_118094 | 3300053119 | Bacteria | 751 |
| 719 | Ga0501084_0069166 | 3300054114 | Unclassified | 2955 |
| 720 | Ga0501084_0187041 | 3300054114 | Unclassified | 1748 |
| 721 | Ga0501084_1006113 | 3300054114 | Unclassified | 700 |
| 722 | Ga0587070_053073 | 3300059491 | Unclassified | 815 |
| 723 | Ga0587085_109672 | 3300059506 | Bacteria | 593 |
| 724 | Ga0587091_084522 | 3300059511 | Bacteria | 718 |
| 725 | Ga0501082_0031459 | 3300060353 | Bacteria | 4576 |
| 726 | Ga0501082_0234341 | 3300060353 | Bacteria | 1598 |
| 727 | Ga0501082_0248420 | 3300060353 | Bacteria | 1548 |
| 728 | Ga0530510_0002585 | 3300061734 | Bacteria | 12433 |
| 729 | Ga0530510_0074024 | 3300061734 | Bacteria | 2473 |
| 730 | Ga0530510_0367950 | 3300061734 | Unclassified | 1081 |
| 731 | Ga0530510_0802319 | 3300061734 | Unclassified | 718 |
| 732 | Ga0501070_0042502 | |||
| 733 | JGI25406J46586_10004491 | |||
| 734 | Ga0058862_10001543 | |||
| 735 | Ga0065714_10138008 | |||
| 736 | Ga0065712_10000161 | |||
| 737 | Ga0065712_10126453 | |||
| 738 | Ga0065715_10002397 | |||
| 739 | Ga0065715_10009377 | |||
| 740 | Ga0065707_10247051 | |||
| 741 | Ga0070658_10451423 | |||
| 742 | Ga0070676_10004921 | |||
| 743 | Ga0070683_100793715 | |||
| 744 | Ga0070690_100018565 | |||
| 745 | Ga0070690_100320460 | |||
| 746 | Ga0070670_100000611 | |||
| 747 | Ga0070670_100156603 | |||
| 748 | Ga0070677_10019792 | |||
| 749 | Ga0068869_100066289 | |||
| 750 | Ga0070666_10055281 | |||
| 751 | Ga0070666_10284450 | |||
| 752 | Ga0070680_100004460 | |||
| 753 | Ga0070680_100031322 | |||
| 754 | Ga0070680_100053500 | |||
| 755 | Ga0070680_100401330 | |||
| 756 | Ga0070680_100626282 | |||
| 757 | Ga0070680_100955265 | |||
| 758 | Ga0070680_101220327 | |||
| 759 | Ga0070682_100071064 | |||
| 760 | Ga0068868_100030967 | |||
| 761 | Ga0070660_100176581 | |||
| 762 | Ga0070689_100079524 | |||
| 763 | Ga0070689_100412826 | |||
| 764 | Ga0070691_10044291 | |||
| 765 | Ga0070691_10063895 | |||
| 766 | Ga0070687_100222397 | |||
| 767 | Ga0070661_100141453 | |||
| 768 | Ga0070661_100260926 | |||
| 769 | Ga0070692_10506603 | |||
| 770 | Ga0070692_10583690 | |||
| 771 | Ga0070669_100069079 | |||
| 772 | Ga0070675_100133109 | |||
| 773 | Ga0070671_100066312 | |||
| 774 | Ga0070674_100078636 | |||
| 775 | Ga0070674_101144265 | |||
| 776 | Ga0070673_100024014 | |||
| 777 | Ga0070673_100151887 | |||
| 778 | Ga0070673_101022766 | |||
| 779 | Ga0070688_100059766 | |||
| 780 | Ga0070659_100037236 | |||
| 781 | Ga0070659_100048394 | |||
| 782 | Ga0070667_100137663 | |||
| 783 | Ga0070667_101243362 | |||
| 784 | Ga0070667_101330650 | |||
| 785 | Ga0070709_10024351 | |||
| 786 | Ga0070709_10115764 | |||
| 787 | Ga0070714_100061561 | |||
| 788 | Ga0070714_100218257 | |||
| 789 | Ga0070714_100353028 | |||
| 790 | Ga0070714_100359697 | |||
| 791 | Ga0070714_100731373 | |||
| 792 | Ga0070713_100067769 | |||
| 793 | Ga0070713_100077645 | |||
| 794 | Ga0070713_100255294 | |||
| 795 | Ga0070713_100494594 | |||
| 796 | Ga0070710_10003156 | |||
| 797 | Ga0070710_10023819 | |||
| 798 | Ga0070710_10429871 | |||
| 799 | Ga0070711_100086788 | |||
| 800 | Ga0070711_100317022 | |||
| 801 | Ga0070711_100507767 | |||
| 802 | Ga0070711_100662776 | |||
| 803 | Ga0070705_100013941 | |||
| 804 | Ga0070705_100220043 | |||
| 805 | Ga0070700_100232771 | |||
| 806 | Ga0070700_100332630 | |||
| 807 | Ga0070700_100716931 | |||
| 808 | Ga0070694_100073149 | |||
| 809 | Ga0070694_100295868 | |||
| 810 | Ga0070694_100318608 | |||
| 811 | Ga0070694_100632353 | |||
| 812 | Ga0070708_100254941 | |||
| 813 | Ga0070663_100020480 | |||
| 814 | Ga0070678_100039105 | |||
| 815 | Ga0070678_100363666 | |||
| 816 | Ga0070662_100179839 | |||
| 817 | Ga0070662_100253171 | |||
| 818 | Ga0070681_10003972 | |||
| 819 | Ga0070681_10007797 | |||
| 820 | Ga0070681_10009896 | |||
| 821 | Ga0070681_10058222 | |||
| 822 | Ga0070681_10082655 | |||
| 823 | Ga0070681_10884854 | |||
| 824 | Ga0068867_100194627 | |||
| 825 | Ga0068867_101010122 | |||
| 826 | Ga0070706_100275990 | |||
| 827 | Ga0070706_100278809 | |||
| 828 | Ga0070707_100728302 | |||
| 829 | Ga0070698_100501381 | |||
| 830 | Ga0070698_101001900 | |||
| 831 | Ga0070699_100109530 | |||
| 832 | Ga0070699_100552919 | |||
| 833 | Ga0070699_100626976 | |||
| 834 | Ga0070679_100005562 | |||
| 835 | Ga0070679_100058290 | |||
| 836 | Ga0070679_100060576 | |||
| 837 | Ga0070679_100148161 | |||
| 838 | Ga0070684_100079334 | |||
| 839 | Ga0070684_100091144 | |||
| 840 | Ga0070697_100058232 | |||
| 841 | Ga0070697_100391952 | |||
| 842 | Ga0070697_100825737 | |||
| 843 | Ga0068853_100257246 | |||
| 844 | Ga0070672_100001632 | |||
| 845 | Ga0070686_100058156 | |||
| 846 | Ga0070686_101205924 | |||
| 847 | Ga0070695_100014670 | |||
| 848 | Ga0070695_100015040 | |||
| 849 | Ga0070695_100578270 | |||
| 850 | Ga0070695_100698540 | |||
| 851 | Ga0070696_100022644 | |||
| 852 | Ga0070696_100048551 | |||
| 853 | Ga0070696_100119610 | |||
| 854 | Ga0070696_100605329 | |||
| 855 | Ga0070693_100093605 | |||
| 856 | Ga0070693_100215148 | |||
| 857 | Ga0070665_100573665 | |||
| 858 | Ga0070704_100150305 | |||
| 859 | Ga0070704_100393339 | |||
| 860 | Ga0070704_100878426 | |||
| 861 | Ga0068855_100053393 | |||
| 862 | Ga0068855_100166268 | |||
| 863 | Ga0068855_100384323 | |||
| 864 | Ga0070664_100004308 | |||
| 865 | Ga0070664_100065384 | |||
| 866 | Ga0070664_100403057 | |||
| 867 | Ga0070664_100429775 | |||
| 868 | Ga0070664_101090314 | |||
| 869 | Ga0068857_100033080 | |||
| 870 | Ga0068857_100135526 | |||
| 871 | Ga0068857_100136648 | |||
| 872 | Ga0068854_100231290 | |||
| 873 | Ga0068856_100118477 | |||
| 874 | Ga0068856_100310452 | |||
| 875 | Ga0068856_100336259 | |||
| 876 | Ga0068856_100985059 | |||
| 877 | Ga0070702_100071436 | |||
| 878 | Ga0070702_101210255 | |||
| 879 | Ga0068852_100310188 | |||
| 880 | Ga0068852_100391080 | |||
| 881 | Ga0068859_100184316 | |||
| 882 | Ga0068864_100332802 | |||
| 883 | Ga0068864_101841082 | |||
| 884 | Ga0068866_10307708 | |||
| 885 | Ga0068866_10471687 | |||
| 886 | Ga0068866_10654110 | |||
| 887 | Ga0068863_100492708 | |||
| 888 | Ga0068858_100019185 | |||
| 889 | Ga0068860_100025336 | |||
| 890 | Ga0068860_100121016 | |||
| 891 | Ga0068860_100687900 | |||
| 892 | Ga0068862_100221260 | |||
| 893 | Ga0068862_100365561 | |||
| 894 | Ga0081455_10000599 | |||
| 895 | Ga0081455_10001044 | |||
| 896 | Ga0081455_10174134 | |||
| 897 | Ga0081455_10699393 | |||
| 898 | Ga0081539_10000025 | |||
| 899 | Ga0070717_10010359 | |||
| 900 | Ga0070717_10293721 | |||
| 901 | Ga0070717_10295192 | |||
| 902 | Ga0070712_100040351 | |||
| 903 | Ga0070712_100101850 | |||
| 904 | Ga0097621_100180093 | |||
| 905 | Ga0097621_101184891 | |||
| 906 | Ga0068871_101715650 | |||
| 907 | Ga0075428_100628055 | |||
| 908 | Ga0075428_100949669 | |||
| 909 | Ga0075430_100169054 | |||
| 910 | Ga0075431_100152408 | |||
| 911 | Ga0075431_100172680 | |||
| 912 | Ga0075431_101931864 | |||
| 913 | Ga0075433_10002145 | |||
| 914 | Ga0075433_10317763 | |||
| 915 | Ga0075434_100002497 | |||
| 916 | Ga0075434_100011393 | |||
| 917 | Ga0075434_100032505 | |||
| 918 | Ga0075434_100278054 | |||
| 919 | Ga0075434_100402482 | |||
| 920 | Ga0075434_100627766 | |||
| 921 | Ga0075434_100853358 | |||
| 922 | Ga0075429_100531177 | |||
| 923 | Ga0068865_100106399 | |||
| 924 | Ga0075436_100073073 | |||
| 925 | Ga0075436_100102792 | |||
| 926 | Ga0075436_100268186 | |||
| 927 | Ga0097620_100184307 | |||
| 928 | Ga0075435_100036145 | |||
| 929 | Ga0075435_100092823 | |||
| 930 | Ga0075435_100548945 | |||
| 931 | Ga0075435_100590542 | |||
| 932 | Ga0099794_10161018 | |||
| 933 | Ga0099795_10006448 | |||
| 934 | Ga0099795_10243722 | |||
| 935 | Ga0099795_10297466 | |||
| 936 | Ga0105240_10051632 | |||
| 937 | Ga0105240_10088315 | |||
| 938 | Ga0105240_10166179 | |||
| 939 | Ga0105240_10631758 | |||
| 940 | Ga0105240_11019637 | |||
| 941 | Ga0105240_11406011 | |||
| 942 | Ga0111539_10144128 | |||
| 943 | Ga0111539_10173266 | |||
| 944 | Ga0111539_10370602 | |||
| 945 | Ga0111539_10553599 | |||
| 946 | Ga0111539_10675735 | |||
| 947 | Ga0111539_10943030 | |||
| 948 | Ga0105245_10250673 | |||
| 949 | Ga0105247_10786240 | |||
| 950 | Ga0114129_10663775 | |||
| 951 | Ga0114129_11051180 | |||
| 952 | Ga0105243_10215451 | |||
| 953 | Ga0105241_10115820 | |||
| 954 | Ga0105241_10698552 | |||
| 955 | Ga0105241_10893483 | |||
| 956 | Ga0105241_10919079 | |||
| 957 | Ga0105242_10480320 | |||
| 958 | Ga0105248_10799879 | |||
| 959 | Ga0105248_11183504 | |||
| 960 | Ga0105248_12619600 | |||
| 961 | Ga0105237_10218512 | |||
| 962 | Ga0105237_10573009 | |||
| 963 | Ga0105237_11084276 | |||
| 964 | Ga0105238_10293747 | |||
| 965 | Ga0105238_10878401 | |||
| 966 | Ga0105249_10062669 | |||
| 967 | Ga0105249_10280782 | |||
| 968 | Ga0105249_11335165 | |||
| 969 | Ga0099796_10295784 | |||
| 970 | Ga0105239_10048921 | |||
| 971 | Ga0105239_11119622 | |||
| 972 | Ga0105246_10013668 | |||
| 973 | Ga0105246_10224919 | |||
| 974 | Ga0105246_10453781 | |||
| 975 | Ga0157373_10509118 | |||
| 976 | Ga0157371_10155064 | |||
| 977 | Ga0157371_10167231 | |||
| 978 | Ga0157370_10027321 | |||
| 979 | Ga0157370_10032626 | |||
| 980 | Ga0157370_10072332 | |||
| 981 | Ga0157370_10181126 | |||
| 982 | Ga0157370_10839159 | |||
| 983 | Ga0157369_10050418 | |||
| 984 | Ga0157369_10228072 | |||
| 985 | Ga0157369_10327632 | |||
| 986 | Ga0157369_11516386 | |||
| 987 | Ga0157374_10207110 | |||
| 988 | Ga0157378_10034425 | |||
| 989 | Ga0157378_10047931 | |||
| 990 | Ga0157378_10149185 | |||
| 991 | Ga0157378_10330275 | |||
| 992 | Ga0163162_10084341 | |||
| 993 | Ga0163162_10470502 | |||
| 994 | Ga0163162_10665743 | |||
| 995 | Ga0163162_11045831 | |||
| 996 | Ga0163162_11192868 | |||
| 997 | Ga0163162_11435603 | |||
| 998 | Ga0157372_10177244 | |||
| 999 | Ga0157372_11700776 | |||
| 1000 | Ga0157375_10125124 | |||
| 1001 | Ga0163163_10052057 | |||
| 1002 | Ga0163163_10434344 | |||
| 1003 | Ga0163163_11032143 | |||
| 1004 | Ga0157380_10875333 | |||
| 1005 | Ga0182008_10016665 | |||
| 1006 | Ga0157377_10512966 | |||
| 1007 | Ga0157379_10382838 | |||
| 1008 | Ga0157379_12138648 | |||
| 1009 | Ga0157376_10054061 | |||
| 1010 | Ga0163161_10120194 | |||
| 1011 | Ga0163161_10660971 | |||
| 1012 | Ga0197907_10981873 | |||
| 1013 | Ga0197907_11482104 | |||
| 1014 | Ga0206356_11064732 | |||
| 1015 | Ga0206356_11089989 | |||
| 1016 | Ga0206355_1275391 | |||
| 1017 | Ga0206352_10872377 | |||
| 1018 | Ga0206350_10936941 | |||
| 1019 | Ga0206350_11009195 | |||
| 1020 | Ga0206353_10521041 | |||
| 1021 | Ga0213873_10023397 | |||
| 1022 | Ga0213873_10025919 | |||
| 1023 | Ga0213872_10356609 | |||
| 1024 | Ga0213874_10065388 | |||
| 1025 | Ga0213876_10098173 | |||
| 1026 | Ga0213876_10107961 | |||
| 1027 | Ga0213875_10001005 | |||
| 1028 | Ga0213875_10017557 | |||
| 1029 | Ga0213875_10232180 | |||
| 1030 | Ga0213875_10328147 | |||
| 1031 | Ga0213871_10064375 | |||
| 1032 | Ga0213871_10104635 | |||
| 1033 | Ga0224712_10093610 | |||
| 1034 | Ga0224712_10323931 | |||
| 1035 | Ga0224712_10423511 | |||
| 1036 | Ga0224712_10479571 | |||
| 1037 | Ga0224712_10576516 | |||
| 1038 | Ga0207697_10030991 | |||
| 1039 | Ga0207697_10093693 | |||
| 1040 | Ga0207682_10053192 | |||
| 1041 | Ga0207692_10324812 | |||
| 1042 | Ga0207692_10371836 | |||
| 1043 | Ga0207642_10271696 | |||
| 1044 | Ga0207642_10384775 | |||
| 1045 | Ga0207688_10001647 | |||
| 1046 | Ga0207680_10210763 | |||
| 1047 | Ga0207680_11011930 | |||
| 1048 | Ga0207647_10100540 | |||
| 1049 | Ga0207647_10271074 | |||
| 1050 | Ga0207699_10067702 | |||
| 1051 | Ga0207699_10261732 | |||
| 1052 | Ga0207645_10000665 | |||
| 1053 | Ga0207705_10076065 | |||
| 1054 | Ga0207705_10907991 | |||
| 1055 | Ga0207684_10083893 | |||
| 1056 | Ga0207684_10219399 | |||
| 1057 | Ga0207654_10397741 | |||
| 1058 | Ga0207707_10009330 | |||
| 1059 | Ga0207707_10026955 | |||
| 1060 | Ga0207707_10103105 | |||
| 1061 | Ga0207707_10125490 | |||
| 1062 | Ga0207707_10149818 | |||
| 1063 | Ga0207707_10343489 | |||
| 1064 | Ga0207707_10462920 | |||
| 1065 | Ga0207707_10710419 | |||
| 1066 | Ga0207695_10074547 | |||
| 1067 | Ga0207695_10384051 | |||
| 1068 | Ga0207695_10447013 | |||
| 1069 | Ga0207695_10518914 | |||
| 1070 | Ga0207695_11543845 | |||
| 1071 | Ga0207671_10534312 | |||
| 1072 | Ga0207693_10003546 | |||
| 1073 | Ga0207693_10248339 | |||
| 1074 | Ga0207693_11012413 | |||
| 1075 | Ga0207663_10027943 | |||
| 1076 | Ga0207663_10061491 | |||
| 1077 | Ga0207663_10394356 | |||
| 1078 | Ga0207660_10026629 | |||
| 1079 | Ga0207660_10387159 | |||
| 1080 | Ga0207660_10531762 | |||
| 1081 | Ga0207662_10285311 | |||
| 1082 | Ga0207657_10030265 | |||
| 1083 | Ga0207657_10468294 | |||
| 1084 | Ga0207649_10051588 | |||
| 1085 | Ga0207649_10052250 | |||
| 1086 | Ga0207652_10009020 | |||
| 1087 | Ga0207652_10106988 | |||
| 1088 | Ga0207652_10129264 | |||
| 1089 | Ga0207652_10284636 | |||
| 1090 | Ga0207652_10288920 | |||
| 1091 | Ga0207646_10647840 | |||
| 1092 | Ga0207646_10649514 | |||
| 1093 | Ga0207681_10183742 | |||
| 1094 | Ga0207694_11250222 | |||
| 1095 | Ga0207650_10004361 | |||
| 1096 | Ga0207650_10056046 | |||
| 1097 | Ga0207659_10384990 | |||
| 1098 | Ga0207687_10258293 | |||
| 1099 | Ga0207700_10024739 | |||
| 1100 | Ga0207700_10068486 | |||
| 1101 | Ga0207700_10156580 | |||
| 1102 | Ga0207700_10584865 | |||
| 1103 | Ga0207700_10918264 | |||
| 1104 | Ga0207700_11313970 | |||
| 1105 | Ga0207664_10025166 | |||
| 1106 | Ga0207664_10181886 | |||
| 1107 | Ga0207664_11252778 | |||
| 1108 | Ga0207644_10273826 | |||
| 1109 | Ga0207690_10315536 | |||
| 1110 | Ga0207706_10036452 | |||
| 1111 | Ga0207706_10283341 | |||
| 1112 | Ga0207670_10129128 | |||
| 1113 | Ga0207670_10282416 | |||
| 1114 | Ga0207670_10996614 | |||
| 1115 | Ga0207669_10217907 | |||
| 1116 | Ga0207665_10165395 | |||
| 1117 | Ga0207665_10314774 | |||
| 1118 | Ga0207691_10001474 | |||
| 1119 | Ga0207691_10781204 | |||
| 1120 | Ga0207689_10025031 | |||
| 1121 | Ga0207661_10256785 | |||
| 1122 | Ga0207661_10575607 | |||
| 1123 | Ga0207661_10886455 | |||
| 1124 | Ga0207679_10011173 | |||
| 1125 | Ga0207679_10584700 | |||
| 1126 | Ga0207679_10976501 | |||
| 1127 | Ga0207667_10103756 | |||
| 1128 | Ga0207667_10406281 | |||
| 1129 | Ga0207667_10689032 | |||
| 1130 | Ga0207667_11258541 | |||
| 1131 | Ga0207651_10129010 | |||
| 1132 | Ga0207651_10208131 | |||
| 1133 | Ga0207651_10851478 | |||
| 1134 | Ga0207712_10318624 | |||
| 1135 | Ga0207658_10441908 | |||
| 1136 | Ga0207677_10370862 | |||
| 1137 | Ga0207703_10381727 | |||
| 1138 | Ga0207639_10453363 | |||
| 1139 | Ga0207678_10035816 | |||
| 1140 | Ga0207708_10274914 | |||
| 1141 | Ga0207708_10603484 | |||
| 1142 | Ga0207702_10033806 | |||
| 1143 | Ga0207702_10075627 | |||
| 1144 | Ga0207702_10317557 | |||
| 1145 | Ga0207702_10910955 | |||
| 1146 | Ga0207648_10013103 | |||
| 1147 | Ga0207648_10231846 | |||
| 1148 | Ga0207676_10751783 | |||
| 1149 | Ga0207674_10179458 | |||
| 1150 | Ga0207674_10269560 | |||
| 1151 | Ga0207674_10343608 | |||
| 1152 | Ga0207683_10001563 | |||
| 1153 | Ga0207683_10045547 | |||
| 1154 | Ga0207698_10576266 | |||
| 1155 | Ga0209984_1029552 | |||
| 1156 | Ga0209179_1034269 | |||
| 1157 | Ga0210002_1000936 | |||
| 1158 | Ga0209971_1008182 | |||
| 1159 | Ga0209966_1003306 | |||
| 1160 | Ga0209974_10000574 | |||
| 1161 | Ga0268266_10679205 | |||
| 1162 | Ga0268265_10668493 | |||
| 1163 | Ga0268264_10052164 | |||
| 1164 | Ga0268264_10344902 | |||
| 1165 | Ga0268264_11096370 | |||
| 1166 | Ga0265338_10004828 | |||
| 1167 | Ga0265324_10087107 | |||
| 1168 | Ga0265325_10003410 | |||
| 1169 | Ga0265325_10346819 | |||
| 1170 | Ga0265339_10000269 | |||
| 1171 | Ga0265313_10001274 | |||
| 1172 | Ga0265313_10362438 | |||
| 1173 | Ga0265342_10038800 | |||
| 1174 | Ga0307405_10163208 | |||
| 1175 | Ga0316053_111185 | |||
| 1176 | Ga0373926_0013111 | |||
| 1177 | Ga0373940_0032842 | |||
| 1178 | Ga0373944_0059953 | |||
| 1179 | Ga0373923_0192213 | |||
| 1180 | Ga0373932_0051460 | |||
| 1181 | Ga0373932_0254474 | |||
| 1182 | Ga0373936_0024625 | |||
| 1183 | Ga0373936_0184477 | |||
| 1184 | Ga0373945_0067720 | |||
| 1185 | Ga0373953_0044310 | |||
| 1186 | Ga0373954_0046862 | |||
| 1187 | Ga0373954_0201795 | |||
| 1188 | Ga0373956_0039984 | |||
| 1189 | Ga0373957_0029106 | |||
| 1190 | Ga0373943_0176668 | |||
| 1191 | Ga0373946_0145580 | |||
| 1192 | Ga0373955_0064515 | |||
| 1193 | Ga0373931_0083593 | |||
| 1194 | Ga0373931_0095945 | |||
| 1195 | Ga0373931_0234453 | |||
| 1196 | Ga0373931_0490566 | |||
| 1197 | Ga0373931_0498105 | |||
| 1198 | Ga0373931_0529672 | |||
| 1199 | Ga0373935_0033347 | |||
| 1200 | Ga0373927_0194610 | |||
| 1201 | Ga0373933_0158293 | |||
| 1202 | Ga0373947_0020812 | |||
| 1203 | Ga0373947_0215193 | |||
| 1204 | Ga0373947_0285647 | |||
| 1205 | Ga0373947_0420661 | |||
| 1206 | Ga0373937_0009912 | |||
| 1207 | Ga0373937_0012026 | |||
| 1208 | Ga0373937_0090950 | |||
| 1209 | Ga0373937_0106047 | |||
| 1210 | Ga0373937_0635677 | |||
| 1211 | Ga0373937_1478562 | |||
| 1212 | Ga0373925_0027027 | |||
| 1213 | Ga0373925_0046734 | |||
| 1214 | Ga0373925_0324145 | |||
| 1215 | Ga0395899_0005717 | |||
| 1216 | Ga0395899_0006224 | |||
| 1217 | Ga0395899_0071003 | |||
| 1218 | Ga0395899_0503723 | |||
| 1219 | Ga0395900_0005139 | |||
| 1220 | Ga0395900_0029412 | |||
| 1221 | Ga0395900_0031185 | |||
| 1222 | Ga0395900_0031609 | |||
| 1223 | Ga0395900_0032993 | |||
| 1224 | Ga0395900_1416257 | |||
| 1225 | Ga0395898_0152652 | |||
| 1226 | Ga0395898_0272051 | |||
| 1227 | Ga0395898_0482362 | |||
| 1228 | Ga0436364_0185080 | |||
| 1229 | Ga0436364_0446735 | |||
| 1230 | Ga0436364_0987220 | |||
| 1231 | Ga0436364_1106406 | |||
| 1232 | Ga0436364_1119624 | |||
| 1233 | Ga0436364_1378638 | |||
| 1234 | Ga0436364_1429863 | |||
| 1235 | Ga0436364_1536912 | |||
| 1236 | Ga0395901_0006392 | |||
| 1237 | Ga0395901_0018024 | |||
| 1238 | Ga0395901_0171512 | |||
| 1239 | Ga0395901_0505052 | |||
| 1240 | Ga0436365_0316452 | |||
| 1241 | Ga0436365_0386354 | |||
| 1242 | Ga0436365_0427202 | |||
| 1243 | Ga0436365_0491202 | |||
| 1244 | Ga0436360_0094206 | |||
| 1245 | Ga0436360_0197578 | |||
| 1246 | Ga0436360_0353587 | |||
| 1247 | Ga0436360_0409801 | |||
| 1248 | Ga0436360_0458025 | |||
| 1249 | Ga0436360_0502023 | |||
| 1250 | Ga0436360_0645967 | |||
| 1251 | Ga0436360_0650613 | |||
| 1252 | Ga0436360_0838073 | |||
| 1253 | Ga0436360_0891236 | |||
| 1254 | Ga0436360_0946168 | |||
| 1255 | Ga0436360_1098357 | |||
| 1256 | Ga0436360_1099895 | |||
| 1257 | Ga0436360_1288869 | |||
| 1258 | Ga0436361_0032059 | |||
| 1259 | Ga0436361_0044284 | |||
| 1260 | Ga0436361_0054550 | |||
| 1261 | Ga0436361_0057748 | |||
| 1262 | Ga0436361_0414279 | |||
| 1263 | Ga0436361_0716295 | |||
| 1264 | Ga0436361_0858019 | |||
| 1265 | Ga0436363_0032915 | |||
| 1266 | Ga0436363_0546388 | |||
| 1267 | Ga0436363_0683246 | |||
| 1268 | Ga0436362_0110530 | |||
| 1269 | Ga0436362_0130052 | |||
| 1270 | Ga0436362_0161717 | |||
| 1271 | Ga0436362_0753708 | |||
| 1272 | Ga0436362_0768247 | |||
| 1273 | Ga0436362_0881846 | |||
| 1274 | Ga0436362_0938976 | |||
| 1275 | Ga0436362_1141627 | |||
| 1276 | Ga0436362_1303193 | |||
| 1277 | Ga0451577_0969163 | |||
| 1278 | Ga0451577_1542239 | |||
| 1279 | Ga0466963_0315932 | |||
| 1280 | Ga0466963_0413175 | |||
| 1281 | Ga0466964_0532540 | |||
| 1282 | Ga0453684_0406030 | |||
| 1283 | Ga0453684_0912933 | |||
| 1284 | Ga0466968_0424703 | |||
| 1285 | Ga0466957_0140029 | |||
| 1286 | Ga0451576_0223428 | |||
| 1287 | Ga0451576_0600619 | |||
| 1288 | Ga0451576_0910682 | |||
| 1289 | Ga0466967_0064938 | |||
| 1290 | Ga0466967_0522930 | |||
| 1291 | Ga0466967_0736598 | |||
| 1292 | Ga0466967_1070005 | |||
| 1293 | Ga0495629_0222556 | |||
| 1294 | Ga0495651_0551742 | |||
| 1295 | Ga0495651_0638106 | |||
| 1296 | Ga0495653_0174120 | |||
| 1297 | Ga0495580_0167594 | |||
| 1298 | Ga0495594_0206822 | |||
| 1299 | Ga0495618_0796074 | |||
| 1300 | Ga0495628_0146500 | |||
| 1301 | Ga0495628_0310959 | |||
| 1302 | Ga0495644_0435729 | |||
| 1303 | Ga0495652_0247445 | |||
| 1304 | Ga0495640_0130790 | |||
| 1305 | Ga0495640_0549739 | |||
| 1306 | Ga0495634_0211550 | |||
| 1307 | Ga0495634_0617419 | |||
| 1308 | Ga0495635_0098722 | |||
| 1309 | Ga0495635_0605464 | |||
| 1310 | Ga0495599_0243488 | |||
| 1311 | Ga0495600_0315917 | |||
| 1312 | Ga0495600_0414470 | |||
| 1313 | Ga0495674_0703056 | |||
| 1314 | Ga0495684_0092862 | |||
| 1315 | Ga0495684_0116653 | |||
| 1316 | Ga0495684_0341928 | |||
| 1317 | Ga0495602_0136395 | |||
| 1318 | Ga0496102_0087516 | |||
| 1319 | Ga0496103_0316000 | |||
| 1320 | Ga0496104_0264386 | |||
| 1321 | Ga0496108_0075389 | |||
| 1322 | Ga0496108_0789196 | |||
| 1323 | Ga0496109_0516875 | |||
| 1324 | Ga0496109_0585581 | |||
| 1325 | Ga0496112_0001187 | |||
| 1326 | Ga0496112_0109097 | |||
| 1327 | Ga0496112_0171107 | |||
| 1328 | Ga0496112_1060535 | |||
| 1329 | Ga0496113_0065479 | |||
| 1330 | Ga0496113_0072651 | |||
| 1331 | Ga0496113_0382740 | |||
| 1332 | Ga0496126_0801245 | |||
| 1333 | Ga0501033_0207706 | |||
| 1334 | Ga0501033_0398220 | |||
| 1335 | Ga0501034_0194528 | |||
| 1336 | Ga0501034_0359054 | |||
| 1337 | Ga0501034_1005852 | |||
| 1338 | Ga0501036_0007120 | |||
| 1339 | Ga0501036_0358134 | |||
| 1340 | Ga0501036_0408047 | |||
| 1341 | Ga0501037_0083899 | |||
| 1342 | Ga0501038_0012324 | |||
| 1343 | Ga0501038_0029552 | |||
| 1344 | Ga0501038_0399460 | |||
| 1345 | Ga0501039_0020415 | |||
| 1346 | Ga0501039_0028248 | |||
| 1347 | Ga0501039_0107803 | |||
| 1348 | Ga0501040_0002063 | |||
| 1349 | Ga0501041_0020237 | |||
| 1350 | Ga0501041_0749992 | |||
| 1351 | Ga0501042_0003182 | |||
| 1352 | Ga0501042_0519808 | |||
| 1353 | Ga0501043_0081393 | |||
| 1354 | Ga0501043_0195222 | |||
| 1355 | Ga0501043_0347448 | |||
| 1356 | Ga0501043_0389870 | |||
| 1357 | Ga0501046_0022284 | |||
| 1358 | Ga0501046_0115750 | |||
| 1359 | Ga0501046_0375276 | |||
| 1360 | Ga0501047_0052388 | |||
| 1361 | Ga0501047_0091636 | |||
| 1362 | Ga0501047_0138309 | |||
| 1363 | Ga0501047_0247737 | |||
| 1364 | Ga0501047_0324030 | |||
| 1365 | Ga0501047_0574452 | |||
| 1366 | Ga0501047_1072407 | |||
| 1367 | Ga0501048_0002751 | |||
| 1368 | Ga0501048_0035516 | |||
| 1369 | Ga0501048_0060544 | |||
| 1370 | Ga0501048_0205513 | |||
| 1371 | Ga0501048_0318539 | |||
| 1372 | Ga0501068_0498804 | |||
| 1373 | Ga0501069_0003306 | |||
| 1374 | Ga0501069_0244570 | |||
| 1375 | Ga0501070_0008646 | |||
| 1376 | Ga0501070_0060438 | |||
| 1377 | Ga0501070_0109465 | |||
| 1378 | Ga0501070_0984550 | |||
| 1379 | Ga0501071_0000158 | |||
| 1380 | Ga0501072_0001877 | |||
| 1381 | Ga0501072_0058288 | |||
| 1382 | Ga0501072_0127896 | |||
| 1383 | Ga0501073_0220833 | |||
| 1384 | Ga0501073_0727191 | |||
| 1385 | Ga0501074_0066386 | |||
| 1386 | Ga0501074_0234010 | |||
| 1387 | Ga0501074_0426548 | |||
| 1388 | Ga0501074_0456449 | |||
| 1389 | Ga0501074_0505771 | |||
| 1390 | Ga0501075_0000210 | |||
| 1391 | Ga0501075_0162425 | |||
| 1392 | Ga0501075_0579316 | |||
| 1393 | Ga0501076_0000278 | |||
| 1394 | Ga0501076_1203403 | |||
| 1395 | Ga0501077_0000232 | |||
| 1396 | Ga0501079_0034701 | |||
| 1397 | Ga0501079_0051431 | |||
| 1398 | Ga0501079_1085517 | |||
| 1399 | Ga0501080_0008286 | |||
| 1400 | Ga0501080_0105003 | |||
| 1401 | Ga0501080_0193695 | |||
| 1402 | Ga0501080_0436443 | |||
| 1403 | Ga0501080_0953670 | |||
| 1404 | Ga0501080_1025761 | |||
| 1405 | Ga0501080_1162384 | |||
| 1406 | Ga0501081_0000478 | |||
| 1407 | Ga0501081_0023101 | |||
| 1408 | Ga0501083_0027089 | |||
| 1409 | Ga0501083_0257509 | |||
| 1410 | Ga0501083_0368851 | |||
| 1411 | Ga0501035_0060812 | |||
| 1412 | Ga0501035_0580516 | |||
| 1413 | Ga0501044_0000173 | |||
| 1414 | Ga0501044_0144801 | |||
| 1415 | Ga0501044_0149263 | |||
| 1416 | Ga0501044_0244415 | |||
| 1417 | Ga0501044_1138017 | |||
| 1418 | Ga0501044_1264886 | |||
| 1419 | Ga0501045_0001482 | |||
| 1420 | nmdc:mga05p37_18943_c1 | |||
| 1421 | nmdc:mga06r32_1364579_c1 | |||
| 1422 | nmdc:mga06r32_161069_c1 | |||
| 1423 | nmdc:mga06r32_409064_c1 | |||
| 1424 | nmdc:mga08y16_150188_c1 | |||
| 1425 | nmdc:mga08y16_688809_c1 | |||
| 1426 | nmdc:mga0n895_2250_c1 | |||
| 1427 | nmdc:mga0n895_2726_c1 | |||
| 1428 | nmdc:mga0n895_41842_c1 | |||
| 1429 | nmdc:mga0n895_756309_c1 | |||
| 1430 | nmdc:mga0n895_780334_c1 | |||
| 1431 | nmdc:mga0n895_91031_c1 | |||
| 1432 | nmdc:mga0rr50_107361_c1 | |||
| 1433 | nmdc:mga0rr50_550899_c1 | |||
| 1434 | nmdc:mga08x19_179937_c1 | |||
| 1435 | nmdc:mga08x19_359377_c1 | |||
| 1436 | nmdc:mga08x19_5419_c2 | |||
| 1437 | nmdc:mga0a205_26798_c1 | |||
| 1438 | nmdc:mga0a205_37865_c1 | |||
| 1439 | nmdc:mga0a205_684969_c1 | |||
| 1440 | nmdc:mga0a205_77206_c2 | |||
| 1441 | Ga0495601_0011260 | |||
| 1442 | Ga0495601_0020713 | |||
| 1443 | Ga0495601_0337193 | |||
| 1444 | Ga0495595_0002839 | |||
| 1445 | Ga0495619_0037089 | |||
| 1446 | Ga0495619_0042479 | |||
| 1447 | Ga0495619_0234534 | |||
| 1448 | Ga0495619_0239371 | |||
| 1449 | Ga0500595_118094 | |||
| 1450 | Ga0501084_0069166 | |||
| 1451 | Ga0501084_0187041 | |||
| 1452 | Ga0501084_1006113 | |||
| 1453 | Ga0587070_053073 | |||
| 1454 | Ga0587085_109672 | |||
| 1455 | Ga0587091_084522 | |||
| 1456 | Ga0501082_0031459 | |||
| 1457 | Ga0501082_0234341 | |||
| 1458 | Ga0501082_0248420 | |||
| 1459 | Ga0530510_0002585 | |||
| 1460 | Ga0530510_0074024 | |||
| 1461 | Ga0530510_0367950 | |||
| 1462 | Ga0530510_0802319 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wgb-assembly1.cif.gz_A | crystal structure of a probable flavoprotein from thermus thermophilus hb8 | 0.881 | 1 | 143 |
| 3zoe-assembly1.cif.gz_A | crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde | 0.8648 | 13 | 143 |
| 3zoh-assembly1.cif.gz_D | crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound 1-cyclohex-2-enone | 0.8566 | 13 | 143 |
| 3zoe-assembly1.cif.gz_B | crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde | 0.8562 | 13 | 140 |
| 4f07-assembly5.cif.gz_J | structure of the styrene monooxygenase flavin reductase (smob) from pseudomonas putida s12 | 0.8409 | 7 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wgbA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8864 | 2 | 143 | 2.30.110.10 |
| 3zoeB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8562 | 13 | 140 | 2.30.110.10 |
| 2d5mA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8407 | 14 | 142 | 2.30.110.10 |
| 4l82C00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8288 | 1 | 143 | 2.30.110.10 |
| 4f07E00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.825 | 7 | 144 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D8PIH3-F1-model_v4 | Flavin reductase | 0.9686 | 18 | 142 |
GO:0010181
GO:0042602 |
| AF-A0A846DZL6-F1-model_v4 | Flavin reductase family protein | 0.9617 | 30 | 168 |
GO:0010181
GO:0042602 |
| AF-A0A3C0EDY6-F1-model_v4 | Flavin reductase | 0.9538 | 29 | 168 |
GO:0010181
GO:0042602 |
| AF-A0A3C0EDY6-F1-model_v4 | Flavin reductase | 0.9468 | 29 | 168 |
GO:0010181
GO:0042602 |
| AF-A0A846DZL6-F1-model_v4 | Flavin reductase family protein | 0.9407 | 30 | 168 |
GO:0010181
GO:0042602 |